The URL can be used to link to this page

20200901 City Council Agenda Packet Agenda City of Vernon Regular City Council Meeting Tuesday, September 01, 2020, 09:00 AM City Hall, Council Chamber 4305 Santa Fe Avenue Vernon, California Leticia Lopez, Mayor Melissa Ybarra, Mayor Pro Tem William Davis, Council Member Carol Menke, Council Member Diana Gonzales, Council Member THIS MEETING WILL BE CONDUCTED PURSUANT TO GOVERNOR NEWSOM'S EXECUTIVE ORDER N-29-20. The public is encouraged to view the meeting at http://www.cityofvernon.org/webinar. You may submit comments to PublicComment@ci.vernon.ca.us with the subject line “September 1, 2020 City Council Meeting Public Comment Item #__.” Comments received prior to 8 a.m., Tuesday, September 1, 2020, will be read into the record. CALL TO ORDER FLAG SALUTE ROLL CALL APPROVAL OF THE AGENDA PUBLIC COMMENT At this time the public is encouraged to address the City Council on any matter that is within the subject matter jurisdiction of the City Council. The public will also be given a chance to comment on matters which are on the posted agenda during City Coun cil deliberation on those specific matters. Regular City Council Meeting Agenda Page 2 of 7 September 01, 2020 PUBLIC HEARINGS 1. Public Works Amendment to Municipal Code Chapter 26 - Zoning Map Recommendation: A. Find that the proposed action is exempt under the California Environmental Quality Act (CEQA) review, because it is a continuing administrative activity that will not result in any direct or indirect physical changes in the environment, and therefore do es not constitute a “project” as defined by CEQA Guidelines Section 15378, and to the extent the property owner seeks to engage in actual physical construction or development, such would be subject to separate and independent CEQA review and analysis; and B. Introduce and conduct first reading of Ordinance No. 1270 amending the Zoning Map in Chapter 26 of the Municipal Code to include the properties located at 2328, and at 2332/2334 E. Vernon Avenue in the Housing Overlay Zone, and direct staff to schedule second reading and adoption for the September 15, 2020 City Council meeting. 1. Ordinance No. 1270 2. July 7, 2020 Agenda Report 3. April 7, 2015 Agenda Report (including attachments) 4. Proposed Housing Overlay Zone 5. Notice of Public Hearing- Zoning Map Change CONSENT CALENDAR All matters listed on the Consent Calendar are to be approved with one motion. Items may be removed from the Consent Calendar by any member of the Council. Those items removed will be considered immediately after the Consent Calendar. 2. City Clerk Approval of Minutes Recommendation: Approve the August 4, 2020 Regular City Council Minutes. 1. 20200804 City Council Minutes 3. City Clerk Claims Against the City Recommendation: Receive and file the claims submitted by: 1) Leydi Sanchez in the amount of $3,361.84; and 2) Edwin Silveira in the minimum amount of $3,925.93. 1. Sanchez, Leydi 08-05-2020 2. Silveira, Edwin 08-20-20 Regular City Council Meeting Agenda Page 3 of 7 September 01, 2020 4. Finance/Treasury City Payroll Warrant Register Recommendation: Approve City Payroll Warrant Register No. 770, for the period of July 1 through July 31, 2020, which totals $4,258,150.66 and consists of ratification of direct deposits, checks and taxes totaling $2,996,148.77 and ratification of checks and electronic fund transfers (EFT) for payroll related disbursements totaling $1,262,001.89 paid through operating bank account. 1. City Payroll Account Warrant Register No. 770 5. Finance/Treasury Operating Account Warrant Register Recommendation: Approve Operating Account Warrant Register No. 51, for the period of July 19 through August 15, 2020, which totals $10,223,414.19 and consists of ratification of electronic payments totaling $9,796,376.07 and ratification of the issuance of early checks totaling $427,038.12. 1. Operating Account Warrant Register No. 51 6. Fire Department Fire Department Activity Report Recommendation: Receive and file the June 2020 Report. 1. Fire Department Activity Report - 06/01/20 to 06/30/20 7. Police Department Police Department Activity Report Recommendation: Receive and file the June 2020 Report. 1. Police Department Activity Report – June 2020 8. Public Works Public Works Monthly Building Report Recommendation: Receive and file the July 2020 Building Report. 1. Public Works Department July 2020 Building Report 9. City Administration Fiscal Year 2019/2020 Vernon CommUNITY Fund Grant Committee Activity Report Recommendation: Receive and file the report, as it is being provided for informational purposes only. 1. FY 2019/2020 Grantee Awards List Regular City Council Meeting Agenda Page 4 of 7 September 01, 2020 10. Police Department Office of Traffic Safety Selective Traffic Enforcement Program (STEP) Grant Agreement Recommendation: Approve and authorize the City Administrator, Police Chief, and Police Sergeant to execute an agreement between the City of Vernon and the Office of Traffic Safety, in substantially the same form as submitted for a one (1) year term, for participation in the Selective Traffic Enforcement Program (STEP) with an effective date of October 1, 2020. 1. Office of Traffic Safety STEP Grant Agreement 11. City Administration Managed Print Services Agreement with MRC Smart Technology Solutions and Xerox Recommendation: A. Approve and authorize the City Administrator to execute a Services Agreement with MRC Smart Technology Solutions, in substantially the same form as submitted, for a three-year term in an amount not-to-exceed $206,360 ($68,786.82 per year) for Managed Print Services (MPS) with an effective date of September 20 , 2020; and B. Approve and authorize the City Administrator to execute a related Lease Agreement with Xerox, in substantially the same form as submitted, for a three -year term in an amount not-to-exceed $83,640 ($27,879.84 per year) for MPS with an effective date of September 20, 2020. 1. Services Agreement with MRC Smart Technology Solutions 2. Lease Agreement with Xerox NEW BUSINESS 12. Health and Environmental Control Department Memorandum of Understanding with the University of Southern California (USC) for Corona Virus-19 (COVID-19) Vaccine Trial Recommendation: Approve the Memorandum of Understanding between the City of Vernon and USC, in substantially the same form as submitted, for COVID-19 vaccine trial. 1. MOU with USC Regular City Council Meeting Agenda Page 5 of 7 September 01, 2020 13. Public Works Contract for Fire Station Remodeling Required for Transition to the Consolidated Fire Protection District of Los Angeles County (LA County Fire) Recommendation: A. Find that approval of the proposed action is categorically exempt from California Environmental Quality Act (CEQA) review, in accordance with CEQA Guidelines Sections 15301 - 15332 for Class 1: Existing Facilities; B. Accept the bid from Fasone Construction, Inc.; C. Approve and authorize the City Administrator to execute a contract with Fasone, Construction Inc. in substantially the same form as submitted, in an amount not to exceed $547,034.72 f or the required remodeling of Fire Station 76; and D. Authorize a contingency amount of $25,000 in the event of an unexpected changed condition in the project and grant authority to the City Administrator to issue Change Orders for an amount up to the contingency amount, if necessary. 1. CS-1266 - Fire Station 76 Dormitory, Kitchen & Bathroom Improvements 2. LA County Fire Conversion Cost Estimates ORAL REPORTS City Administrator Reports on Activities and other Announcements. City Council Reports on Activities (including AB1234), Announcements, or Directives to Staff. CLOSED SESSION 14. CONFERENCE WITH LEGAL COUNSEL - EXISTING LITIGATION Government Code Section 54956.9(d)(1) A. Bicent (California) Malburg LLC et al. v. City of Vernon et al., Los Angeles Superior Court Case No. 19STCV08859 and JAMS Reference No. 1100107175 B. City of Vernon v. Bicent (California) Malburg LLC Los Angeles Superior Court Case No. 19STCP02411 and JAMS Reference No. 1220062657 C. Christina Sanchez, et al. v. City of Vernon, et al. Los Angeles Superior Court Case No. 19STCV38779 Regular City Council Meeting Agenda Page 6 of 7 September 01, 2020 15. CONFERENCE WITH LEGAL COUNSEL – ANTICIPATED LITIGATION Significant Exposure to Litigation Government Code Section 54956.9(d)(2) Number of potential cases: 1 Facts and Circumstances: Pursuant to Government Code Section 54956.9(e)(3), the City has received written communication threatening litigation on behalf of former employee Jerrick Torres related to his termination, in the form of a Complaint of Discrimination filed with the Department of Fair Employment and Housing (DFEH). The DFEH Complaint (DFEH No. 201910-08099730) is made available for public inspection pursuant to Section 54957.5. 16. CONFERENCE WITH LEGAL COUNSEL – ANTICIPATED LITIGATION Government Code Section 54956.9(d)(4) Consideration of initiation of litigation – One matter CLOSED SESSION REPORT ADJOURNMENT I hereby certify under penalty of perjury under the laws of the State of California, that the foregoing agenda was posted on the bulletin board at the main entrance of the City of Vernon City Hall, located at 4305 Santa Fe Avenue, Vernon, California, and o n the City’s website, not less than 72 hours prior to the meeting set forth on this agenda. Dated this 27th day of August, 2020. By: __________________________________ Sandra Dolson, Administrative Secretary Regular City Council Meeting Agenda Page 7 of 7 September 01, 2020 Guide to City Council Proceedings Meetings of the City Council are held the first and third Tuesday of each month at 9:00 a.m. and are conducted in accordance with Rosenberg's Rules of Order (Vernon Municipal Code Section 2.1-1). Copies of all agenda items and back-up materials are available for review in the City Clerk Department, Vernon City Hall, 4305 Santa Fe Avenue, Vernon, California, and are available for public inspection during regular business hours, Monday through Thursday, 7:00 a.m. to 5:30 p.m. Agenda reports may be reviewed o n the City's website at www.cityofvernon.org or copies may be purchased for $0.10 per page. Disability-related services are available to enable persons with a disability to participate in this meeting, consistent with the Americans with Disabilities Act (ADA). In compliance with ADA, if you need special assistance, please contact the City Clerk department at CityClerk@ci.vernon.ca.us or (323) 583-8811 at least 48 hours prior to the meeting to assure arrangements can be made. The Public Comment portion of the agenda is for members of the public to present items, which are not listed on the agenda but are within the subject matter jurisdiction of the City Council. The City Council cannot take action on any item that is not on the agenda but matters raised under Public Comment may be referred to staff or scheduled on a future agenda. Comments are limited to three minutes per speaker unless a different time limit is announced. Speaker slips are available at the entrance to the Council Chamber. Public Hearings are legally noticed hearings. For hearings involving zoning matters, the applicant and appellant will be given 15 minute s to present their position to the City Council. Time may be set aside for rebuttal. All other testimony shall follow the rules as set for under Public Comment. If you challenge any City action in court, you may be limited to raising only those issues you or someone else raised during the public hearing, or in written correspondence delivered to the City Clerk at or prior to the public hearing. Consent Calendar items may be approved by a single motion. If a Council Member or the public wishes to discuss an item, it may be removed from the calendar for individual consideration. Council Members may indicate a negative or abstaining vote on any individual item by so declaring prior to the vote on the motion to adopt the Consent Calendar. Items excluded from th e Consent Calendar will be taken up following action on the Consent Calendar. Public speakers shall follow the guidelines as set forth under Public Comment. New Business items are matters appearing before the Council for the first time for formal action. Those wishing to address the Council on New Business items shall follow the guidelines for Public Comment. Closed Session allows the Council to discuss specific matters pursuant to the Brown Act, Government Code Section 54956.9. Based on the advice of the City Attorney, discussion of these matters in open session would prejudice the position of the City. Following Closed Session, the City Attorney will provide an oral report on any reportable matters discussed and actions taken. At the conclusion of Closed Session, the Council may continue any item listed on the Closed Session agenda to the Open Session agenda for discussion or to take formal action as it deems appropriate. City Council Agenda Item Report Agenda Item No. COV-306-2020 Submitted by: Daniel Wall Submitting Department: Public Works Meeting Date: September 1, 2020 SUBJECT Amendment to Municipal Code Chapter 26 - Zoning Map Recommendation: A. Find that the proposed action is exempt under the California Environmental Quality Act (CEQA) review, because it is a continuing administrative activity that will not result in any direct or indirect physical changes in the environment, and therefore does not constitute a “project” as defined by CEQA Guidelines Section 15378, and to the extent the property owner seeks to engage in actual physical construction or development, such would be subject to separate and independent CEQA review and analysis; and B. Introduce and conduct first reading of Ordinance No. 1270 amending the Zoning Map in Chapter 26 of the Municipal Code to include the properties located at 2328, and at 2332/2334 E. Vernon Avenue in the Housing Overlay Zone, and direct staff to schedule second reading and adoption for the September 15, 2020 City Council meeting. Background: On July 7, 2020, the City Council conducted a public hearing to consider adoption of Ordinance No. 1270 (Attachment 1) amending the Zoning Map in Chapter 26 of the Municipal Code to include the properties located at 2328, and at 2332/2334 E. Vernon Avenue in the Housing Overlay Zone (Attachment 2). The hearing was continued to July 21, 2020 to provide staff the opportunity to present information as to why these properties were not included in the Housing Overlay Zone when the map was last modified in 2015 (Attachment 3). Introduction of the Ordinance failed by a 2 -2 vote (Mayor Pro Tem Ybarra could not participate in the matter and recused herself from voting on this item). In a conversation, Former Director Samuel Kevin Wilson indicated that the Housing Overlay Zone was created to allow for the construction of the Vernon Village Apartments and that the subject properties were not included in the Zone because their continued residential use would be grandfathered under the zoning code being adopted at the time. A review of the April 7, 2015 staff report adopting the current Zoning Map indicates that staff had concerns "… with compatibility issues with the introduction of any housing when industrial prevail (sic) uses throughout Vernon. Because of the range of uses allowed in the Industrial zone, at any time a new industrial use could be established that might pose hazards to residential uses. The Housing Overlay gives the City the ability to assess any proposed housing development application on a case-by-case basis and only apply the overlay to properties where it makes good sense to do so, such as the recent Meta Housing development adjacent to existing residential uses in the city of Maywood.” Those concerns would not have applied to the subject properties located at 2328, and at 2332/2334 E. Vernon Avenue as, at the time, they were being used exclusively as residences, a use that is currently an allowed (grandfathered), non-conforming use. These properties are adjacent to Vernon City School, and are across the street from the 10 City-owned homes on Furlong Place (Attachment 4). Given the residential and educational uses of the surrounding properties and the historic residential use of the subject properties, there is minimal potential for conflicts between existing residential and industrial uses at this location. Based on a conversation with staff from Bank of America, banks do not lend on residential properties that are outside of a residential zone. This means that if these properties were to be sold without Housing Overlay Zoning, a buyer would not be able to obtain a residential mortgage and that these properties would likely be converted to a nonresidential use. On July 21, 2020, during the continued Public Hearing from the July 7 meeting, the City Council raised concerns about the compatibility of the proposed zoning change with the General Plan and the ordinance failed to be approved in a two to two vote. Staff is bringing this item back to the City Council in order to address questions that were raised about making the amendments to the Zoning Map in the context of the General Plan. At the previous City Council meeting there had been discussion about the precedence of the General Plan versus the Zoning Ordinance (Chapter 26 of the Vernon Municipal Code). This is addressed on page 12 of the Introduction Section of the General Plan: “The Zoning Ordinance is the governing land use law for the City…” and again in Section 2.4 of the Land Use Element of the General Plan: “2.4 Relationship of Land Use Policy to the Zoning Ordinance The Zoning Ordinance is the primary implementation tool for the Land Use Element. Both the Element and the Ordinance describe the distribution and intensity limits for development. Whereas the Land Use Element sets forth the broad policies for future development, the Zoning Ordinance provides specific detail, enforcement mechanisms, development standards, and provides for deviations through Conditional Use Permits, Variances, and amendments to the Zoning Ordinance.” This establishes that the Zoning Ordinance has precedence over the General Plan and that the General Plan can be deviated from through amendments to the Zoning Ordinance. The General Plan also establishes the goals for land use in the City and a goal that is stated multiple times is the preservation of existing housing. Page 46 of the Housing Element in the General Plan: “…the City wants to conserve and preserve all existing 31 housing units in the City.” And Section 5.1 on page 47 of the Housing Element in the General Plan: “The major focus of housing policy in Vernon is to preserve the existing housing stock in the City and to ensure that existing housing in the City is well maintained.” And Policy 1.3 on page 49 of the Housing Element in the General Plan: “Continued Appropriateness: The City's primary housing goal is to preserve the existing housing units. The City is committed to mitigating residential displacement impacts, should they occur.” And Policy 2.1 on page 50 of the Housing Element in the General Plan: “Provide for the retention of existing residential units in the City that are economically and physically sound.” And again on page 51 of the Housing Element in the General Plan: “GOAL H-2: Maintain all existing dwelling units within the City. POLICY H-2.1: Provide for the retention of existing residential units in the City that are economically and physically sound.” The preservation of existing housing was and continues to be important to the continued existence of the City of Vernon. When the General Plan was last updated there were 31 housing units in the City of Vernon. Twenty-six of those were owned by the City and five were privately owned. Of the five privately owned units in existence at that time, only three remain housing today. The other two are currently vacant and slated to be demolished to make room for a warehouse. In order to help ensure that the three remaining housing units are preserved, it is important that residential financing be available for future residential purchasers or for future capital maintenance. Ordinance No. 1270 revises the Zoning Map in Chapter 26 of the Vernon Municipal Code to include the properties located at 2328, and at 2332/2334 E. Vernon Avenue in the Housing Overlay Zone. Pursuant to Municipal Code Section 26.6.6-3, the public hearing was legally noticed by publishing in the Los Angeles Wave, posting the notice on the City Hall posting board and website on August 20, 2020 and mailing public hearing notices to properties within a 300 foot radius of the subject property on August 20, 2020 (Attachment 5). Fiscal Impact: There is no fiscal impact associated with this report. Attachments: 1. Ordinance No. 1270 2. July 7, 2020 Agenda Report 3. April 7, 2015 Agenda Report (including attachments) 4. Proposed Housing Overlay Zone 5. Notice of Public Hearing- Zoning Map Change ORDINANCE NO. 1270 AN ORDINANCE OF THE CITY COUNCIL OF THE CITY OF VERNON AMENDING CHAPTER 26 MODIFYING THE COMPREHENSIVE ZONING MAP OF THE CITY OF VERNON TO INCLUDE THE PROPERTIES LOCATED AT 2328 AND 2332/2334 E. VERNON AVE, VERNON, CALIFORNIA 90058 IN THE HOUSING OVERLAY ZONE SECTION 1. Recitals. A.The City of Vernon (City) is a municipal corporation and a chartered city of the State of California, organized and existing under its Charter and the Constitution of the State of California. B.On January 16, 2008, the City Council of the City of Vernon adopted Ordinance No. 1227, adopting amendments to the comprehensive zoning ordinance of the City of Vernon; establishing zoning districts in the City and regulating and restricting the use, size, and the location of buildings and improvements on land; the use of land and open space; adopting a map showing said zoning districts, defining the terms used in the ordinance; providing for its adjustment, amendment and enforcement (Zoning Ordinance). C.By memorandum dated July 7, 2020, the Director of Public Works recommended that the Zoning Map in Chapter 26 of the Municipal Code be amended. D.A public hearing was held on July 7, 2020, and was continued to the July 21, 2020, City Council meeting. At that meeting, introduction of Ordinance No. 1270 was motioned but failed. E.By memorandum dated September 1, 2020, the Director of Public Works has recommended that the Zoning Map in Chapter 26 of the Municipal Code be amended to include the properties located at 2328 and 2332/2334 E. Vernon Ave, Vernon, California 90058 in the Housing Overlay Zone. F.A duly-noticed public hearing has been held to consider the proposed ordinance changes, and public testimony has been received and considered. THE CITY COUNCIL OF THE CITY OF VERNON HEREBY ORDAINS: SECTION 2. The City Council of the City of Vernon hereby finds and determines that the above recitals are true and correct and are a substantial part of this ordinance. SECTION 3. This ordinance was assessed in accordance with the authority and criteria contained in the California Environmental Quality Act (CEQA), the State CEQA Guidelines, and the environmental regulations of the City. The City Council hereby finds Ordinance No. 1270 Page 2 of 4 _______________________ that this ordinance is not subject to CEQA review because the adoption of this ordinance is a continuing administrative activity that will not result in any direct or indirect physical changes in the environment, and therefore does not constitute a “project” as defined by CEQA Guidelines section 15378, and to the extent the property owner seeks to engage in actual physical construction or development, such would be subject to separate and independent CEQA review and analysis. SECTION 4. The City Council of the City of Vernon hereby approves and adopts the Zoning Map in Chapter 26 of the Municipal Code to include the properties located at 2328 and 2332/2334 E. Vernon Ave, Vernon, California 90058 in the Housing Overlay Zone (Attachment A). SECTION 5. Any provision of the Vernon Municipal Code or appendices thereto inconsistent with the provisions of this Ordinance, to the extent of such inconsistencies and no further are repealed or modified to that extent necessary to affect the provisions of this Ordinance. SECTION 6. If any section, subsection, paragraph, sentence, clause, phrase, or portion thereof, of this Ordinance is declared by a court of competent jurisdiction to be unconstitutional or otherwise invalid, such decision shall not affect the validity of the remaining portions of this Ordinance. The City Council hereby declares that it would have adopted this Ordinance, and each section, subsection, paragraph, sentence, clause, phrase, or portion thereof, irrespective of the fact that any one or more sections, subsections, paragraphs, sentences, clauses, phrases, or portions thereof, be declared invalid or unconstitutional. To this end, the provisions of this Ordinance are declared to be severable. Ordinance No. 1270 Page 3 of 4 _______________________ SECTION 7. The City Clerk shall certify the adoption and publish this ordinance as required by law. APPROVED AND ADOPTED this __ day of _____, 2020. ______________________ LETICIA LOPEZ, Mayor ATTEST: LISA POPE, City Clerk (seal) APPROVED AS TO FORM: _________________________________ ARNOLD M. ALVAREZ-GLASMAN, Interim City Attorney Ordinance No. 1270 Page 4 of 4 _______________________ ATTACHMENT A City Council Agenda Item Report Agenda Item No. COV-230-2020 Submitted by: Daniel Wall Submitting Department: Public Works Meeting Date: July 7, 2020 SUBJECT Amendment to Municipal Code Chapter 26 - Zoning Map Recommendation: A. Find that the proposed action is exempt under the California Environmental Quality Act (CEQA) review, because it is a continuing administrative activity that will not result in any direct or indirect physical changes in the environment, and therefore does not constitute a “project” as defined by CEQA Guidelines Section 15378, and to the extent the property owner seeks to engage in actual physical construction or development, such would be subject to separate and independent CEQA review and analysis; and B. Introduce and conduct first reading of Ordinance No. 1270 amending the Zoning Map in Chapter 26 of the Municipal Code to include the properties located at 2328, and at 2332/2334 E. Vernon Avenue in the Housing Overlay Zone, and direct staff to schedule second reading and adoption for the July 21, 2020 City Council meeting. Background: The properties located at 2328, and at 2332/2334 E. Vernon Avenue are currently used exclusively as residences. The residential use of these properties preceded the the current zoning code and as such this use is currently an allowed, non-conforming use. The owner of these properties has requested that the property be rezoned to reflect the current residential use. At present, residential development is only allowed in the Housing (H) Overlay Zone which was created to accommodate housing at limited and specific areas of the City. The Housing Overlay Zone was specifically created to allow for the construction of the Vernon Village Park Apartments and this is the only property that currently has this zoning designation. The only other privately owned housing In Vernon is located at 2328, and at 2332/2334 E. Vernon Avenue. Designating these properties to be in the Housing Overlay Zone can help preserve their residential use. The existing residence at 2328 E. Vernon, built in 1985, is 35 years-old, and the residence at 2332/2334 E. Vernon, built in 1966, is 54 years-old. These properties are adjacent to Vernon City School, and are across the street from the 10 City-owned homes on Furlong Place. Given the residential and educational uses of the surrounding properties and the historic residential use of the subject properties, there is minimal potential for conflicts between existing residential and industrial uses at this location. Ordinance No. 1270 revises the Zoning Map in Chapter 26 of the Vernon Municipal Code to include the properties located at 2328, and at 2332/2334 E. Vernon Avenue in the Housing Overlay Zone. Pursuant to Municipal Code Section 26.6.6-3, the public hearing was legally noticed by publishing in the Los Angeles Wave, posting the notice on the City Hall posting board and website on June 25, 2020 and mailing public hearing notices to properties within a 300' radius of the subject property on June 24, 2020. Fiscal Impact: There is no fiscal impact associated with this report. Attachments: 1. Ordinance No. 1270 Amending Zoning Map 2. 20200707 Notice of Public Notice Hearing - Zoning Map Amendment ORDINANCE NO. 1270 AN ORDINANCE OF THE CITY COUNCIL OF THE CITY OF VERNON AMENDING CHAPTER 26 MODIFYING THE COMPREHENSIVE ZONING MAP OF THE CITY OF VERNON TO INCLUDE THE PROPERTIES LOCATED AT 2328 AND 2332/2334 E. VERNON AVE, VERNON, CALIFORNIA 90058 IN THE HOUSING OVERLAY ZONE SECTION 1. Recitals. A.The City of Vernon (City) is a municipal corporation and a chartered city of the State of California, organized and existing under its Charter and the Constitution of the State of California. B.On January 16, 2008, the City Council of the City of Vernon adopted Ordinance No. 1227, adopting amendments to the comprehensive zoning ordinance of the City of Vernon; establishing zoning districts in the City and regulating and restricting the use, size, and the location of buildings and improvements on land; the use of land and open space; adopting a map showing said zoning districts, defining the terms used in the ordinance; providing for its adjustment, amendment and enforcement (Zoning Ordinance). C.By memorandum dated July 7, 2020, the Director of Public Works has recommended that the Zoning Map in Chapter 26 of the Municipal Code be amended to include the properties located at 2328 and 2332/2334 E. Vernon Ave, Vernon, California 90058 in the Housing Overlay Zone. D.A duly-noticed public hearing has been held to consider the proposed ordinance changes, and public testimony has been received and considered. THE CITY COUNCIL OF THE CITY OF VERNON HEREBY ORDAINS: SECTION 2. The City Council of the City of Vernon hereby finds and determines that the above recitals are true and correct and are a substantial part of this ordinance. SECTION 3. This ordinance was assessed in accordance with the authority and criteria contained in the California Environmental Quality Act (CEQA), the State CEQA Guidelines, and the environmental regulations of the City. The City Council hereby finds that this ordinance is not subject to CEQA review because the adoption of this ordinance is a continuing administrative activity that will not result in any direct or indirect physical changes in the environment, and therefore does not constitute a “project” as defined by CEQA Guidelines section 15378, and to the extent the property owner seeks to engage in actual physical construction or development, such would be subject to separate and independent CEQA review and analysis. Ordinance No. 1270 Page 2 of 3 _______________________ SECTION 4. The City Council of the City of Vernon hereby approves and adopts the Zoning Map in Chapter 26 of the Municipal Code to include the properties located at 2328 and 2332/2334 E. Vernon Ave, Vernon, California 90058 in the Housing Overlay Zone (Attachment A). SECTION 5. Any provision of the Vernon Municipal Code or appendices thereto inconsistent with the provisions of this Ordinance, to the extent of such inconsistencies and no further are repealed or modified to that extent necessary to affect the provisions of this Ordinance. SECTION 6. If any section, subsection, paragraph, sentence, clause, phrase, or portion thereof, of this Ordinance is declared by a court of competent jurisdiction to be unconstitutional or otherwise invalid, such decision shall not affect the validity of the remaining portions of this Ordinance. The City Council hereby declares that it would have adopted this Ordinance, and each section, subsection, paragraph, sentence, clause, phrase, or portion thereof, irrespective of the fact that any one or more sections, subsections, paragraphs, sentences, clauses, phrases, or portions thereof, be declared invalid or unconstitutional. To this end, the provisions of this Ordinance are declared to be severable. SECTION 7. The City Clerk shall certify the adoption and publish this ordinance as required by law. APPROVED AND ADOPTED this __ day of _____, 2020. ______________________ LETICIA LOPEZ, Mayor ATTEST: LISA POPE, City Clerk (seal) APPROVED AS TO FORM: _________________________________ ARNOLD M. ALVAREZ-GLASMAN, Interim City Attorney Ordinance No. 1270 Page 3 of 3 _______________________ ATTACHMENT A City of Vernon NOTICE OF CITY COUNCIL PUBLIC HEARING The City Council of the City of Vernon will conduct a public hearing, which you may attend, at Vernon City Hall, City Council Chamber, 4305 Santa Fe Avenue, Vernon, CA 90058, on Tuesday, July 7, 2020, at 9:00 a.m. (or as soon thereafter as the matter can be heard), to: Consider adoption of an ordinance amending Chapter 26 modifying the Comprehensive Zoning Map of the City of Vernon to include the properties located at 2328 and 2332/2334 E. Vernon Ave, Vernon, California 90058 in the Housing Overlay Zone. The proposed ordinance will be available for public review on the City’s website once the agenda for the meeting is posted or from the City Clerk at CityClerk@ci.vernon.ca.us or 323-583-8811, ext. 546. Please send your comments or questions to: Daniel Wall, Director of Public Works City of Vernon 4305 Santa Fe Avenue, Vernon, CA 90058 (323) 583-8811 Ext. 305 Email: dwall@ci.vernon.ca.us PROPOSED CEQA FINDING: Find that the proposed action is exempt under the California Environmental Quality Act (“CEQA”) review, because it is continuing administrative activity t hat will not result in any direct or indirect physical changes in the environment, and therefore does not constitute a “project” as defined by CEQA Guidelines section 15378, and to the extent the property owner seeks to engage in actual physical construction or development, such would be subject to separate and independent CEQA review and analysis. If you challenge the adoption of the proposed ordinance approving and authorizing the amendment of the Comprehensive Zoning Map of the City of Vernon to include the properties located at 2328 and 2332/2334 E. Vernon Ave. Vernon California 90058 in the Housing Overlay Zone or any provision thereof in court, you may be limited to raising only those issues you or someone else raised at the hearing described in this notice or in written correspondence delivered to the City of Vernon at, or prior to, the meeting. In compliance with the Americans with Disabilities Act (ADA), if you need special assistance to participate in the meeting, please contact the Office of the City Clerk at (323) 583-8811 ext. 546. The hearing may be continued, adjourned, or cancelled and rescheduled to a stated time and place without further notice of a public hearing. Dated: June 18, 2020 Lisa Pope, City Clerk Publish: June 25, 2020 4305 Santa Fe Avenue Vernon, CA 90058 (323) 583-8811 Vernon, CA 90058 ( 3 2 3 ) 5 8 3 - 8 8 1 1 Attachment A City of Vernon General Plan CITY OF VERNON GENERAL PLAN Adopted December 3, 2007 Amended February 23, 2009 Amended February 5, 2013 Draft for Public Review March 2015 Vernon General Plan Table of Contents Table of Contents - i TABLE OF CONTENTS Page INTRODUCTION Vernon – Founding of the City and Establishing It’s Mission ................................... 1 Vision for the Future ........................................................................................................ 4 Purpose and Scope of the Plan ....................................................................................... 5 Public Involvement in Developing the General Plan .................................................. 6 Relationship of Vernon General Plan to State Requirements for Plans .................... 6 Related Plans and Programs ........................................................................................... 7 LAND USE 1.0 Purpose and Focus ........................................................................................................... 1 1.1 Purpose of this Element ...................................................................................... 1 1.2 Focus ...................................................................................................................... 2 1.3 Flood Management ............................................................................................. 2 2.0 Land Use Plan................................................................................................................... 3 2.1 Land Use Terms and Concepts .......................................................................... 3 2.2 Land Use Designations and Land Use Policy Map ....................................... 5 2.3 Implications of Land Use Policy ........................................................................ 8 2.4 Relationship of Land Use Policy to the Zoning Ordinance ......................... 10 3.0 Goals and Policies ......................................................................................................... 10 CIRCULATION AND INFRASTRUCTURE ELEMENT 1.0 Purpose and Focus ........................................................................................................... 1 1.1 Purpose ................................................................................................................. 1 1.2 Focus ...................................................................................................................... 2 2.0 Circulation Plan ............................................................................................................... 2 2.1 Regional Circulation ........................................................................................... 2 2.2 Vernon’s Street System ....................................................................................... 4 2.3 Off-Street Parking and Loading Facilities ...................................................... 13 2.4 Other Transportation Modes ........................................................................... 14 3.0 Meeting Infrastructure Needs ..................................................................................... 15 3.1 Water and Wastewater ..................................................................................... 15 3.2 Storm Drainage .................................................................................................. 17 3.3 Electrical Generation and Distribution ........................................................... 18 3.4 Communications and Information Technology ............................................ 18 3.5 Gas System ......................................................................................................... 19 Vernon General Plan Table of Contents Table of Contents - ii Page 4.0 Goals and Policies ......................................................................................................... 19 2014-2021 HOUSING ELEMENT 1.0 Introduction ...................................................................................................................... 1 1.1 State Requirement ............................................................................................... 3 1.2 Relation to Other General Plan Elements ........................................................ 4 1.3 Sources of Information ....................................................................................... 4 1.4 Public Participation ............................................................................................. 5 2.0 Housing Needs Assessment .......................................................................................... 8 2.1 Population and Housing Trends ....................................................................... 8 2.2 Housing Characteristics ...................................................................................... 9 3.0 Housing Constraints ..................................................................................................... 18 3.1 Governmental Constraints ............................................................................... 18 3.2 Non-governmental Constraints to Housing .................................................. 29 4.0 Housing Opportunities ................................................................................................ 38 5.0 Housing Plan .................................................................................................................. 47 5.1 Evaluation of Previous Accomplishments ..................................................... 47 5.2 Goals and Policies .............................................................................................. 51 5.3 Programs ............................................................................................................. 52 5.4 Redevelopment Agency Dissolution .............................................................. 57 SAFETY ELEMENT 1.0 Purpose and Focus ........................................................................................................... 1 1.1 Purpose ................................................................................................................. 1 1.2 Focus ...................................................................................................................... 1 2.0 Identifying and Guarding Against Hazards .............................................................. 2 2.1 Natural Hazards .................................................................................................. 4 2.2 Human-caused Hazards ..................................................................................... 9 3.0 Goals and Policies ......................................................................................................... 10 RESOURCES ELEMENT 1.0 Purpose and Focus ........................................................................................................... 1 1.1 Purpose ................................................................................................................. 1 1.2 Focus ...................................................................................................................... 2 Vernon General Plan Table of Contents Table of Contents - iii 2.0 Identifying and Protecting Local Resources .............................................................. 2 2.1 Water Quality and Supply ................................................................................. 2 2.2 Air Quality ............................................................................................................ 4 2.3 Global Warming .................................................................................................. 6 2.4 Energy Supplies ................................................................................................... 7 2.5 Open Space ........................................................................................................... 7 2.6 Cultural Resources .............................................................................................. 8 3.0 Goals and Policies ........................................................................................................... 9 NOISE ELEMENT 1.0 Purpose and Focus ........................................................................................................... 1 1.1 Purpose ................................................................................................................. 1 1.2 Focus ...................................................................................................................... 1 2.0 About Noise ...................................................................................................................... 2 2.1 Noise Metrics ....................................................................................................... 2 2.2 Noise and Health Effects .................................................................................... 5 2.3 Community Noise Standards ............................................................................ 5 3.0 Noise Environment in 2007 ............................................................................................ 7 3.1 2007 CNEL Contours .......................................................................................... 8 3.2 Transportation Noise Sources ............................................................................ 8 3.3 Industrial Noise Sources ................................................................................... 11 4.0 Future Noise Environment .......................................................................................... 12 5.0 Goals and Policies ......................................................................................................... 12 Appendices Appendix A: Implementation Plan Appendix B: Glossary Appendix C: Housing Element Appendix Vernon General Plan Table of Contents Table of Contents - iv List of Tables Page Table I-1 Relationship of Vernon General Plan to Mandated State Elements ............. 7 Table LU-1: Building Square Footage and Employment Projections ................................ 9 Table LU-2: Relationship of Land Use Categories and Zoning Districts ........................ 10 Table CI-1: Level of Service Descriptions ........................................................................... 10 Table H-1: Vernon Employment 2010 .................................................................................. 8 Table H-2: Projected Population and Household Growth 2008-2035 .............................. 9 Table H-3: Housing Characteristics 2010 and 2012 .......................................................... 10 Table H-4: Housing Affordability Based on Income ....................................................... 11 Table H-5: Affordability Matrix .......................................................................................... 13 Table H-6: Permit and Processing Fees .............................................................................. 25 Table H-7: Potential Housing Sites ..................................................................................... 39 Table H-8: Characteristics of Vacant and Underutilized Sites in Commerical/Industrial Zones ................................................................. 43 Table H-9: Characteristics of Vacant and Underutilized Sites in Commercial/Industrial Zones ................................................................. 43 Table H-10: Residential Service Characteristics of Unimproved and Underutilized Sites in Commercial/Industrial Zone ................................ 45 Table H-11: Quantified Objectives for 2014-2021 ............................................................... 46 Table H-12: Housing Element Accomplishments for 2008-2014 Planning Period ........ 49 Vernon General Plan Table of Contents Table of Contents - v List of Figures Page Figure LU-1: Floor Area Ratio ................................................................................................... 3 Figure LU-2: Land Use Policy Map .......................................................................................... 7 Figure CI-1: Street Cross Sections ........................................................................................... 6 Figure CI-2: Circulation Plan ................................................................................................... 7 Figure CI-3: Water Service ..................................................................................................... 16 Figure H-1: Regional Location ................................................................................................ 2 Figure H-2: Highly Toxic Regulated Substances ............................................................... 31 Figure H-4: 2007 Noise Contours ......................................................................................... 35 Figure H-5: Major Transportation Corridors ...................................................................... 37 Figure H-6: Housing Sites ..................................................................................................... 42 Figure S-1: Regional Faults .................................................................................................... 4 Figure S-2: Liquefaction Zone ................................................................................................ 5 Figure S-3: FEMA Flood Hazard Zones ............................................................................... 7 Figure S-4: Dam Inundation Areas ....................................................................................... 8 Figure N-1: Examples of Noise Levels ................................................................................... 4 Figure N-2: Examples of Noise at Southern California Locations ..................................... 5 Figure N-3: Community Noise Standards ............................................................................ 6 Figure N-4: 2007 Noise Contours ........................................................................................... 9 Figure N-5: Projected 2030 Noise Contours ........................................................................ 13 Vernon General Plan Table of Contents Table of Contents - vi This page intentionally left blank. VERNON GENERAL PLAN INTRODUCTION Vernon General Plan Introduction Introduction - 1 INTRODUCTION VERNON – FOUNDING OF THE CITY AND ESTABLISHING ITS MISSION The City of Vernon was founded in 1905 as an industrial city, and it remains so today. This General Plan reflects the long history and continues the City’s mission of maintaining Vernon as an ideal location for industry in Southern California. At the turn of the twentieth century, the lands now comprising Vernon were largely farmland. However, the location south of downtown Los Angeles and the presence of major rail lines led influential businessmen and property owners to encourage railroad companies to run spur lines into the adjacent farmlands. These rail extensions enabled the creation of an “exclusively industrial” city. James J. and Thomas Furlong and John B. Leonis led the city formation effort, and Vernon incorporated in 1905. Vernon General Plan Introduction Introduction - 2 Although the presence of the rail lines facilitated industrial development, the process was slow. A few new industrial businesses located in Vernon during the colorful period between incorporation and Prohibition Period of the 1920s. Other businesses located in the City during this period, such as Doyle’s bar, which employed 37 bartenders and hosted an arena where 20 world championship boxing matches were held. Vernon also had a ballpark for the Vernon Tigers, which won Pacific Coast League championships on multiple occasions . By the 1920s, Vernon was attracting large stockyards and meatpacking facilities, including slaughtering operations. While the stockyards have vanished, meat processing remains a signature business in the City. The Farmer John’s facility, with its iconic pig mural, processes pork products, including the famous Dodger Dogs enjoyed by baseball fans. Refrigerated food storage began as an outgrowth of the early meat packing and processing activities and is now a significant activity as well. Vernon farmland along the Los Angeles River, 1926 Vernon General Plan Introduction Introduction - 3 To provide for the service requirements of these activities, including the electrical demands of the cold storage and refrigerated facilities, in the early 1930s the City began building municipal water supply and distribution facilities, as well as its own electrical power plant, which remains in operation. The capability of the City to provide these two critical services at a relatively low cost continues to be a competitive advantage for Vernon in attracting industry. During the 1920s and ‘30s, Vernon became the location of choice for many heavy industrial plants, including steel, aluminum, paper, and glass producers. Automobile assembly, canning, and other manufacturing operations also were established in the City in this period. As economic conditions have changed over the decades, however, many of these large- scale industrial operations have relocated out of Southern California or even out of the country. Los Angeles Union Stock Yards in Vernon, 1937 Vernon General Plan Introduction Introduction - 4 The focus of businesses has shifted to smaller, more specialized manufacturing, processing, and storage operations. The City’s business-friendly environment, competitive-cost utilities, (largely due to the recent completion of the Malburg Generating Station), and key location for trucking and rail transport continue to position Vernon as an ideal location for industrial uses. VISION FOR THE FUTURE As Vernon enters the twenty-first century, its mission and character remains unchanged. For the foreseeable future, Vernon will continue to be an almost totally industrial city, with limited retail commercial and food service operations to support the large day-time business population, and few residences. City policy, land use restrictions, and limited land availability will allow Vernon to continue its mission to attract new, highly specialized industrial businesses. As noted in the City’s 1992 General Plan, national economic and environmental regulations have resulted in the shift of many types of industrial operations to other areas of the world. These forces have affected the type and character of industrial operations in Vernon, as they have elsewhere in the United States. Technological advances, environmental regulations, the cost of labor and raw or processed materials, and the cost of energy and petroleum products necessitate Vernon Potteries, 1931 Vernon General Plan Introduction Introduction - 5 continuing change in Vernon’s industrial operations and in the types of new industries desiring to locate in the City. Together with the aging of both private development and the public infrastructure, these factors require that a framework for guiding future growth and development in the community be developed. This General Plan addresses the continuing change, growth, and development of Vernon over the next two decades and provides a public policy statement regarding the future of the City. PURPOSE AND SCOPE OF THE PLAN Adopted by the City Council and available to all businesses, property owners, and others with an interest in the community, the General Plan is available for public review at all times. The Plan complies with the requirement by the State of California that all cities prepare and adopt a comprehensive, long-range plan to serve as a guide for the future. The Plan contains the goals, policies, and explanatory detail about issues important to the future of Vernon. Plan policies address land use (including housing), infrastructure, public safety, resources, and noise within topic-related chapters, or “elements”. These elements are: Land Use Element Infrastructure Element Safety Element Natural Resources Element Noise Element Housing Element General Plan policies and programs are supported by several key documents, listed below. While not technically a part of the Plan, each contributes to the ability of the City officials and staff — as well as the public — to understand the Plan and carry out its mandates. These documents may be updated, modified, or replaced over time, and readers should seek the current version for reference. These additional documents are: Final Environmental Impact Report (FEIR) and Monitoring Plan for the General Plan Implementation Plan Vernon General Plan Introduction Introduction - 6 Five-Year Capital Improvements Program Urban Water Management Plan Natural Hazards Mitigation Plan Standardized Emergency Management System (SEMS) Multi-hazard Functional Plan Other documents may be prepared over time to support implementation of the General Plan policies or as may be directed by the State Legislature. These should be reviewed for additional detail regarding various proposals contained in the General Plan. PUBLIC INVOLVEMENT IN DEVELOPING THE GENERAL PLAN As part of the General Plan program, the City undertook a public outreach program to identify issues and establish a new General Plan policy foundation. The outreach program included a City mailer, scoping meeting, and public hearings. The City distributed a mailer to property and business owners in Vernon regarding the General Plan. The mailer asked the Vernon business community to identify issues that can be addressed by the General Plan. Comments returned to the City were recognized in developing the General Plan. Those attending the scoping session (held in accord with the requirements of CEQA) were also given the opportunity to comment on the Public Review Daft of the Plan and the Zoning Ordinance. Prior to adoption of the General Plan, the Draft General Plan and associated Environmental Impact Report were circulated for public review and comment. Public hearings were conducted before the Vernon City Council. RELATIONSHIP OF VERNON GENERAL PLAN TO STATE REQUIREMENTS FOR PLANS This General Plan contains six elements, as well as a comprehensive Implementation Plan. These elements relate to the seven elements mandated by State law as follows: Vernon General Plan Introduction Introduction - 7 Table I-1 Relationship of Vernon General Plan to Mandated State Elements Vernon General Plan Elements State Required Elements Land Use Land Use Circulation and Infrastructure Circulation Safety Public Safety Noise Noise Natural Resources Open Space Conservation Housing Housing RELATED PLANS AND PROGRAMS State law places the General Plan atop the hierarchy of land use planning regulations, although, as a Charter City, Vernon’s Zoning Ordinance is its governing law as to land use. The General Plan provides guidance to the City Council in enacting ordinances relating to zoning, land use, public improvements, and development programs. Also, regional governmental agencies, such as the Southern California Association of Governments and the South Coast Air Quality Management District, have been established in recognition of the fact that planning issues extend beyond the boundaries of individual cities. Efforts to address regional planning issues such as air quality, transportation, and housing needs have resulted in the adoption of regional plans. The policies Vernon adopts are affected by these plans. The following paragraphs describe ordinances, plans, and programs which should be considered in association with the General Plan in development and planning decisions. Federal Plans and Programs National Pollutant Discharge Elimination System As part of a multi-pronged effort to improve the quality of water resources nationwide, the federal government authorized the State Regional Water Quality Control Board and its regional offices such as the Los Angeles Regional Vernon General Plan Introduction Introduction - 8 Water Quality Control Board to set up programs to implement National Pollutant Discharge Elimination System (NPDES) goals. Under the NPDES Stormwater Permit issued to the County of Los Angeles and Vernon as a co-permittee, most new development projects in the City are required to incorporate measures to minimize pollutant levels in stormwater runoff. Compliance is required at the time that construction permits are issued, as well as over the long term through periodic inspections. National Flood Insurance Program The Federal Emergency Management Agency administers the National Flood Insurance Program (NFIP). The NFIP provides federal flood insurance subsidies and federally financed loans for eligible property owners in flood-prone areas. Vernon has no mapped flood hazard areas. Clean Water Act Congress passed the Federal Water Pollution Control Act Amendments of 1972 and the Clean Water Act (CWA) of 1977 to provide for the restoration and maintenance of the chemical, physical, and biological integrity of the nation’s lakes, streams, and coastal waters. Primary authority for the implementation and enforcement of the CWA (33 U.S.C. 1251) now rests with the U.S. Environmental Protection Agency (EPA) and, to a lesser extent, the U.S. Army Corps of Engineers. In addition to the measures authorized before 1972, the CWA implements a variety of programs, including: federal effluent limitations and state water quality standards; permits for the discharge of pollutants and dredged and fill materials into navigable waters; and enforcement mechanisms. Section 404 of the CWA is the principal federal program that regulates activities affecting the integrity of wetlands. California State Plans and Programs California Environmental Quality Act (CEQA) The California Environmental Quality Act (CEQA) was adopted by the state legislature in 1970 in response to a public mandate for thorough environmental analysis of projects impacting the environment. The provisions of the law and environmental review procedure are described in the CEQA Law and Guidelines. CEQA is the instrument for ensuring that environmental impacts of local development projects are Vernon General Plan Introduction Introduction - 9 appropriately assessed and mitigated, and if not fully mitigated, ensuring that project benefits to the community are substantial. The Department of Community Services reviews projects for conformance with CEQA. California Noise Insulation Standards (Title 24) In 1974, the California Commission on Housing and Community Development adopted noise insulation standards for residential buildings (Title 24, Part 2, California Code of Regulations). Title 24 establishes standards for interior room noise (attributable to outside noise sources). The regulations also specify that acoustical studies must be prepared whenever a residential building or structure is proposed to be located near an existing or adopted freeway route, expressway, parkway, major street, thoroughfare, rail line, rapid transit line, or industrial noise source, and where such noise source or sources create an exterior CNEL (or Ldn) of 60 dB or greater. Such acoustical analysis must demonstrate that the residence has been designed to limit intruding noise to an interior CNEL (or Ldn) of at least 45 dB. The Department of Community Services enforces Title 24. Seismic Hazards Mapping Act California’s 1990 Seismic Hazards Mapping Act requires the State Geologist to compile maps identifying and describing seismic hazard zones throughout California. Guidelines prepared by the State Mining and Geology Board identify the responsibilities of state and local agencies in the review of development within seismic hazard zones. Development on a site that has been designated as a seismic hazard zone requires a geotechnical report, and local agency consideration of the policies and criteria established by the Mining and Geology Board. Over the years, the program has expanded to include mapping of seismic-related hazards such as liquefaction- and landslide-prone areas. The Safety Element discusses seismic hazards associated with faults and those identified on state seismic hazard maps. Vernon contains only liquefaction-prone areas. The Safety Element contains a map identifying these areas. AB 32 Assembly Bill 32, the Global Warming Solutions Act (passed in 2006), sets the target of reducing emissions of greenhouse gases statewide to 1990 levels by 2020. The bill assigned the task of coming up with a scoping plan for this reduction to the Vernon General Plan Introduction Introduction - 10 California Air Resources Board (CARB). This plan, which CARB’s board approved in December 2008, has a range of greenhouse gas (GHG) reduction actions which include direct regulations, alternative compliance mechanisms, monetary and non-monetary incentives, voluntary actions, market-based mechanisms such as a cap-and-trade system, and an AB 32 cost of implementation fee regulation to fund the program. SB 375 Senate Bill 375 (2008) takes aim at reducing the single largest source of greenhouse gases in California—emissions from passenger vehicles—by working to reduce vehicle miles traveled. The law prompts California regions to work together to lower these emissions, and requires the integration of planning processes for transportation, land use, and housing. SB 375 requires CARB to develop regional reduction targets for automobiles and light trucks GHG emissions. The regions, in turn, are tasked with creating “sustainable communities strategies,” which combine transportation and land use elements to achieve the emissions reduction target, if feasible. Vernon is cooperating with these efforts. The Gateway Cities Council of Governments, comprised of 26 local cities including Vernon, completed a Subregional Sustainable Communities Strategy, which is a part of the SCAG Sustainable Communities Strategy. Vernon is also part of the larger Southern California Association of Governments, or SCAG, and as such participates in the development and implementation of the Sustainable Communities Strategy for the SCAG region. Regional and County Level Plans and Programs SCAG Regional Comprehensive Plan and Guide The Southern California Association of Governments undertakes regional planning for the six-county SCAG region of Los Angeles, Orange, Riverside, San Bernardino, Imperial, and Ventura counties. SCAG’s efforts focus on developing regional strategies to minimize traffic congestion, protect environmental quality, and provide adequate housing. The Regional Comprehensive Plan and Guide sets forth broad goals intended to be implemented by participating local and regional jurisdictions and the South Coast Air Quality Management District. SCAG has adopted companion documents to the Regional Comprehensive Plan and Guide, most notably the Regional Transportation Plan (see below). Vernon General Plan Introduction Introduction - 11 Congestion Management Plan The Congestion Management Plan (CMP) is a program adopted by the state legislature and approved by the voters in 1990 through Proposition 111. As a new approach to addressing congestion concerns, the CMP was created for the following purposes: To link land use, transportation, and air quality decisions To develop a partnership among transportation decision-makers on devising appropriate transportation solutions that include all modes of travel To propose transportation projects which are eligible to compete for state gas tax funds The Los Angeles County Metropolitan Transportation Authority (Metro) is responsible for preparing the County’s CMP. Metro is required by state law to monitor local implementation of all CMP elements. Local jurisdictions are required to monitor arterial congestion levels, monitor transit services along certain corridors, and implement an adopted trip reduction ordinance and land use analysis program. Regional Transportation Plan The Regional Transportation Plan (RTP) is a component of the Regional Comprehensive Plan and Guide prepared by SCAG to address regional issues, goals, objectives, and policies for the Southern California region into the early part of the 21st century. The RTP, which SCAG periodically updates to address changing conditions in the Southland, has been developed with active participation from local agencies throughout the region, elected officials, the business community, community groups, private institutions, and private citizens. The RTP sets broad goals for the region, and provides strategies to reduce problems related to congestion and mobility. In recognition of the close relationship between the traffic and air quality issues, the assumptions, goals, and programs contained in the Plan parallel those used to prepare the Air Quality Management Plan. Vernon General Plan Introduction Introduction - 12 Air Quality Management Plan The federal Clean Air Act requires preparation of plans to improve air quality in any region designated as a nonattainment area. The Air Quality Management Plan, or AQMP, prepared by the South Coast Air Quality Management District, first adopted in 1994 and updated on a three-year cycle, contains policies and measures designed to achieve federal and state air quality standards within the South Coast Air Basin. The assumptions and programs in the AQMP draw directly from regional goals, objectives, and assumptions in SCAG’s Regional Comprehensive Plan and Guide. City Level Plans and Programs Vernon Zoning Ordinance In recognition of the City’s industrial nature, the City’s Zoning Ordinance establishes one Zone (the Industrial Zone) throughout the City, and provides for several Overlay Zones. The Zoning Ordinance establishes land use regulations for the City and each Overlay Zone with respect to permitted uses, allowable intensity, and development standards. The Zoning Ordinance explains the purposes of the Industrial Zone and each Overlay Zone, specifies permitted uses and conditional uses, and establishes development standards, and includes a map describing the location of each Overlay Zone. The Zoning Ordinance is the governing land use law for the City, and to the degree practical, implements the goals, policies, and development expectations established in Vernon’s Land Use Plan. Urban Water Management Plan Vernon’s Urban Water Management Plan provides the long- term plan and vision for managing its water resources and providing a reliable supply of water to its customers. The Plan details water supplies, water quality impacts, water demand management measures, water shortage contingency plan, and water recycling methods. Water Department Emergency Response and Recovery Plan The Vernon Water Department Emergency Response and Recovery Plan is designed to prepare the City’s Water Department for a planned response to emergency situations associated with natural disasters, technological incidents, and Vernon General Plan Introduction Introduction - 13 natural security emergencies in, or affecting Vernon Water Department’s facilities and its service area. The plan is consistent with the requirements of Government Section 8607 and is intended to be used in conjunction with the State Emergency Plan. Standardized Emergency Management System Multi- Hazard Functional Plan Vernon’s Standardized Emergency Management System (SEMS) Multi-Hazard Function Plan addresses the City’s planned response to extraordinary emergency situations associated with natural disasters, technological incidents, and natural security emergencies. The plan does not address normal day-to-day emergencies or the well-established and routine procedure used in coping with such emergencies. Instead, the operational concepts reflected in this Plan focus on potential large-scale disasters, which can generate unique situations requiring unusual emergency responses. Vernon General Plan Introduction Introduction - 14 This page intentionally left blank. VERNON GENERAL PLAN LAND USE ELEMENT Vernon General Plan Land Use Element Land Use Element - 1 LAND USE ELEMENT 1.0 PURPOSE AND FOCUS 1.1 Purpose of this Element This Land Use Element establishes the broad, general policies for how properties are used in Vernon, including location, distribution, type, and intensity of development, with the overarching goal of maintaining Vernon as an industrial city. The Land Use Policy Map graphically illustrates the planned pattern of land use in Vernon and the City’s sphere of influence, which consists of unincorporated lands adjacent to Vernon which have a bearing and influence on properties in the City. The General Plan and Land Use Element goals and policies provide guidance to the City Council and City officials regarding zoning, land subdivision, public improvements, and physical development programs. The Land Use Element and the circulation portion of the Circulation and Infrastructure Element are closely tied. It is intended that the land use patterns and intensities permitted by Land Use Element policies be supported by the streets, Vernon General Plan Land Use Element Land Use Element - 2 highways, and other transportation systems planned in the Circulation and Infrastructure Element. Vernon recognizes that its street system is constrained by long-established development patterns, and land use policies have been crafted accordingly to minimize the adverse effects of specific land uses on the local street system. To continue to attract and support industrial businesses, the City must be able to accommodate the vehicular traffic associated with desired uses. With regard to housing, long-standing City policy has been to discourage housing, recognizing that the traffic, noise, and odors that industrial uses produce are generally incompatible with residential development. In the past, land use policy limited housing to existing, long-established single-family homes and apartments. However, in 2011 the City Council committed to implementing new good governance practices that included adopting land use policies aimed at increasing the voting populous. Specifically, the City has identified specific locations where a limited amount of new housing can be constructed, and has adopted implementing zoning regulations. Recognizing Vernon’s mission to remain and industrial city, the locations for housing have been selected to minimize adverse interface between industrial and residential uses. Vernon’s city boundaries blur and blend into urban Los Angeles County, and many of the people working in businesses in Vernon live relatively close by in communities removed from industrial conditions and where they have access to parks, grocery stores, pharmacies, and other residential amenities. Thus, it is appropriate that new housing opportunities in Vernon remain very limited. 1.2 Focus The key policy objective of the City is to remain almost exclusively an industrial city, serving the needs of industry, including local, national, and international consumers of goods produced by manufacturers. To fulfill this objective, this Element describes a limited range of land use categories, establishes standards of use and intensity, and sets forth policies relating to use of properties. 1.3 Flood Management In 2007, the State adopted legislation that strengthened the long-existing requirement that a General Plan address flood management by specifically mandating that the Land Use Element identify flood-prone areas mapped by either the Vernon General Plan Land Use Element Land Use Element - 3 Federal Emergency Management Agency (FEMA) or the State Department of Water Resources. Flood Insurance Rate Maps, which are prepared by FEMA, identify potential flood zones. Please refer to the Safety Element, which addresses this issue in detail. 2.0 LAND USE PLAN The Land Use Plan consists of the Land Use Policy Map and text that describes the types and intensities of permitted uses. The Land Use Plan, along with the Zoning Ordinance, provides guidance and direction for all planning and land use decisions. 2.1 Land Use Terms and Concepts In discussing how properties may be developed, this Element uses the following planning terms and concepts. Land Use Designations “Designation” means a generalized category of land use type, with associated standards of use and development. Intensity Intensity is used to describe the level of development existing or permitted on a lot or parcel of land. Intensity applies to industrial and commercial land uses. Intensity means the total building square footage, percent of lot coverage, or floor-area ratio established on a property. The measure of intensity Vernon has adopted is the floor-area ratio. Floor-area ratio, or FAR, describes the relationship between the total square footage of development on a lot and the area of that lot. In general, the FAR can be determined by dividing the gross floor area of all buildings on a lot by the land area of the lot. A precise definition is contained in the Zoning Ordinance. FAR and factors such as building square footage, building height, and the percent of the lot devoted to parking, open storage, and similar uses are all interrelated. For example, a 20,000 square-foot building on a 40,000 square-foot lot has a FAR of 0.50:1. This 0.50:1 FAR can accommodate a single-story building that covers half the lot or a two-story building with reduced lot coverage. Figure LU-1 illustrates different FAR calculations. Figure LU-1: Floor Area Ratio Vernon General Plan Land Use Element Land Use Element - 4 Density For residential uses, the term density describes the level of development permitted. New residential uses, in addition to existing homes, are permitted only at a few limited locations in the City. Land use policy limits housing at these locations by establishing a maximum allowable density. Density is described in terms of the number of dwelling units allowed per net acre (du/acre). Net acre is defined as the gross project or lot area, less that portion of the site to be used or dedicated for use as a public road and for flood control purposes. Substantive Improvements Several land use policies call for the City to take action, or for new requirements to take effect, when land uses change or when substantive improvements are made to a property. In general, if a building with a nonconforming use is vacant for more than two years, there is a voluntary major alteration or repair (defined as an alteration or repair costing more than 50% of the building’s fair market value), or an increase in square footage, such change will require conformity with the permitted uses and development standards of the Zoning Ordinance. The requirements for bringing nonconforming uses into conformity with the Zoning Ordinance are described in detail in the Zoning Ordinance. A Vernon icon: the Farmer John meat processing plant Vernon General Plan Land Use Element Land Use Element - 5 2.2 Land Use Designations and Land Use Policy Map The Land Use Policy Map, Figure LU-2, identifies the planned distribution of land use in Vernon. In recognition of Vernon’s unique status as an exclusively industrial city, the General Plan contains one land use category (Industrial), and five Overlay Districts (Commercial, Rendering, Slaughtering, Housing, and Emergency Shelter). Industrial (I) – The industrial designation is purposefully structured to allow for a broad range of uses that support the City’s desire to maintain its status as a regional manufacturing and industrial center. The Industrial land use designation allows manufacturing, industrial uses, refrigerated and cold storage warehouses, data centers, general warehousing, industrial gas manufacturing, and any use or activity undertaken by the City. Refineries, energy generating facilities, hazardous waste facilities, trash to energy facilities, petroleum related uses, and other complementary uses may be permitted with special approval such as a Conditional Use Permit (CUP). Certain ancillary uses may be permitted in accordance with Zoning Ordinance requirements. The maximum permitted FAR is 2:1. Overlay Districts All uses allowed in the Industrial category are permitted in the Overlay Districts. Each Overlay District allows certain specialized uses not permitted in other areas of the City. The Zoning Ordinance may impose conditions on the permitted uses and may identify appropriate development standards. The Plan provides for five Overlay Districts: Commercial Rendering Slaughtering Housing Emergency Shelter Commercial Overlay District – The Commercial Overlay District, encompassing approximately 535 acres, is established along Santa Fe Avenue, Pacific Boulevard, Atlantic Boulevard, and Slauson Avenue, and along portions of Soto Street – as indicated on the Land Use Policy Map – to accommodate retail, commercial, service, and restaurant uses that support the needs Vernon General Plan Land Use Element Land Use Element - 6 of the daily employee population. Such uses may be permitted with a Conditional Use Permit. Rendering Overlay District – A Rendering Overlay District, encompassing 164 acres, exists in the area indicated on the Land Use Policy Map. With a Conditional Use Permit, lots over one acre may be used for rendering. Slaughtering Overlay District – The Slaughtering Overlay District, encompassing 83 acres, is designated in the area indicated on the Land Use Policy Map. With a Conditional Use Permit, lots over one acre may be used for slaughtering of animals. Housing Overlay District – The Housing Overlay District is applicable only to sites that have been specifically identified by the City and determined to be the best locations for housing, given surrounding uses, proximity to services and amenities, and distance from large-scale industrial operations. Residential uses are permitted in this overlay with discretionary review, such as via a Development Agreement, given the ubiquitous nature of industrial businesses in Vernon. No more than 61 units shall be permitted within the Housing Overlay District citywide. Emergency Shelter Overlay District – The Emergency Shelter Overlay District is applicable only to sites that have been specifically identified by the City and determined to be appropriate locations for emergency shelters. This Overlay is established to comply with requirements of Government Code Section 65583(a)(4). 2.3 Implications of Land Use Policy Vernon is virtually built out, and at any point in time, few, if any, vacant parcels are available for development. New development only occurs as a result of land recycling, with newer, more modern industrial buildings replacing older facilities. Because many of the oldest buildings cover properties from lot line to lot line (with little or no on-site parking or loading spaces), new development frequently BANDINIBLVD61stStFruitlandAv58thSt60thStEWASHINGTONBLVD56thStSLAUSONAVRANDOLPHSTSSANTAFEAVEAlcoaAvDistrictBlvdSotoSt54thStSBoyleAvPacific Blvd52ndStEVernonAvGiffordAvStESlausonAvFruitlandAvLOSANGELESRIVERMaywood AvFishburnAv5PineAvE26ThStStE50thStLEONISBLVDTriggs StKingAvE46thStMalabar StSevilleAvClarendonAvNoakesSt59thPlCoronaAvEVERNONAVnAv57thStUNIONPACIFICRRBURLINGTONNORTHERNSANTAFERRE27thStCarmelitaAvSt52NdPlE58thStE44thStMilesAvStStEmeryStE 49th StAlbanyStE52ndStFRUITLANDAVE54thStAlcoaAvIndianaStE56thStE54thStArbutusAvE15ThStMalburgWyExchangeAvVioletAlBickettStAyersAvE52ndPlauraAvDunham StMaywoodAvHamptonStCharterStE24thSt60thPlSHerbertAvE45thStBelgraveAvSIndianaStSierraPineAvBANDINIBLVDLOSANGELESJUNCTIONRRUNIONPACIFICRRSBonnieBeachPlPackersAvSevilleAvLosPalosStSSunolDrChambersStHolabird AvFurlongPlAlcoaAv53rdSt55thStUNION PACIFIC RRBURLINGTON NORTHERN SANTA FE RRRE49ThStSheilaSt61st StBelgrave AvDISTRICTBLVDE26thStAyersAvONAVIr v in g S t RANDOLPHSTLomaVistaAv57thStEverettAvLomaVistaAvE37THSTESLAUSONAVPACIFICBLVDE28thST30thStSaintCharlesStStStBOYLEAVSOTOSTSSotoStSSantaFeAvStSSantaFeAvE 26th StSevilleAvDOWNEYRDSATLANTICBLVDE50thSt52ndSt54thSt56thSt58thSt55thSt58thStMayflowerAv61stPlWoodlawnAv61stSt1.ctsHousingEmergency ShelterVernon City BoundaryVernon Sphere of InfluenceBase Map This page left intentionally blank Vernon General Plan Land Use Element Land Use Element - 9 results in reduced lot coverage and thus reduced building space, as the new use is required to provide parking and loading per current zoning regulations. Thus, implementation of land use policy over time is not anticipated to notably increase the overall intensity of development in Vernon. Rather, uses will shift among the various permitted industrial, manufacturing, and limited commercial and retail uses. Also, up to 61 additional residential units are anticipated to be constructed within the Housing Overlay District. Total building square footage and the number of employees in Vernon has steadily declined since the early 1990s. The Land Use Element anticipates a continuing decline in building square footage and employees during the period of this General Plan. Table LU-1 identifies the building square footage and employment for the baseline year (2007) and the decline in square footage and employment. This anticipated decline is taken into account in developing land use policy set forth in the Land Use Policy Map and the goals and policies contained in this Element. Table LU-1 Non-Residential Building Square Footage and Employment Projections The City of Vernon has, in the past, discouraged new housing development due to potential conflicts with industry. The City has revised this policy to permit very limited new residential development in specifically designated areas, with the goal of increasing the voting population and enhancing government accountability. Land use policy will permit up to 61 new housing units via the Housing Overlay District. The population increase associated with this land use policy is estimated to be 216 additional Vernon residents, assuming the average Vernon household size reported in the 2010 Census. This land use Land Use Designation Net Acreage (A) Baseline Year (2007) Development Build-out Year (2025) Development Net Increase/ Decrease Percent Change Industrial 2,775 Building Square Footage 62,636,000 61,412,300 -1,223,700 -2.0% Employment (B) 44,600 43,700 -900 -2.0% Note: (A) Net Acreage does not include streets or the Los Angeles River. (B) Number of employees Vernon General Plan Land Use Element Land Use Element - 10 policy would triple the baseline 2010 resident population from 112 persons to an estimated 328 persons. 2.4 Relationship of Land Use Policy to the Zoning Ordinance The Zoning Ordinance is the primary implementation tool for the Land Use Element. Both the Element and the Ordinance describe the distribution and intensity limits for development. Whereas the Land Use Element sets forth the broad policies for future development, the Zoning Ordinance provides specific detail, enforcement mechanisms, development standards, and provides for deviations through Conditional Use Permits, Variances, and amendments to the Zoning Ordinance. The Zoning Ordinance includes the following zoning districts to implement land use policy: Table LU-2 Relationship of Land Use Categories and Zoning Districts Land Use Designation Corresponding Zoning District Industrial General Industrial (I) Commercial Overlay Commercial - 1 (C-1) Commercial - 2 (C-2) Slaughtering Overly Slaughtering Overlay (S) Rendering Overlay Rendering Overlay (R) Housing Overlay Housing Overlay (H) Emergency Shelter Overlay Emergency Shelter Overlay (ES) Trucking and Freight Terminal Overlay (TF) 3.0 GOALS AND POLICIES Land use goals and policies related to land use and its distribution and intensity reflect the industrial nature of Vernon. Vernon incorporated in 1905 for the stated purpose of being an exclusively industrial city. This founding purpose has remained largely unchanged over the last century, with the focus of City land use policy on providing suitable sites for industry and providing the infrastructure and services required to serve industrial activities. Vernon General Plan Land Use Element Land Use Element - 11 GOAL LU-1 Promote and maintain manufacturing and other industrial uses as the primary land use within the City. POLICY LU-1.1: Designate all properties in Vernon for manufacturing and industrial use, and permit other uses only with a Conditional Use Permit or other discretionary review process. Permit certain uses only in specified Overlay Districts with a Conditional Use Permit or other discretionary review process. POLICY LU-1.2: Accommodate, at limited and specific areas of the City, those commercial, service, and retail uses that complement but do not detract from the purposely established industrial character of the City. Limit such uses to the Commercial Overlay District, and permit only with a Conditional Use Permit or other discretionary review process. POLICY LU-1.3: Permit limited ancillary uses on industrial sites, such as limited office use and showrooms, as necessary to support basic industrial activities. POLICY LU-1.4: Permit only housing and emergency shelters as may be required by State law and as necessary to foster the City’s good governance practices. Ensure adequate review of housing development proposals to minimize potential industrial/housing conflicts. POLICY LU-1.5: Permit truck and freight terminals on a limited basis to minimize the impacts associated with heavy trucking activity. Designate such permitted areas using an overlay zoning district or similar mechanism. POLICY LU-1.5: Continue to maintain up-to-date information regarding flooding hazards consistent with the Safety Element. GOAL LU-2 Phase out aging industrial building and sites through modernization and replacement. Vernon General Plan Land Use Element Land Use Element - 12 POLICY LU-2.1: Require private upgrading of off- street parking and loading facilities to comply with the City Zoning Ordinance at the time that any nonconforming building or use is required to be brought into conformity with the Zoning Ordinance. POLICY LU-2.2: Support cooperative solutions to provide required off-street parking, such as agreements among neighboring businesses and public/private ventures. POLICY LU-2.3: Continue to enforce all applicable building and health and safety codes. POLICY LU-2.4: Provide incentives to property owners to revitalize industrial structures or recycle/demolish obsolete or vacant structures. POLICY LU-2.5: Assist in the reuse of properties from one industrial use to another. POLICY LU-2.6: Accommodate the expansion of Soto Street north of 37th Street/Bandini Boulevard pursuant to Circulation and Infrastructure Element policy by requiring properties with frontage along this corridor to dedicate land to the public right-of- way sufficient to accommodate the roadway widening in the event that such properties redevelop or undergo substantial improvements. POLICY LU-2.7: Consider and facilitate proposals for more intensive employment-generating, non- residential development near transit stops. GOAL LU-3 Maintain Vernon as a highly desirable location for industry, and continue to attract the types of industry the City is well positioned to serve. POLICY LU-3.1: Review City codes and development requirements on a regular basis to ensure that development costs and standards are competitive with other industrial cities. Vernon General Plan Land Use Element Land Use Element - 13 POLICY LU-3.2: Foster a City government and governmental structure that is responsive to the needs of industry located in a metropolitan area. POLICY LU-3.3: Maintain power plants as key land use in the community, and allow for the expansion and/or development of new facilities to provide a reliable, cost-effective source of energy to industrial users. POLICY LU-3.4: Invest in activities and programs that advertise and promote Vernon as a quality and desirable location for industry. POLICY LU-3.5: Use development proposals as opportunities to encourage modernization and broaden property improvements goals. Vernon General Plan Land Use Element Land Use Element - 14 This page intentionally left blank. VERNON GENERAL PLAN CIRCULATION AND INFRASTRUCTURE ELEMENT Vernon General Plan Circulation and Infrastructure Element Circulation and Infrastructure Element - 1 CIRCULATION AND INFRASTRUCTURE ELEMENT 1.0 PURPOSE AND FOCUS 1.1 Purpose The Circulation and Infrastructure Element addresses the movement of goods and people along roadways and railways in the City, as well as the distribution of water, wastewater, stormwater, energy, and information through various conduits. Vernon’s industrial nature involves both manufacturing and logistics. Vernon originally was oriented around rail transport, but over the years goods movement has relied increasingly on trucks, thus heightening the importance of a local street system capable of safely and efficiently handling multi-axle truck traffic. In addition to good access to transportation, industrial businesses demand reliable, high-volume utilities to properly conduct their operations. Intense land uses require large amounts of electricity and water, and also generate large amounts of sewage. Today’s globalized Vernon General Plan Circulation and Infrastructure Element Circulation and Infrastructure Element - 2 economy demands fast, high-capacity telephone and other communications systems. To remain competitive as a location for industry, Vernon must be able to deliver or otherwise provide high-quality utility services at competitive prices. 1.2 Focus California planning law requires the inclusion of a Circulation Element addressing both transportation and non-transportation infrastructure. While all elements of the General Plan must be consistent with each other, the Circulation Element must, by State law, correlate directly to the Land Use Element. 2.0 CIRCULATION PLAN 2.1 Regional Circulation Streets and Freeways Vernon lies two miles southeast of the industrial areas of downtown Los Angeles, and both the local roadway and freeway systems directly connect the industrial businesses in Vernon with industrial development in adjacent communities. Key connections include: Downtown Los Angeles, via Alameda Street and Santa Fe Avenue; The Boyle Heights district of the City of Los Angeles, via Soto Street, Washington Boulevard, and Downey Road; The City of Commerce, via Washington Boulevard, Interstate 710, and Atlantic Boulevard; The City of Bell, via Bandini Boulevard and Interstate 710; The City of Maywood, via Atlantic Boulevard; The City of Huntington Park, via Slauson Avenue, Soto Street, Pacific Boulevard, Santa Fe Avenue, and Alameda Street; Portions of the City of Los Angeles south of downtown, connected by many streets across the shared boundary of Alameda Street, including Vernon Avenue and Santa Fe Avenue. Of particular note is the Long Beach Freeway, Interstate 710. Vernon General Plan Circulation and Infrastructure Element Circulation and Infrastructure Element - 3 Interstate 710 provides an important direct connection to the ports of Long Beach and Los Angeles. Although less than half a mile of this freeway traverses Vernon, that portion contains the very busy Atlantic Boulevard/Bandini Boulevard interchange. This frequently congested interchange carries a substantial amount of truck traffic from Vernon, particularly from the adjacent Hobart Rail Yard. In August of 2004, the Gateway Cities Council of Governments made preliminary recommendations to improve the Atlantic/Bandini interchange, as well as to build truck ramps directly from the rail yards to the freeway. Engineering plans and studies for this interchange will continue in concert with broader plans for improvements to I-710, with improvements to the interchange expected be accomplished prior to 2030. The timing will depend upon State approvals and funding. Once implemented, the interchange improvements are expected to relieve a major traffic bottleneck and improve safety by separating autos from heavy truck traffic. The City has undertaken a project to partially relieve congestion at the Atlantic/Bandini interchange. The extension of 26th Street to Bandini Boulevard will provide a means for through traffic to bypass the Atlantic/Bandini interchange. Railroads In the early years of the twentieth century, rail transport dominated the distribution of materials and manufactured goods, so an extensive rail network was built in Vernon with main lines, switching yards, and many spur lines to serve industrial properties. Over the years, trucks have come to play a more important role in freight transport, especially for access to individual businesses. Some spur rail lines have been abandoned, but rail traffic still plays a major role in the transport of materials and goods. Several rail lines cross Vernon, the most important of which is the Alameda Corridor. The Alameda Corridor, opened in 2002, serves as the primary connection between the ports of Los Angeles and Long Beach and the rail yards of Vernon, Commerce, and downtown Los Angeles. The Alameda Corridor places ten miles of track inside the 30- foot-deep Mid-Corridor Trench between the northern Vernon General Plan Circulation and Infrastructure Element Circulation and Infrastructure Element - 4 boundary of Vernon at 25th Street south to the State Route 91 freeway. This has eliminated many dangerous and time-consuming conflicts between surface street traffic and at-grade rail crossings, both in Vernon and elsewhere along the line. While the Alameda Corridor takes much of the container shipping traffic that would otherwise use trucks or the older Union Pacific (UP) or Burlington Northern Santa Fe (BNSF) lines, the older lines do still receive some use. Many at-grade rail crossings remain in the City. These should gradually decrease as the City encourages rail lines to merge facilities, to abandon spur lines, and to participate in separating streets from remaining railways. The Hobart Yard, located in the northeastern portion of Vernon, links the Alameda Corridor and BNSF lines with the wider transcontinental rail system, serving to assemble longer trains and transfer shipping containers between trucks and trains. Vernon is also home to the smaller Malabar Yard (east of Santa Fe Avenue between Fruitland Avenue and Vernon Avenue), the Los Angeles Junction Yard (between Exchange Boulevard and the Los Angeles River), and a portion of the UP East Yard. Other important rail yards are located nearby but outside of the Vernon city limits. 2.2 Vernon’s Street System Streets in Vernon generally form a grid pattern, although not a regularly spaced grid. Many of the City’s streets do not extend more than two or three blocks, with many T- intersections. To accommodate large industrial lots, most streets in Vernon are spaced farther apart than is typical in urban residential or commercial areas; most blocks in the City are between 600 and 2,000 feet long. 2.2.1 Street Classification Vernon’s street system is differentiated by roadway size, function, and capacity. The four basic types of roadways in Vernon are described below. Figure CI-1 presents schematic cross-sections for each type of roadway that represent desirable standards. Deviations from these standards may occur in cases where physical constraints and/or right-of-way limitations are present. Provision of sidewalks and off-street parking may also affect the specific design of roadways. In addition, the median Vernon General Plan Circulation and Infrastructure Element Circulation and Infrastructure Element - 5 width of arterials and collectors will vary according to the area being served, right-of-way constraints, and turn lane requirements. The assignment of these classifications to streets in the City is shown on the Circulation Plan, Figure CI-2. Freeway Freeways are controlled-access, high-speed throughways included in the State and federal highway systems. Freeways carry regional through traffic, that is, traffic passing through Vernon without stopping in the City. The Atlantic Boulevard/Bandini Boulevard interchange of the I-710, the Long Beach Freeway, is in Vernon. Access to the regional highway system for Vernon businesses and visitors is provided at the interchange between I-710, Atlantic Boulevard, and Bandini Boulevard. The design, construction, and maintenance of freeways are under the jurisdiction of the California Department of Transportation (Caltrans). Arterial Arterial streets, together with freeways, form a network carrying long-distance, high-speed traffic. Arterial streets transport large volumes of traffic from one part of the City to another and connect to the regional street system. The arterial streets also move traffic between cities in locations where a freeway does not link the two. Of the roadways designed, constructed, and maintained by the City, arterials are designed to have the highest traffic carrying capacity, the highest speeds, and limited interference with traffic flow by driveways. Limitations on truck access to and from abutting properties are most important on arterial streets to prevent obstructions and delays. Arterial streets aligned generally north-south in Vernon are, from west to east: Alameda Street Santa Fe Avenue Pacific Avenue (this curves broadly from north- south to east-west before continuing as Vernon Avenue) Soto Street Downey Road Atlantic Boulevard Vernon General Plan Circulation and Infrastructure Element Circulation and Infrastructure Element - 6 Figure CI-1: Street Cross Sections 64 FT Co l l ec t o r St r eet s L o c al St r eet s A r t er i al 64 to 104 FT 80 to 120 FT NOTES 1. Total right-of-way width will vary depending upon parkway requirements and existing conditions. 2. Curb and gutter, pavement thickness, and striping shall be as specified by the City Enginee r. 3. American DisabilityAct (ADA) requirements must be met for all pedestrian access. 4. Parking on major roadways will depend on land width and available right-of-wa y. 80 FT Minimum 42 to 49 FT 60 to 65 FT Vernon General Plan Circulation and Infrastructure Element Circulation and Infrastructure Element - 7 Vernon General Plan Circulation and Infrastructure Element Circulation and Infrastructure Element - 8 Arterial streets aligned generally east-west in Vernon are, from north to south: Washington Boulevard Bandini Boulevard (this continues as 37th Street west of Soto Street) District Boulevard between Downey Road and Atlantic Boulevard (this continues as Leonis Boulevard west of Downey Road) Slauson Avenue East Vernon Avenue/Pacific Boulevard Collector Collector streets are intended to serve as intermediate routes, handling traffic between arterial streets and local streets. Collectors are designed primarily to move traffic, but also to provide access to abutting properties. Collectors differ from arterials in that collectors distribute trips from the arterials to ultimate destinations. Conversely, collectors also collect traffic from local streets and channel it onto the arterials. Ideally, collector streets should form a network, but with no one collector extending so far that it functions as an arterial street. Collector streets in Vernon aligned generally north-south include: Boyle Avenue Collector streets aligned generally east-west in Vernon are, from north to south: 25th Street/26th Street 38th Street/37th Street (these two streets flow into each other, and continue as Bandini Boulevard east of Soto Street) Vernon Avenue (this street is discontinuous and offset at Santa Fe Avenue) Leonis Boulevard (this street continues as District Boulevard east of Downey Road) District Boulevard east of Atlantic Boulevard Fruitland Avenue Local Local streets provide direct access to individual parcels. The local street is not designed for through traffic. Rather, local streets should move traffic toward the nearest Vernon General Plan Circulation and Infrastructure Element Circulation and Infrastructure Element - 9 collector street. Therefore, speeds on local streets are relatively low, and on-street parking is usually permitted. Local streets are two-lane roadways without medians. When traffic congestion is detected through closed circuit detection cameras and/or via electronic traffic loops, the current signal patterns are adjusted to relieve or reduce the congestion. 2.2.2 Measuring roadway performance Evaluating the ability of the circulation system to serve Vernon’s businesses and other users requires establishing suitable performance criteria. Within the Circulation and Infrastructure Element, two measures are used to describe traffic flow on Vernon’s roadways and freeway access points: Volume to Capacity Ratios (V/C) and Intersection Capacity Utilization (ICU). These measures are used to establish Level of Service (LOS) categories describing the performance of roadways and access points throughout the City. Each of these measures is described briefly below. Volume to Capacity Ratio (V/C) This measure, consisting of a ratio between volume and theoretical capacity, is used to measure the performance of roadway facilities. Volume is established either by a traffic count (in the case of current volumes) or by a forecast for a future point in time. Capacity refers to the vehicle carrying ability of a roadway at free flow speed, and is a critical component of roadway design. For example, a roadway that carries 16,000 vehicles per day, with the capacity to accommodate 20,000 vehicles per day at free flow speed, has a V/C of 0.80. Intersection Capacity Utilization (ICU) This measure is applied using peak hour volumes and considers the geometric configuration of intersections when measuring capacity. Intersection Capacity Utilization sums the V/C ratios for the critical movements of an intersection, and thus accounts for the overall performance of intersections, which are the most critical limitations within the City roadway system. Level of Service (LOS) Level of Service (LOS) describes the efficiency and quality of traffic operations. Six categories of LOS – the letter designations A to F – are used to identify traffic conditions, with LOS A representing excellent conditions and LOS F Vernon General Plan Circulation and Infrastructure Element Circulation and Infrastructure Element - 10 representing extreme congestion. The LOS designations are based upon V/C ratios calculated for freeway access ramps and roadway segments, as well as ICU values calculated for intersections. Table CI-1 shows V/C and ICU ranges and the corresponding LOS, with a description of corresponding traffic conditions. The City of Vernon uses LOS D as its minimum standard for traffic operations. Table CI-1 Level of Service Descriptions Level of Service Description of Traffic Conditions V/C or ICU A Very short delays at intersections and free flow operation. Vehicles are completely unimpeded and can maneuver freely within traffic. 0.00 – 0.60 B Short delays of 10 to 20 seconds at intersections. Vehicles are completely unimpeded and can maneuver through traffic. 0.61 - 0.70 C Stable flow, with delays of 20 to 35 seconds at intersections. Some waiting vehicles may fail to go through the intersection before the green light turns red. Ability to maneuver and change lanes at mid-block is somewhat restricted. 0.71 – 0.80 D Congestion becomes more noticeable, with delays of 35 to 55 seconds at intersections. Many vehicles are required to stop at signals, and travel speeds along these roadways become slower. 0.81 – 0.90 E Unstable traffic flow, with delays of 55 to 80 seconds at intersections. Most vehicles are required to wait at least one traffic signal cycle. 0.91 – 1.00 F Traffic volumes exceed capacity, resulting in jammed intersections. This can result in delays greater than 80 seconds, and/or two-cycle signal waits. Above 1.00 Source: Highway Capacity Manual 2000, Transportation Research Board, National Research Council Vernon General Plan Circulation and Infrastructure Element Circulation and Infrastructure Element - 11 2.2.3 Circulation System Improvements Needed to Meet Level of Service Goals The City is investigating the following programs with the intent of improving the overall traffic flows throughout Vernon during morning and evening peak hours. These programs include physical improvements, such as widening streets, as well as advanced technological strategies, such as monitoring traffic flows using video and computer systems. Transportation System Management Although widening some roads in Vernon may help in reducing traffic congestion, Vernon must pursue alternative cost effective and efficient methods in improving traffic flows. Due to narrow streets and limited right-of-ways, Vernon’s traffic congestion can no longer be resolved by capacity enhancements such as lane re-striping or roadway widening. An alternative strategy is implementation of Intelligent Transportation Systems (ITS), which allows a city to control traffic signals by using advanced computer technologies, monitor traffic using video monitoring, and provide traveler information to motorists. The City intends to work toward implementing ITS systems at strategic locations to improve traffic flows. The City recommends implementing an ITS program, the Los Angeles County automated traffic surveillance and control (ATSAC) system, in an effort to improve traffic flow and increase capacity throughout the City. Traffic signal surveillance and control is a developing method of measuring the efficiency of traffic signal systems. This approach consists of installation of surveillance cameras and traffic volume counters to monitor traffic flow. Implementation of a citywide ATSAC system will improve many of the deficient intersections to an acceptable level of service. In addition to the ATSAC system, the following physical improvements will also help alleviate traffic congestion in the City. 26th Street Extension The City is planning to improve east to west access, near the I-710 Freeway and Atlantic Boulevard, by extending 26th Street easterly across Atlantic Boulevard and connecting with Bandini Boulevard. This improvement Vernon General Plan Circulation and Infrastructure Element Circulation and Infrastructure Element - 12 will help improve intersection conditions at Atlantic Boulevard/Bandini Boulevard/I-710 Freeway interchange. Atlantic Boulevard Bridge Widening The City of Vernon is planning to widen the Atlantic Boulevard Bridge over the Los Angeles River. The project plans to widen bridge to six lanes. Soto Street Widening Soto Street is a key north-south arterial that brings traffic from Interstate 10 to and through Vernon. Of the north- south arterials in the City, Soto Street has the best ability to handle higher volumes, and particularly through volumes. In 2002, the City of Vernon conducted the Soto Street Corridor Study to identify the best way to improve traffic flow along Soto Street and also relieve peak-hour congestions on parallel arterials. The preferred alternative involves widening Soto Street from four lanes to six lanes, three in each direction. This configuration requires widening the public right-of-way between 37th Street/Bandini Boulevard and Olympic Boulevard. Widening the public right-of-way will require each property owner with frontage along this section of Soto Street to dedicate between eight and 14 feet of property, depending on location, to public use. The City will require this dedication when a property undergoes a complete redevelopment or substantial improvement. The City may also proactively acquire some rights-of-way to achieve the planned configuration. When fully implemented, this plan will allow traffic to move more freely on Soto Street, improving the Level of Service. It will also have a secondary traffic-moderating effect on nearby streets. I-710 Freeway Improvements In a regional effort to improve truck movement from the ports to inland areas and overall increase the capacity of the I-710 Freeway, Caltrans has embarked on a major improvement program for the I-710 Freeway. The following improvements have been identified for the I-710 Freeway, between Slauson Avenue and Washington Boulevard, which will significantly contribute to traffic improvements in Vernon: Vernon General Plan Circulation and Infrastructure Element Circulation and Infrastructure Element - 13 The addition of two dedicated truck lanes with direct access to Hobart Rail Yard; Added general purpose lanes on the Freeway; Modication of Atlantic and Bandini Boulevards interchange; Addition of Slauson Avenue interchange; Closure of Washington Boulevard Interchange; and Extension of District Boulevard and creation of new intersection at Slauson Avenue. 2.3 Off-Street Parking and Loading Facilities Vernon’s streets support a significant load of heavy truck traffic. Since the street system was developed early in the twentieth century, streets are typically narrower than industrial street standards, and the streets were not designed to handle today’s truck sizes and volume of traffic. Large multi-axle vehicles encounter difficulties maneuvering on the streets, and congestion and traffic back-ups frequently occur as trucks enter and leave properties. Many properties have small driveways and inadequate loading bays, and trucks making these difficult maneuvers to access properties can block traffic and cause delays. Further contributing to on-street congestion is significant on-street parking. Many businesses do not provide adequate off-street parking for employees, largely because the properties were developed before parking of any maginitude was required. As properties transition to other uses, creating sufficient off-street parking to meet current zoning standards is extremely difficult. The City has considered many approaches to addressing the problems associated with inadequate off-street parking and loading facilities, including establishing criteria (such as vacancy in the building for over a year, major alteration or repair, or increase in square footage of a building) that would require the owner of a non-conforming property to bring parking and loading facilities into compliance with the City’s zoning standards. However, the widespread nature of the non-conformities makes this a difficult and costly proposition. Thus, the City will look to implement over time a variety of techniques to minimize congestion resulting from on-street parking and undersized or poorly configured loading facilities, which may include: Restricting truck movements at key intersections and along key road segments; Vernon General Plan Circulation and Infrastructure Element Circulation and Infrastructure Element - 14 Allowing for development of shared parking facilities; Establishing parking restrictions along key travel corridors; and Requiring that parking and loading comply with current zoning code requirements whenever substantial property modifications are proposed, the property has been vacant for over a year, or there is a proposed increase in floor area. 2.4 Other Transportation Modes Vernon is served by buses operated by the Los Angeles County Metropolitan Transit Authority (Metro). As an important center of employment, several Metro bus lines serve Vernon, providing an important alternative to personal automobiles as a means of commuting to and from work. Buses are particularly important for Vernon for several reasons. First, they provide transportation for workers who may be low income and cannot readily afford an automobile or gasoline. Second, by reducing the number of cars on the road, they reduce traffic and conflicts between cars and heavy trucks. Third, bus service reduces the strain on employers to provide parking for their workers. Located west of the City of Vernon, the Metro’s Blue Line light rail system also provides an important regional link for Vernon commuters. The Blue Line has a station at Vernon Avenue, approximately one-quarter mile west of the City boundary. From this station or adjacent stations at Washington Boulevard or Slauson Avenue, workers may walk to their workplaces or connect to one of several bus lines. While bicycles represent an additional mode of travel, biking is not encouraged on Vernon’s streets due to the heavy truck traffic and narrow configuration of many streets, which would present dangers to cyclists. The City of Vernon will cooperate with the Metropolitan Transportation Authority and other local agencies in their efforts to complete a bicycle path along the levee of the Los Angeles River connecting downtown Los Angeles with the waterfront in Long Beach. Vernon General Plan Circulation and Infrastructure Element Circulation and Infrastructure Element - 15 3.0 MEETING INFRASTRUCTURE NEEDS 3.1 Water and Wastewater Three water agencies supply water to the businesses, residents, and utilities in Vernon (see Figure CI-3). The majority of the City’s water is supplied by the City of Vernon’s Water Department. The area north of the Los Angeles River and east of a line just west of Indiana Street is supplied by the California Water Service Company (Cal Water), East Los Angeles District. The small portion of Vernon south of the Los Angeles River and east of Atlantic Boulevard is serviced by Maywood Mutual Water Company Number 3. The City of Vernon water system has received a Class I rating, the highest possible, by the Insurance Service Organization. The City’s water distribution system consists of 250,000 linear feet of pipe, nine wells, seven ground-level reservoirs, one elevated tank, and a below- ground reservoir. The total storage capacity is 16 million gallons. In addition, Vernon has a direct interconnection to the Metropolitan Water District (MWD). The MWD connection provides both a supplemental water source and an emergency supply in the event of a major power outage. The average pressure in the distribution systems is about 75 pounds per square inch (psi). Details of the sources and levels of water consumption used by the City of Vernon Water Department are provided in the Resources Element. The City owns its own sewerge collection system which discharges into the system managed by the Los Angeles County Sanitation Districts (LACSD). The majority of Vernon is within District 23, but also contains territory in Districts 1 and 2. Vernon General Plan Circulation and Infrastructure Element Circulation and Infrastructure Element - 16 BANDINIBLVD61stStFruitlandAv58thSt60thStEWASHINGTONBLVD56thStSAlamedaStSLAUSONAVSSANTAFEAVEAlcoaAvDistrictBlvdSotoStEasternAv54thStSBoyleAvPacific Blvd52ndStEVernonAvGiffordAvE55thStPineAvE26ThStE57thStE50thStLEONISBLVDTriggs StHolmesAvKingAvE46thStMalabar StSheilaStSevilleAvClarendonAvNoakesSt59thPlCoronaAvE27thStCarmelitaAvE38thSt52NdPlE58thStE44thStMilesAvE25thStE51stStE48thStEmeryStCoutsAE 49th StAlbanyStE52ndStTELEGRAPHRDRoss StLeonisStE56thStE54thStStArbutusAvE15ThStLindberghLnMalburgWyExchangeAvNobelStVioletAlBickettStAstorAvAyersAvE 52ndPlMcBirdAvLauraAvMaywoodAvE48thPlHamptonStCharterStSt41stPl60thPlSHerbertAvE45thStBelgraveAvSIndianaStkerAvE43rdStE58thPlSBonnieBeachPlPackersAvSevilleAvLosPalosStSSunolDrChambersStHolabird AvHawthorneAvFurlongPlE49ThStESlaSheilaSt61st StE51stStL o n g B e a c h F r w y Belgrave AvDISTRICTBLVD26ThStE26thStAyersAvEVERNONAVIr vin g StE37THST ESLAUSONAVE45thStE46thSt42ndStE50thStStStPACIFICBLVDE28thST30thStE45thStE46thStSaintCharlesStEVERNONAVSierraPineAvAlcoaAvSevilleAv53rdSt55thSt57thStEverettAv61stPlWoodlawnAv61stStESlausonAvFruitlandAvRANDOLPHSTLOSANGELESRIVERMaywoodAvFishburnAv59thPl57thStSATLANTICBLVDIndianaStDunham StRansomStBANDINIBLVDUNIONPACIFICRRBURLINGTONNORTHERNSANTAFERRLOSANGELESJUNCTIONRRUNIONPACIFICRRUNION PACIFIC RRBURLINGTON NORTHERN SANTA FE RRUNIONPACIFICRRUNIONPACIFICRRESlausonAvFRUITLANDAVE54thStE52ndStRossStE37thStALAMEDASTBOYLEAVSOTOSTSSotoStSSantaFeAvE 49th StrtinLutherngJrBlvd41stStE40thPlAlamedaStSSantaFeAvRegentStE 26th StDOWNEYRDAlcoaAvRANDOLPHLomaVistaAvSATLANTICBLVDLomaVistaAvE50thSt52ndSt54thSt56thSt58thSt55thSt58thStMayflowerAvVernon Water DivisionCalifornia Water CompanyMaywood Mutual No. 30 500 1,000 1,500 2,000 2,500FeetLast Update: EDAW, February 21, 2007.Source: City of Vernon, 2006; and Los Angeles County, 2006.LEGENDWATER SERVICEFigure CI-3City BoundaryVernon Water DivisionCalifornia Water CompanyMaywood Mutual No. 3 Vernon General Plan Circulation and Infrastructure Element Circulation and Infrastructure Element - 17 These Districts, along with more than a dozen others, are signatories to a Joint Outfall Agreement. This agreement provides for the operation and maintenance of an interconnected Joint Operating System of wastewater collection, treatment, reuse, and disposal facilities across a large portion of the urban region. The Joint Operating System includes the following treatment plants: Joint Water Pollution Control Plant, Carson; Whittier Narrows Water Reclamation Plant (WRP), near South El Monte; Los Coyotes WRP, Cerritos; San Jose Creek WRP, near Industry; Long Beach WRP, Long Beach; and Pomona WRP, Pomona. All of the sewerage generated in Vernon is treated by the Joint Water Pollution Control agency. 3.2 Storm Drainage Stormwater runoff in Vernon is conveyed through local and and Los Angeles County Flood Control District storm drainage systems. Discharges are regulated under an existing NPDES permit for municipal stormwater (NPDES Permit CAS004001, Order No. 01-182, and in particular, Subsection 8.14.6.3-Industrial Stormwater). This permit was not written specifically for Vernon; it covers most of Los Angeles County and includes Vernon as a co- permittee. The permit establishes a framework of requirements for monitoring discharges and water quality, performing best management practices, and submitting reports to the Regional Water Quality Control Board, Los Angeles Region. To address growing concerns with stormwater runoff contamination in urban areas, the Los Angeles Regional Water Quality Control Board (LARWCB) looks for co- permittees to capture and treat runoff on individual parcels at the time properties are redeveloped. The LARWCB policy is to seek to infiltrate as much of the stormwater as practical. In Vernon, this approach is difficult,primarily due to the industrial nature of the City and the potential for ground water contamination and the need to utilize available surface area to meet parking and loading requirements. The City supports a more comprehensive approach and will continue to explore Vernon General Plan Circulation and Infrastructure Element Circulation and Infrastructure Element - 18 options to meet NPDES requirements creatively and in ways that can help achieve other City goals as well. 3.3 Electrical Generation and Distribution The City of Vernon operates its own Light and Power Department, supplying customers throughout the City with reliable and comparatively low-cost electrical power. The City generates electrical power and also purchases power from third-party suppliers through its connection with the Southern California Edison bulk power system and the Cal-ISO grid at the Laguna Bell Substation. For many years, the City’s power-generating facility has supplied local customers with local power, supplemented as needed through connections to the grid. More recently, the Malburg Generating Station, which is a combined cycle plant with two natural-gas-fired combustion turbines and one steam turbine, has been providing additional power. However, in an effort to be able to supply nearly all of the local electrical demand, the City intends to construct a new natural gas-fired power plant at 3200 Fruitland Avenue. When constructed, the Vernon Power Plant is expected to have a capacity of 914 megawatts of electric power using three natural-gas-fired combustion turbines and one steam turbine. Vernon anticipates that when this facility is operational, Vernon will not need to import electricity from outside sources, and will even be able to contribute to the regional electricity reserves through a line connecting the plant to Southern California Edison’s Laguna Bell substation in Commerce. 3.4 Communications and Information Technology To attract new businesses and to accommodate businesses’ ever-changing telecommunications needs, Vernon has established a network of fiber-optic cables in the City. This enables businesses to receive exceptionally clear telephone and internet service, giving Vernon an advantage when competing for business. The City will continue to be proactive in developing telecommunications systems beneficial to businesses, including the development of data centers in the City. Vernon General Plan Circulation and Infrastructure Element Circulation and Infrastructure Element - 19 3.5 Gas System As a means of attracting and retaining industrial users, the City has developed a system for transporting and providing natural gas to businesses within the City at competitive prices. The City is currently providing natural gas to the Malburg Generating Plant and other businesses. A fully developed distribution system exists and connection is available to all businesses. 4.0 GOALS AND POLICIES To support the needs of existing businesses in Vernon and to attract new enterprises consistent with the City’s vision to remain an industrial city, Vernon will continue to improve its infrastructure – from the street system to energy facilities to communications systems. GOAL CI-1 Provide a balanced transportation system for the safe and efficient movement of people, goods, and emergency services throughout the City. POLICY CI-1.1: Continue to improve the street system to meet the minimum standards contained in this Element. POLICY CI-1.2: Continue to coordinate with the rail companies to provide for efficient rail service that minimizes impacts on the local street system. POLICY CI-1.3: Limit rail yards to areas agreed on and consolidate rail spurs where feasible. POLICY CI-1.4: Evaluate implementing measures that reduce the maneuvering of trucks on streets with substantial traffic during periods of high traffic volumes. POLICY CI-1.5: Continue to pursue grade separation for railroad crossings on designated streets. POLICY CI-1.6: Encourage the continued improvement of services provided by the Los Vernon General Plan Circulation and Infrastructure Element Circulation and Infrastructure Element - 20 Angeles County Metropolitan Transit Authority to Vernon and adjacent cities to provide good access from home to job and job to home for persons employed in Vernon. POLICY CI-1.7: Encourage the use of ride sharing and public transit for persons employed in the City to reduce traffic congestion and the need for off-street parking in the City. POLICY CI-1.8: Continue to work with Caltrans and neighboring jurisdictions to improve the Atlantic/Bandini/I-710 intersection and to make improvements to the I-710 Freeway, including direct truck ramps to the rail yards and exploring the potential for adding an interchange at Slauson Avenue to improve access to the City. POLICY CI-1.9: Gradually eliminate unnecessary rail spur lines, and permit the combination of properties across spur lines. POLICY CI-1.10: Widen Soto Street consistent with the cross section shown in Figure CI-1. POLICY CI-1.11: Consider installing and maintaining an ATSAC system to improve traffic flow. POLICY CI-1.12: Cooperate with the Metropolitan Transportation Authority and other local agencies in their efforts to complete a bicycle path along the levee of the Los Angeles River connecting to adjacent jurisdictions. Vernon General Plan Circulation and Infrastructure Element Circulation and Infrastructure Element - 21 GOAL CI-2: Work toward the provision of adequate off-street parking and loading facilities for each business. POLICY CI-2.1: Implement methods to encourage provision of new off-street parking and loading facilities. POLICY CI-2.2: Encourage cooperative efforts among businesses to resolve off-street parking problems and meet zoning code requirements. POLICY CI-2.3: Explore the potential of creating public parking lots for employee parking using parking assessment districts or redevelopment powers. POLICY CI-2.4: Require an existing business or property to comply with zoning code requirements for off-street parking and loading at such time as any nonconforming building or use is required to be brought into conformity with the Zoning Code. GOAL CI-3 Maintain the water supply system to meet both normal demand and emergency needs. POLICY CI-3.1: Periodically evaluate the entire water supply and distribution systems to determine their continued adequacy and to attempt to eliminate deficiencies or enhance service. POLICY CI-3.2: Require all new developments and expansions of existing facilities bear the cost of providing adequate water service to meet the increased demand which they generate. . POLICY CI-3.3: Implement the programs and policies contain in the City’s Urban Water Management Plan, including particularly those related to reliability planning and conservation and reuse. Vernon General Plan Circulation and Infrastructure Element Circulation and Infrastructure Element - 22 POLICY CI-3.4: Use reclaimed water for cooling and other functions at the Malburg Generating Station and the future Vernon Power Plant to the greatest extent feasible. GOAL CI-4 Maintain the sewer system to assure the health and safety of all residents and businesses. POLICY CI-4.1: Periodically evaluate the sewage disposal system to determine its adequacy to meet changes in demand and changes in types of waste. POLICY CI-4.2: Ensure that all new developments bear the cost of expanding the sewage disposal system to handle any increase in load that they generate. POLICY CI-4.3: Investigate and implement means of financing maintenance and improvements to the sewer system. GOAL CI-5 Maintain the storm drainage system to assure the protection of lives and property of in Vernon. POLICY CI-5.1: Periodically evaluate the size and condition of the storm drainage system to determine its ability to handle expected storm runoff. POLICY CI-5.2: Evaluate the impact of all new developments and expansion of existing facilities on storm runoff, and require that the cost of upgrading existing drainage facilities to handle the additional runoff is paid for by the development which generates the need to improve a facility. POLICY CI-5.3: Monitor the use and storage of hazardous materials to prevent accidental discharge into the storm drainage system. POLICY CI-5.4: Allow new development projects to creatively implement NPDES standards and requirements. Vernon General Plan Circulation and Infrastructure Element Circulation and Infrastructure Element - 23 GOAL CI-6 Improve the City’s capability to generate and supply electric power to achieve energy self-sufficiency. POLICY CI-6.1: Expand, operate, and maintain an electrical utility system in an effort to provide an adequate level of service to businesses and other uses in the City. POLICY CI-6.2:Improve the electrical utility system in an effort to allow the City to meet any changes in demand over time. POLICY CI-6.3: Cooperate and/or participate with other agencies or parties in the expansion or development of power generation. POLICY CI-6.4: Evaluate the impact of all new development on the electrical energy system, and require that the cost of upgrading existing facilities is paid by the development, which necessitates the upgrade. POLICY CI-6.5: Expand the City’s capability to generate and provide natural gas to enhance the power/energy supply system. GOAL CI-7 Provide the highest quality communications and information technology services throughout the City. POLICY CI-7.1: Work with communication and technology service providers to provide for state-of-the-art internet, phone, and wireless communications equipment and services. Vernon General Plan Circulation and Infrastructure Element Circulation and Infrastructure Element - 24 This page intentionally left blank. VERNON GENERAL PLAN Adopted February 2013 2014-2021 HOUSING ELEMENT Vernon General Plan 2014-2021 Housing Element Housing Element - 1 HOUSING ELEMENT 1.0 INTRODUCTION Vernon is located near the geographic center of Los Angeles County. The City is bounded on the north and west by Los Angeles, on the east by Commerce and Bell, and on the south by Huntington Park and Maywood. Vernon is three miles southeast of downtown Los Angeles (Figure H-1) and 15 miles north of major harbor and port facilities in San Pedro and Long Beach. The City’s fully industrial nature generally creates conflicts with housing due to safety and environmental concerns. The Southern California Council of Governments (SCAG) historically has assigned Vernon very low housing production goals – and in the case of this cycle, a Regional Housing Needs Allocation (RHNA) of two units - in recognition of Vernon’s unique status as city devoted almost exclusively to industrial uses. Past City policy has precluded the development of any new residential units due to potential conflicts with industry. However, efforts by the City to create and implement a number of reforms and initiatives to enhance the accountability and transparency of its government and better provide for the Vernon General Plan 2014-2021 Housing Element Housing Element - 2 welfare of its residents and businesses have led to a policy change regarding housing. Specifically, the City of Vernon has established a policy to increase the City’s population to enhance government accountability through the construction of approximately 30 to 50 new non-City owned housing units, including units specifically designated for low- and very low- income households. Also, the City of Vernon is committed to maintaining the existing, long-established housing stock of 31 units. Figure H-1: Regional Location Vernon General Plan 2014-2021 Housing Element Housing Element - 3 1.1 State Requirement The California Government Code is very specific concerning the preparation and content of a housing element. It is the only element which must be reviewed by the State for completeness and compliance with the law before it is adopted. The element examines existing conditions and, through analysis, identifies housing needs and presents programs to meet those needs. The legislature has deemed that the Housing Element is the appropriate mechanism to implement State-wide goals regarding the provision of decent and suitable housing for all persons. The Government Code also makes it clear that the provision of affordable housing is the responsibility of all local governments and that they, using vested powers, should make a conscious effort to see that there are housing opportunities for all income groups (Section 65580). The intent of the State housing element requirements is based on the following concerns (Section 65581): 1. Local governments should recognize their responsibilities in contributing to the attainment of the State’s housing goals; 2. Cities and counties should prepare and implement housing elements coordinated with State and federal efforts to achieve the State’s housing goals; 3. Each local jurisdiction should participate in determining the necessary efforts required to attain the State’s housing goals; and 4. Each local government must cooperate with other local governments to address regional housing needs. This Housing Element was prepared in compliance with State requirements, and covers the 2014-2021 planning period for jurisdictions in the SCAG region. Many of the housing goals and programs which are desirable in non-industrial jurisdictions are not feasible in Vernon. The noise, dust, vibration, chemical wastes, and odors from Vernon’s local industries (many of which operate around the clock) serve as a deterrent to housing development in almost all locations within the City. Moreover, housing generally should not be encouraged in close proximity to heavy industry Vernon General Plan 2014-2021 Housing Element Housing Element - 4 for health and safety reasons. The Government Code makes it clear that the local government has the responsibility to consider such environmental factors in the Housing Element (Section 65580[e]). Therefore, while each requirement of State housing element law is referenced, this Housing Element reflects the unique realities within the City of Vernon. Potential sites for new housing have been analyzed in detail, including the conduct of a health risk assessment to identify the most preferable sites. 1.2 Relation to Other General Plan Elements The Vernon General Plan is comprised of the following six elements: Land Use; Circulation and Infrastructure; Housing; Safety; Resources; and Noise. The Housing Element builds upon the other General Plan elements and is entirely consistent with the policies and proposals set forth by the Plan. The General Plan was comprehensively updated in 2007. As portions of the General Plan are amended in the future, the Plan (including the Housing Element) will be reviewed to ensure that internal consistency is maintained. 1.3 Sources of Information The City of Vernon consists of two Census Tracts in the 2010 Census, including all of 5324.00 and a small portion of 5323.04. The 2010 Census incorrectly indicates that a portion of Census Tract 5323.02 is located in the City of Vernon; however, any actual overlap of the City boundary and Census Tract 5323.02 is a mapping error and does not represent any substantial area. The 2010 Census indicates that there are 29 housing units in Vernon, of which 28 were occupied as of 2010. However, both the 1990 and the 2000 Censuses has incorrectly documented the City’s unit count figures. The State Department of Finance (DOF) provides more up-to-date housing information based on the Census data. For the 2012 DOF housing estimates, the Vernon General Plan 2014-2021 Housing Element Housing Element - 5 housing count has been adjusted to accurately reflect Vernon’s housing count known number of units: 31.. The Southern California Association of Governments (SCAG) also prepares growth forecasts for the Regional Transportation Plan (RTP) and the Regional Housing Needs Assessment (RHNA) for cities within the SCAG region. SCAG’s 2012 adopted growth forecasts identify Vernon as having 30 households in 2008, with a projection for 30 units in 2035. The City has verified the existence of 31 units within its jurisdiction (of which 30 were occupied as of September 2012), the addresses for which are listed in Appendix C. While Census and SCAG data are used within the Housing Element, it is hereby acknowledged these data represent an undercount of two units and one unit, respectively. In addition, because of the City’s extremely limited housing stock, combined with the fact that the City owns 26 of these units, original data from the City on housing and household characteristics are utilized where available in place of the Census. In addition to housing conditions and market information provided by the City, the following documents serve as supplemental material to the Vernon Housing Element and are incorporated by reference: 1. 2012 SCAG Regional Transportation Plan Socioeconomic Projections 2. 2010 Comprehensive Housing Affordability Strategy (CHAS) data; HUD tabulations based on 2006-2010 American Community Survey Five-Year Estimates developed by the U.S Census Bureau 1.4 Public Participation Section 65583 (c)(6)(A) of the Government Code states: “The local government shall make a diligent effort to achieve public participation of all economic segments of the community in the development of the housing element, and the program shall describe this effort.” For purposes of this Housing Element, outreach to the community was conducted to assess the types of and locations for housing to be considered as part of the City’s reform Vernon General Plan 2014-2021 Housing Element Housing Element - 6 process. The following meetings were held to gather input into the development of the Housing Element: Housing Commission Workshop, February 9, 2012. The Housing Element consultant made a presentation to the Commission that provided an overview of the City’s housing commitments, reviewed options to meet those commitments, identified known constraints, and identified sites under consideration for potential housing. Vernon Chamber of Commerce Meeting, March 29, 2012. The Housing Element consultant met with Chamber representatives and made a presentation similar to that conducted with the Housing Commission. City Council Workshop, April 17, 2012. Based on input received during the two meetings described above, the Housing Element consultant refined the presentation to focus on preferred housing sites, options for housing types, and potential environmental and health risks located on or near the preferred sites. In addition, community residents were provided the opportunity to review and comment on the Draft Element prior to adoption. Upon receipt of comments from the State Department of Housing and Community Development (HCD) on the Draft Element, the City Council conducted a public hearing on the Element. (The City Council has not created a separate Planning Commission, so all public hearings are conducted before the Council.) For all hearings, notice was published in the local newspaper, posted in the City, and mailed to those who have a request for notice on file in advance of the hearing. The Draft Element was available for review online and in the City’s Community Services Department. Copies were made available on request to any person at a nominal charge. The public hearing provided an opportunity for public comment, and recommendations were considered by City Council for incorporation into the Element. In December of 2007, the City adopted a comprehensive revision to its Zoning Ordinance. As part of this process, the City held a series of public meetings with property and Vernon General Plan 2014-2021 Housing Element Housing Element - 7 business owners to discuss changes to the document. This successful outreach process resulted in full support of the revisions to the Zoning Ordinance. As part of this Housing Element Update, the Zoning Ordinance was again amended to create an overlay zone to be applied to sites where housing will be permitted. A second overlay was created to allow for the establishment of emergency housing pursuant to Government Code 65583(a)(4). The City conducted a comprehensive review of the most viable housing sites in the City, and through the new overlay districts has established implementing zoning to facilitate housing development. The City made the draft Housing Element, with revisions as recommended by HCD, available to the public in December 2012 through January 2013. Notices of the public hearing held on February 5, 2013 and availability of the document for review were mailed to the following service providers: Human Services Association, Bell Gardens Los Angeles County Social Services Department, Cudahy St. Matthias Social Service Center, Huntington Park Mexican American Opportunity Foundation – Community Services, Commerce Ability First/East Los Angeles Center, Los Angeles Eastern Los Angeles Regional Center, Alhambra The notice indicated the web location of the draft Element for download by interested parties, and asked that comments be directed to S. Kevin Wilson, Director of Community Services and Water. Vernon General Plan 2014-2021 Housing Element Housing Element - 8 2.0 HOUSING NEEDS ASSESSMENT 2.1 Population and Housing Trends City records indicate that Vernon’s housing stock and related resident population base has undergone little change since 1980. The City had a 1980 housing stock of 35 dwelling units, supporting a resident population of 85 persons. Only one residential unit has been constructed since that time. Several substandard residential units have been removed from the housing stock, including three units in 1984, one unit in 1985, and one in 1992, bringing the current unit count to 31. These housing units are all located west of Downey Road. Since 1980, the resident population has ranged between 77 and 120 persons, with the current population estimated by the 2010 Census to be 112 persons. For 2012, the Department of Finance reported 120 persons. The 2006-2010 American Community Survey indicates that the majority of residents in Vernon are employed in management, service, and sales industries. Table H-1 Vernon Employment 2010 Occupation Residents Employed % of All Jobs Managerial, Business, Science, and Arts 10 19% Sales and Office 19 36% Service Occupations 10 19% Production, Transportation, Material Moving 7 13% Natural Resources, Construction, Maintenance 7 13% Farming, Forestry, Fishing 0 0% Total Employed Residential Jobs 53 100% Source: U.S. Census 2006-2010 American Community Survey Five-Year Estimates On April 4, 2012, the SCAG Regional Council adopted the 2012-2035 Regional Transportation Plan/Sustainable Communities Strategy (RTP/SCS): Towards a Sustainable Future. As illustrated in Table H-2, SCAG projects that in 2035, the households and population in Vernon will remain constant at 30 and 100, respectively. SCAG’s projections were made at a time prior to the City’s reform commitments and thus do not reflect the population and household growth that will result from new housing units. Vernon General Plan 2014-2021 Housing Element Housing Element - 9 Table H-2 Projected Population and Household Growth 2008-2035 2008 2020 2035 Pop Hshlds Pop Hshlds Pop Hshlds SCAG 100 30 100 30 100 30 Source: 2012 SCAG Regional Transportation Plan Growth Forecast 2.2 Housing Characteristics Households According to the California Department of Finance, the 31 housing units in Vernon (see Table H-2) house a population of 120 persons. Average household size is 4.0 persons per unit. Housing vacancy is generally very low in the City, with only one rental unit unoccupied according to the 2010 Census. No owner-occupied housing is vacant. Table H-3 presents 2012 data on housing units per structure, as reported to the State Department of Finance. The majority of Vernon’s housing stock is comprised of single-family dwellings, with only one apartment building located in the City. The City owns 84 percent of the total housing stock: 26 dwelling units, 18 of which are single-family dwellings and one of which is an eight-unit apartment building. The City rents these units. As part of the reform initiative, the City established a lottery system for the units to allow a broader base of persons to be eligible to rent units in Vernon. Vernon General Plan 2014-2021 Housing Element Housing Element - 10 Table H-3 Housing Characteristics 2010 and 2012 Housing Characteristics 2010 2012 Total Housing Units 31 31 Single, Detached 19 19 Single, Attached 2 2 Two to Four Units 2 2 Five Plus Units 8 8 Mobile Homes 0 0 Occupied Units/Total Households 28 30 Average Household Size 4.0 4.0 Vacancy Rate 3.45% 3.23% Total Population 112 120 Source: City of Vernon, 2012 and State of California, Department of Finance, E-5 Population and Housing Estimates for Cities, Counties, and the State, 2011 and 2012, with 2010 Benchmark. Sacramento, California, May 2012. Housing Condition Given the limited housing stock in Vernon, City staff is able to assess housing conditions on an ongoing basis. Although the housing stock is older (largely built before 1950), City staff has determined that all 31 units, or 100% of the housing stock, is well maintained and in good condition. No units have been determined to need replacement. One unit, which had fallen into disrepair, was demolished by its owner in 1992. A major reason for the unusually good quality of housing conditions in Vernon is the City’s ownership of 84 percent of the housing stock and its responsibility for maintaining these units. As needed, the City performs any required repairs and upgrades. The great demand for industrial space in the City means that unnecessary or poorly maintained units are unlikely to remain unless acquired by the City. Housing Affordability The California Health and Safety Code Section 50052.5 provides the following definition of affordable housing cost based on the area median income level (AMI) adjusted by family size and income level: Vernon General Plan 2014-2021 Housing Element Housing Element - 11 Table H-4 Housing Affordability Based on Income Calculation of Affordable Housing Cost for Owner Calculation of Affordable Housing Cost for Renters Extremely Low Income (0-30% MFI) 30% of 30% AMI 30% of 30% AMI Very Low Income (0-50% MFI) 30% of 50% AMI 30% of 50% AMI Lower Income (51-80% MFI) 30% of 70% AMI 30% of 60% AMI Moderate Income (81-120% MFI) 35% of 110% AMI 30% of 110% AMI Because the City’s resident population is so small, household needs are negligible when traditional needs analysis methods are applied. The Comprehensive Housing Affordability Strategy (CHAS)—special 2000 Census tabulations developed by HUD—provides a specific breakdown of household income adjusted for family size. According to CHAS Data, one-quarter of the households in Vernon were low income, earning between 51 and 80 percent of the Los Angeles County median family income (MFI) of $64,800. All other households earned more than 80 percent MFI. Due to the fact that the City owns and rents most of the housing at unusually low monthly rents, housing overpayment is virtually non-existent.1 As of 2012, City-owned apartments and houses largely rented at the following monthly payments, well below market levels for the region: 1-bedroom apartment $120 2-bedroom apartment $240 1-bedroom house $120 2-bedroom house $240 3-bedroom house $360 1 No housing units in the City have been sold in recent years. As such, an estimate of ownership housing costs is unavailable. However, recent (2012) land sales for large industrial sites have been priced at approximately $40 per square foot, depending on location, soil condition and necessary demolition costs. Vernon General Plan 2014-2021 Housing Element Housing Element - 12 Implementation of the good government reforms now underway will result in annual rent increases for persons currently living in the units. Using the California Health and Safety Code’s updated affordability thresholds, current housing affordability at the County level can be estimated for the various income groups (Table H-5). Housing overpayment occurs when a households pays more than 30 percent of gross monthly income on housing costs. A comparison of housing costs in Vernon and maximum affordable prices for low-income households in Los Angeles County shows that the City’s rental rates are well below the maximum affordable rents for very low-income (less than 50% MFI) households, and some one- and two-bedroom apartments may even be affordable to extremely low-income households (although the CHAS data indicate that there are no very low- or extremely low-income households in the City). As such, no households in Vernon experience a housing cost burden. As rental rates rise over time pursuant to the good government reform initiatives, households will experience increased housing costs. Rental rates are anticipated to transition to market rate costs by 2016, as shown below, through annual increases in rent. Additionally, when there is a change in tenancy, new tenants will pay market rate. Market rate costs will be affordable for very low and moderate income households. 1-bedroom unit: $120 to $696 2-bedroom unit: $240 to $1,450 to $839 to $1,450 3-bedroom unit: $240 to $1,114 to $1,000 to $1,700 Certain segments of the population may have a more difficult time finding decent, affordable housing due to special circumstances. Government Code Section 65583(a) requires cities to evaluate the following special needs households in the Housing Element: elderly, disabled persons, developmentally disable persons, large families, female-headed households, farmworkers, and the homeless. Due to the small size of the City’s resident population, the magnitude of households in Vernon with special needs is very small. Vernon General Plan 2014-2021 Housing Element Housing Element - 13 Table H-5 Affordability Matrix Income Group AMI adjusted by size Affordable Monthly Payment Housing Costs Maximum Affordable Price Renter Owner Utilities Taxes and Insurance Home Rental Extremely Low (0-30% MFI) 30% AMI One Person $13,605 $340 $340 $50 $80 $46,078 $290 Small Family $17,490 $437 $437 $100 $90 $54,219 $337 Four Person Family $19,440 $486 $486 $125 $95 $58,331 $361 Large Family $21,000 $525 $525 $150 $100 $60,305 $375 Very Low (30-50% MFI) 50% AMI One Person $22,675 $567 $567 $85 $115 $80,452 $482 Small Family $29,150 $729 $729 $125 $130 $103,889 $604 Four Person Family $32,400 $810 $810 $175 $140 $108,549 $635 Large Family $35,000 $875 $875 $200 $145 $116,224 $675 Lower (50-80% MFI) 60%AMI 70%AMI One Person $27,210 $31,745 $680 $794 $100 $165 $115,922 $580 Small Family $34,980 $40,810 $875 $1,020 $150 $190 $149,172 $725 Four Person Family $38,880 $45,360 $972 $1,134 $200 $210 $158,766 $772 Large Family $42,000 $49,000 $1,050 $1,225 $250 $220 $165,564 $800 Moderate (81-120% MFI) 110% AMI One Person $49,885 $1,247 $1,455 $100 $215 $249,986 $1,147 Small Family $64,130 $1,603 $1,870 $150 $260 $320,264 $1,453 Four Person Family $71,280 $1,782 $2,079 $200 $280 $350,645 $1,582 Large Family $77,000 $1,925 $2,246 $250 $300 $371,880 $1,675 Notes: 1. Small Family = 3 persons; Large Families = 5 persons 2. Property taxes and insurance based on averages for the region 3. Calculation of affordable home sales prices based on a down payment of 10%, annual interest rate of 6.5%, 30- year mortgage, and monthly payment 30% of gross household income 4. Based on Los Angeles County MFI $64,800 and 2012 HCD State Income Limits 5. Monthly affordable rent based on payments of no more than 30% of household income Vernon General Plan Housing Element 2014-2021 Housing Element - 14 Special Needs Groups Elderly The special needs of many elderly households result from their lower, fixed incomes, physical disabilities, and dependence needs. According to the 2010 Census, 14 residents in Vernon are age 65 and above, representing 12 percent of the population. The proportion of elderly persons in Vernon is likely to remain low as the majority of the City’s limited housing stock is occupied by working-age persons. Disabled Persons Disability is a physical or mental condition that affects the functioning of a person. Physical disabilities can hinder access to housing units of conventional design, as well as limit the ability to earn adequate income. The Census defines a disability as a long-lasting physical, mental, or emotional condition. This condition can make it difficult for a person to do activities such as walking, climbing stairs, dressing, bathing, learning, or remembering. This condition can also impede a person from being able to go outside the home alone or to work at a job or business. The City’s heavily industrial environment presents added constraints to the disabled. Large volumes of street and rail traffic, and delays caused by trains and parked trucks additionally limit the maneuverability of handicapped individuals. In order to address the needs of its handicapped residents and employees, the City enforces requirements for handicapped accessibility in new construction, and has undertaken a program to install curb ramps for wheelchairs. Developmentally Disabled According to Section 4512 of the Welfare and Institutions Code a "developmental disability" means a disability that originates before an individual attains age 18 years, continues, or can be expected to continue, indefinitely, and constitutes a substantial disability for that individual which includes mental retardation, cerebral palsy, epilepsy, and autism. This term shall also include disabling conditions found to be closely related to mental retardation or to require treatment similar to that required for individuals with mental retardation, but shall not include other handicapping conditions that are solely physical in nature. Vernon General Plan 2014-2021 Housing Element Housing Element - 15 The State Department of Developmental Services (DDS) currently provides community based services to persons with developmental disabilities and their families through a statewide system of 21 regional centers, four developmental centers, and two community-based facilities. Vernon is served by the South Central Los Angeles Regional Center and the Frank d. Lanterman Regional Center. These facilities provide point of entry to services for people with developmental disabilities. In Vernon, only one person is a consumer of the services provided at the local Regional Center. In order to assist in the housing needs for persons with developmental disabilities, the City will implement programs to coordinate housing activities and outreach with the Regional Center and, encourage housing providers to designate a portion of new affordable housing developments for persons with disabilities, especially persons with developmental disabilities, and pursue funding sources designated for persons with special needs and disabilities. Large Families/Overcrowding Large families are identified as a group with special housing needs based on the limited availability of adequately sized, affordable housing units. Large households are often of lower income, which can result in the overcrowding of smaller dwelling units and in turn accelerate unit deterioration. The 2010 Census identifies eight renter-occupied households as having five or more members. The City’s industrial character presents similar disadvantages for families with children as it does for the handicapped. Access to residential services, such as education, recreation, and local retail goods and services, is along roadways with high levels of truck traffic, railroad crossings, and loading activities. These conditions make pedestrian access to residential service facilities difficult and often unsafe, particularly for children. In terms of household overcrowding (defined as greater than 1.01 persons per room), the 2010 Census identifies no overcrowded rental or ownership housing in Vernon2. Thus, household overcrowding is not an issue. 2 The 2010 Census indicated that 15 rental housing units were overcrowded, but the margin of error was so high it was not used for this analysis. Also, because the City owns virtually all units in the Vernon General Plan Housing Element 2014-2021 Housing Element - 16 Female-Headed Households Female-headed households tend to have low incomes, thus limiting housing availability for this group. The 2010 Census identifies two female-headed households in Vernon, representing seven percent of all households. The housing needs of female-headed households of lower income can be addressed through the continued provision of the currently existing affordable housing in the City. Farmworkers According to the 2010 Census, no Vernon residents have Farming, Forestry, and Fishingoccupations. Due to the lack of opportunities for agricultural operations and the highly industrial nature of the City, no farming operations exist in Vernon. As such, the City has no need for farmworker housing. Homeless Throughout the country, homelessness has become an increasing problem. Factors contributing to the rise in homelessness include the general lack of housing affordable to low and moderate-income persons, increases in the number of persons whose incomes fall below the poverty level, reductions in public subsidy to the poor, and the deinstitutionalization of the mentally ill. According to the Gateway Cities Council of Governments Homeless Action Plan, homeless “hotspots” surveys were conducted during the summer and fall of 2011, during which outreach workers noticed homeless couples and individuals sleeping under bridges and around the Los Angeles River on a nightly basis near the City of Vernon. Other than this one-time observation and casual comment, very few homeless persons have been recorded living in Vernon largely because the City is not desirable for the homeless given the City’s industrial environment and its lack of social and residential services. On October 15, 2007, Governor Arnold Schwarzenegger signed into law SB2, which amends Government Code Sections 65582, 65583, and 65589.5 of State Housing Element Law. This legislation requires local jurisdictions to strengthen provisions for addressing housing needs of the homeless, including the community, the City can easily assess whether units are overcrowded. Vernon General Plan 2014-2021 Housing Element Housing Element - 17 identification of a zone or zones where emergency shelters are allowed as a permitted use without a conditional use permit. Due to very low homeless population in the City and the industrial nature of the community, the City’s policy position is that development of emergency shelters in Vernon is not a good solution for addressing regional homelessness issues. Placing a homeless shelter in an area that has been deemed largely inappropriate for new housing due to environmental concerns—including noxious odors from rendering and slaughtering, proximity to hazardous waste sites, and truck traffic pollution and noise—could raise potential environmental justice concerns. A large number of facilities for homeless individuals and families are located within a five-mile radius of the City, in locations that do not have the environmental constraints that exist in Vernon. For example, the Salvation Army Shelter in the city of Bell is a regional emergency shelter offering emergency and transitional care for up to 340 homeless adults, including 154 in the shelter, 128 in the drug and alcohol program, and 49 in longer term transitional housing. In addition to a place to stay, the Bell Shelter provides case management; substance abuse rehabilitation; individual and group therapy/counseling; on-site health care, medical referrals and HIV/AIDS education; job training; on-site adult education classes and life skills classes. However, given that State law requires all jurisdictions to comply SB2 mandates, the City has established an emergency shelter overlay zone to be applied to a single parcel at the northwest corner of the City. Future Housing Needs State law requires jurisdictions to provide for their fair share of regional housing needs. SCAG determines the projected housing needs for Southern California jurisdictions. Future housing needs reflect the number of new units needed in a jurisdiction (future demand), plus an adequate supply of vacant housing to assure mobility and new units to replace losses. These needs were forecast by the 2014-2021 Regional Housing Needs Assessment (RHNA), which considered on a regional and local level: market demand for housing, employment opportunities, availability of suitable sites and public facilities, commuting patterns, type and tenure of Vernon General Plan Housing Element 2014-2021 Housing Element - 18 housing need, and housing needs of farm workers. The 2014- 2021 RHNA establishes a future housing need of two units in the City of Vernon, with one unit to be affordable to very low- income households and one unit to low-income households. Energy and Water Conservation Compared with Vernon’s energy-intensive industries, housing consumes only a small proportion of the City’s total energy consumption. The City utilizes the California Green Building Standards Code for all construction to minimize energy consumption. Necessary sound insulation on residential units also results in effective heat insulation, thus reducing energy usage. Electric power in Vernon is provided by the City’s local power plant and municipal utility system. The Southern California Gas Company and the City of Vernon Light & Power Department Gas Division provide fuel for most natural gas heating needs, and offers programs for water heater insulation, attic insulation, and water flow limiting devices. Water is provided to all dwelling units either from groundwater pumped by the Vernon Community Services and Water Department or by import from the Metropolitan Water District. Compared to the large local industrial users, residential water use is minimal, and no special conservation steps have been deemed necessary for housing. 3.0 HOUSING CONSTRAINTS 3.1 Governmental Constraints Historically, housing growth has been virtually nonexistent in Vernon due to City policy that has discouraged, and in 2007 precluded, the development of any new residential units. City policy-makers have for decades determined that the pervasive industrial environment and land use incompatibilities related to hazardous materials storage and processing, background contamination, noxious odors, noise pollution, and truck and railroad traffic make Vernon an inappropriate location for new housing. However, as part of the City’s good governance reform initiative, City leaders have agreed to establish a way to allow for a very limited amount of new housing at a location or locations that would not result in significant land use conflicts, would minimize exposure of housing residents to adverse Vernon General Plan 2014-2021 Housing Element Housing Element - 19 environmental conditions, and would provide access to stores, schools, parks, and other amenities that residents would need. The City has made a commitment to amend the Zoning Ordinance to allow for the future development of a limited number of new residential units via a Housing Overlay zone, to be applied to two or fewer parcels. Zoning Ordinance Vernon comprehensively updated its Zoning Ordinance in 2007. The Ordinance did not include any development processes or standards to allow for residential projects, nor did the City have permit processing fees, site improvement requirements, impact fee requirements, or procedures for new residential development. With establishment of the Housing Overlay zone, new permitting procedures and development standards for targeted new residential development are now available. Given the unique conditions in the City and the fact that the sites to which the overlay will be applied are owned by the City, the City permitting process consists of a Development Agreement. In addition, the Housing Overlay zone allows transitional and supportive housing subject to the same permitting processes as other housing in the Housing Overlay zone without any special regulatory requirements. A Development Agreement is considered the most appropriate way to permit housing in Vernon given the unique characteristics of this industrial city. A Development Agreement provides a high degree of flexibility in defining the development standards for a housing project. Through a Development Agreement, the City can work with prospective housing developers to craft the provisions that will apply to site planning, provision of parking and open space, height limits, etc. Because the General Plan allows up to 30 units per acre, a prospective developer can propose innovative approaches to multifamily housing. Rather than establish concrete development standards, Section 26.4.5-5 of the Zoning Ordinance sets forth performance standards for residential development as follows: Vernon General Plan Housing Element 2014-2021 Housing Element - 20 “Sec. 26.4.5-5 Findings. After a public hearing, the City Council shall approve a proposed residential development and related Development Agreement only after first making all of the following findings: a)The design, location, size, and operating characteristics of the proposed residential will be compatible with the existing land uses in the vicinity; b)The proposed density is consistent with density standards and all applicable policies contained in the General Plan; c)The site and site plan are physically suitable in terms of design, location, shape, size, and the provision of public and emergency vehicle access, and public services and utilities, including but not limited to (fire protection, police protection, potable water, schools, sewerage, solid waste collection and disposal, storm drainage, and wastewater collection, treatment, and disposal; d)On-site traffic circulation for pedestrians and vehicles is designed into the development to allow residents to move easily through the development and to avoid pedestrian/vehicular conflicts and further, to ensure appropriate access for fire and police response and surveillance equal to or better than what would normally be created by compliance with the Site Planning Standards of Section 26.4.1-7; e)The proposed project provides suitable, usable common and/or private open space that will meet the passive and/or active recreation needs of the resident. Common open space areas and setbacks are provided with landscaping and other improvements suitable for the development proposed; f)The proposed project provides adequate parking to meet the residents’ needs and to avoid parking impacts on surrounding properties; g)Refuse/recycling collection areas are located to provide easy access to for all residents and collection vehicles, and to minimize noise impacts on residents; Vernon General Plan 2014-2021 Housing Element Housing Element - 21 h)To the extent feasible, the project design incorporates sustainable development features.” Given the flexibility of these standards and the need to address unique conditions in Vernon, the requirement for a Development Agreement is not considered a constraint. In fact, in response to a request for proposals for housing development on the site on 52nd Street, the City received five submittals and selected the one which can achieve objectives for providing affordable housing. Renovation, Restoration, Maintenance, and Repair The City will continue to permit the renovation, restoration, maintenance, and repair of existing residential uses. Residential rehabilitation projects are permitted in Vernon, and the rehabilitation is a “Minor Alteration or Repair,” as defined in the Zoning Ordinance (less than 50 percent of the fair market value of the buildings on the lot).3 As a practical matter, the expansive definition of “Minor Alteration or Repair” and lack of development standards result in limited governmental constraints (other than complying with the building code) that would prevent a homeowner from upgrading or improving a residence within the existing square footage. If the hard costs of improvements equal or exceed, over a three- year period, 50 percent of the then-current fair market value of the building, then the improvement, if voluntary, will be defined as a “Major Alteration or Repair” and terminate the legal nonconforming status of the residence. A Major Alteration or Repair is considered to be the functional equivalent of a tear-down and re-build, which the City does not permit, for the same reasons that it does not permit new construction of residences. However, if the Major Alteration or Repair is necessitated by a natural disaster, such as an earthquake or fire, the owner does have the right to rebuild the residence. At that time, the development standards for the home would be developed. The City did not undertake to 3 A minor alteration is that for which the hard costs charged, incurred, or paid for such renovation, alteration, or repair, over a three year period, commencing when the permit required is issued, or if no permit is required, when the physical portion of the renovation, alteration, or repair is commenced, is less than 50 percent of the current fair market value of all of the buildings located on the same lot. Vernon General Plan Housing Element 2014-2021 Housing Element - 22 develop those criteria at this time since there are only five private residences in Vernon. The Major Alteration provision does not constrain the maintenance of the existing housing stock, as property owners are permitted to undertake a broad array of improvements that extend the life of residential structures and improve unit conditions. Under State law, any and all such improvements can be pursued consistent with Health & Safety Code Section 17922(d) and Section 17958.8 relating to the alteration and repair of existing buildings. Section 17922(d) relates to the standards adopted by the State, which the Zoning Ordinance in no way invalidates. This section discusses the use of original materials and methods for the repair, replacement, or extension as long as it meets Building Code standards. The Zoning Ordinance has no provisions or limitations on the construction materials utilized. Section 17958.8 is similar, as it is addresses the use of original construction materials and methods. Nothing in the Zoning Ordinance or Building Code prohibits the use of original materials and methods, with the exception of an unreinforced masonry structure, which would have to be seismically retrofitted. As no residential units in Vernon are constructed of unreinforced masonry, this does not affect any housing units. All residential units in the City are in good condition, with no units requiring a major alteration during the planning period. Of those units owned by the City, the City intends to renovate seven units due to age, although all are currently in good, habitable condition. These seven units have had new HVAC systems installed in recent years. No residential property owners have proposed major renovations to their properties. Residential property owners participated in the recent Zoning Ordinance revision process, and none expressed opposition to the standards that apply to existing, nonconforming residential structures in the City, including the prohibitions on increasing square footage and undertaking major alterations. All residences – whether owned by the City or others – are in good condition, according to City staff. As described above, residential rehabilitation that constitutes a minor alteration (costing, over a three year period, less than 50 percent of the market value of the building) is permitted. Because minor alterations are permitted and existing standards will allow renovations of these units, the limit on major alterations is not considered an impact to the Vernon General Plan 2014-2021 Housing Element Housing Element - 23 maintenance and improvement of the City’s housing stock. As discussed later in this section, to accommodate housing needs of the disabled, the Zoning Ordinance has be revised to remove restrictions on major alterations as needed through the implementation of reasonable accommodation procedures. It is the City’s intent to encourage and actively participate in the rehabilitation of existing residential units. The process is straightforward and not burdensome; there is no entitlement process required for rehabilitation projects. Residential rehabilitation projects that are Minor Alterations or Repairs and do not exceed the existing square footage require only a building permit. The building permit process timeframe depends on the complexity of the renovation. Complex renovations involving new electrical systems, plumbing, etc. can take up to three weeks to process. The City has no intention of removing any of the 31 units in the City, as all units are in good condition. Replacement of housing units that have been demolished or destroyed due to force majeure (defined as an event that is not within the control of the owner of the property, including, without limitation, earthquake, flood, fire, and acts of war or terrorism) are permitted. A building permit would be required, and a housing unit would be permitted to be rebuilt up to the existing building square footage. The development standards for the reconstructed dwelling would be determined at that time. Building Code Amendments The City has adopted the California Building Code with some minor local amendments related primarily to industrial buildings in the City. Per Health and Safety Code Sections 17958.5 and 17958.7, the City made required findings and filed such findings with the California Building Standards Commission. The amendments include administrative processes such as the establishment of City permit fees and appeals boards, as well as requirements specific to hazardous and industrial uses such as fire access roads, spray booths, and storage of explosive and flammable materials. Vernon has also made additional amendments to protect the safety of workers and residents within the City. Specifically, the City requires all wiring to be in a metallic conduit, to protect workers and residents from hazards of accidentally driving a nail or screw through wiring. There is a marginal cost increase associated Vernon General Plan Housing Element 2014-2021 Housing Element - 24 with this precaution, but the benefit associated with safer installation outweighs the cost. The City has also made amendments to require Class A and B roofing material, which is more fire resistive and can stop the potential spread of fire. While this type of roofing material may be more expensive than some standard materials, this amendment is necessary to prevent and quickly extinguish fires that may have far more costly impacts. As such, no restrictions or amendments have been adopted in the Building Code that would constrain housing in the City. Permit and Infrastructure Fees The City assesses various fees to cover the costs of permit processing (Table H-6). Most of the fees charged are flat fees based on the cost of services, or tiered fees based on the size and cost of the improvement. Fees charged are comparable to surrounding communities in Los Angeles County, and as such, do not pose a constraint to housing maintenance and preservation. Owners intending to renovate or improve existing residential units are required to obtain a building permit for a minor alteration. The fee, which is reviewed annually, is based on the cost of the improvement. Because future residential development will occur on no more than two parcels on properties owned by the City, no special fees will be required for processing development applications. The vehicle for approving projects will be through a Development Agreement with the City. Because the development will occur on existing lots well served by streets, water lines, sewer lines, and all other urban- level infrastructure, no off-site improvements will be required to allow housing development to proceed. Vernon General Plan 2014-2021 Housing Element Housing Element - 25 Table H-6 Permit and Processing Fees Building Permits Cost of Renovation Fee $1.00 to $2,000 $80 $2,001 to $5,000 $80 for the first $2,000 plus $4 for each additional $100 $5,001 to $25,000 $200 for the first $5,000 plus $10 for each additional $1,000 $25,001 to $50,000 $400 for the first $25,000 plus $7.50 for each additional $1,000 $50,001 to $100,000 $587.50 for the first $50,000 plus $5.50 for each additional $1,000 $100,001 to $500,000 $862.50 for the first $100,000 plus $4 for each additional $1,000 $500,001 and up $2,462.50 for the first $500,000 plus $3.10 for each additional $1,000 Inspection and Other Fees Description Fee Inspection Outside of Normal Hours (minimum of 4 hours) $89.70/hour (minimum of $358.80) Reinspection Fee $89.70/hour Additional Plan Review $150/hour Final, Parcel, or Tentative Map $1,250 - $2,000 Conditional Use Permit $2,875 Zoning Variance or Amendment $2,000 Building Code Variance $1,000 Source: City of Vernon Fees, Effective July 1, 2008 Housing Maintenance The Vernon Department of Community Services is responsible for code enforcement and the maintenance and upkeep of all City-owned units. Enforcement of building code standards does not constrain the improvement of housing in Vernon but instead serves to maintain or improve the condition of the limited, existing housing stock. Of the 31 units in the City, only five are not owned by the City. City staff has investigated and determined that none of these Vernon General Plan Housing Element 2014-2021 Housing Element - 26 five units requires significant rehabilitation. At this time, an active code enforcement program is unwarranted due to the limited number of privately owned units (five) and the fact all units are currently in good condition and continue to be well maintained by the owners. The City encourages active maintenance of the housing stock, as evidenced by the extensive rehabilitation the City has undertaken on those housing units that it owns. Community Services Staff is active in the community, and will respond to any visible code enforcement violations or complaints that may require rehabilitation of units. Property owners are permitted and encouraged to perform proper upkeep and maintenance, which can include renovations, as long as the existing square footage is not exceeded and the cost of the renovation, over a three-year period, does not exceed 50 percent of the market value of buildings on the lot. For all practical purposes, all other controls, permit processes, and fees do not constrain the maintenance and preservation of the City’s housing stock. Constraints to Housing for Persons with Disabilities The City has adopted the California Building Standards Code. Standards within the Code of the City of Vernon (through the adoption of the California Building Standards Code) include provisions to ensure accessibility for persons with disabilities. These standards are consistent with the Americans with Disabilities Act. No local amendments that would constrain accessibility or increase the cost of housing for persons with disabilities have been adopted, except that the Zoning Ordinance would not permit the floor area of the residence to be increased or permit any major alterations that equal or exceed 50 percent of the current fair market value of the buildings on the lot. These restrictions have been addressed the implementation of a reasonable accommodation procedures to accommodate housing needs of the disabled (discussed below). Definition of Family Sometimes, a city’s definition of “family” can limit access to housing for persons with disabilities when the word is narrowly defined. This can illegally limit the use of housing as group homes for persons with disabilities, but not limit housing for families. The Vernon Zoning Ordinance does not define family, and therefore is nondiscriminatory in its application. Vernon General Plan 2014-2021 Housing Element Housing Element - 27 Reasonable Accommodation The Fair Housing Act, as amended in 1988, requires that cities and counties provide reasonable accommodation to rules, policies, practices, and procedures where such accommodation may be necessary to afford individuals with disabilities equal housing opportunities. While fair housing laws intend that all people have equal access to housing, the law also recognizes that people with disabilities may need extra tools to achieve equality. Reasonable accommodation is one of the tools intended to further housing opportunities for people with disabilities. Reasonable accommodation provides a means of requesting from the local government flexibility in the application of land use and zoning and building regulations or, in some instances, even a waiver of certain restrictions or requirements because it is necessary to achieve equal access to housing. Cities and counties are required to consider requests for accommodations related to housing for people with disabilities, and to provide the accommodation when it is determined to be “reasonable” based on fair housing laws and the case law interpreting the statutes. State law allows for a statutorily based four-part analysis to be used in evaluating requests for reasonable accommodation related to land use and zoning matters and can be incorporated into a reasonable accommodation ordinance or procedures. This analysis gives great weight to furthering the housing needs of people with disabilities and also considers the impact or effect of providing the requested accommodation on the City and its overall zoning scheme. Developers and providers of housing for people with disabilities must be ready to address each element of the following four-part analysis: The housing that is the subject of the request for reasonable accommodation is for people with disabilities as defined in federal or state fair housing laws; The reasonable accommodation requested is necessary to make specific housing available to people with disabilities who are protected under fair housing laws; The requested accommodation will not impose an undue financial or administrative burden on the local government; and Vernon General Plan Housing Element 2014-2021 Housing Element - 28 The requested accommodation will not result in a fundamental alteration in the local zoning ordinance. The City abides by the Fair Housing Act, and has instituted a clearly defined process for making requests for reasonable accommodation to provide exceptions in zoning, land-use, permitting processes, and building codes. The City has developed reasonable accommodation procedures in its Zoning Ordinance and will provide information on the procedures on the City’s website (Housing Element Program 4). The State has removed any City discretion for review of small group homes for persons with disabilities (six or fewer residents). The City does not impose additional zoning, building code, or permitting procedures other than those allowed by State law. The City does not impose special permit procedures or requirements that could impede the retrofitting of homes for accessibility. A retrofit would be permitted as a minor alteration (requiring a building permit), as long as the cost of the retrofit was less than 50 percent of the market value of the buildings. The City’s requirements for building permits are standard, straightforward, and not burdensome. No CUP or other special permitting requirements are required for retrofitting homes for accessibility. The City’s adopted reasonable accommodation procedures are ministerial and include, but not be limited to, identifying who may request a reasonable accommodation (i.e., persons with disabilities, family-members, landlords, etc.), timeframes for decision-making, and provision for relief from the various land-use, zoning, or building regulations that may constrain the housing for persons of disabilities. The procedure also includes consideration of allowing an increase in habitable floor area of an existing residence to accommodate disabled persons. The City will also explore the feasibility of offering fee reductions for permit processes that involve retrofitting residences for accessibility purposes. Vernon General Plan 2014-2021 Housing Element Housing Element - 29 3.2 Non-governmental Constraints to Housing In Vernon, limited land is available which would be suitable for the development of housing. The Housing Element inventory of vacant and underutilized sites identifies two potential sites for residential development. The limited sites available for residential development are due to serious environmental conditions which render the majority of sites throughout Vernon unsuitable for residential development. Environmental factors affecting potential residential development are related to hazardous materials storage and processing, background contamination, noxious odors, noise pollution, and truck and railroad traffic generated by the City’s pervasive industrial land uses. Inadequate access to residential services is an additional constraint to residential development in the City. These factors contribute to the limited number of sites available for residential development. Market Constraints Government Code Section 65583(a)(5) requires communities to include an analysis of potential and actual nongovernmental constraints upon the maintenance, improvement, or development of housing for all income levels, including the availability of financing, the price of land, and the cost of construction. Based upon information regarding the Vernon commercial and industrial market, recent (2012) sales for large developed industrial sites have been priced at approximately $96 per square foot, depending on location, soil condition, and necessary demolition costs.4 Effective land costs, which also include remediation required to make old industrial sites developable for residential use, make the cost of land significantly higher. Land costs for vacant sites have been priced at approximately $1.4 million per acre of land ($31 per square foot of vacant land). 5 Additional costs that would also have to be incurred to make land suitable for residential development include testing for ground contamination, remediation for residential development, and providing minimum safety and nuisance improvements. Although these 4 Loopnet.com Industrial Properties for Sale Search. August 15, 2012. <http://www.loopnet.com> 5 Loopnet.com Industrial Properties for Sale Search. August 15, 2012. <http://www.loopnet.com> Vernon General Plan Housing Element 2014-2021 Housing Element - 30 additional costs might be feasible if the sites were otherwise suitable for residential development, the environmental problems from surrounding uses are so severe that both private market and assisted housing development is precluded on any site in the City. Because the majority of the City’s housing stock is owned and managed by the City, maintenance and improvements are overseen and funded by the City. As such, there are no market constraints on the maintenance of housing in the City. The City actively performs maintenance and repairs on all City-owned buildings. Hazardous Materials With its history as an industrial City dating to incorporation in 1903, heavy and prolonged industrial use in Vernon is reflected in the following conditions (refer to Figure H-2): A high concentration of both underground (38 facilities with 82 underground storage tanks) and above-ground hazardous material storage tanks throughout the City. There are also 20 leaking underground storage tanks clean-up sites. Within the City, approximately 570 businesses handle/store hazardous materials. Thirty-eight of these businesses handle high levels of extremely dangerous materials regulated by the State. Numerous underground pipelines throughout the City, many carrying potentially explosive materials Vernon General Plan 2014-2021 Housing Element Housing Element - 31 BANDINIBLVD61stStFruitlandAv58thSt60thStEWASHINGTONBLVD56thStSAlamedaStSLAUSONAVRANDOLPHSTSSANTAFEAVEAlcoaAvDistrictBlvdSotoStEasternAv54thStSBoyleAvPacific Blvd52ndStUnion Pacific AvEVernonAvGiffordAvE55thStLONGBEACHAVESlausonAvFruitlandAvLOSANGELESRIVERMaywood AvFishburnAv59thPlPineAvE26ThStE57thStE50thStLEONISBLVDTriggs StHolmesAvKingAvE46thStMalabar StSheilaStSevilleAvClarendonAvNoakesSt59thPlCoronaAvEVERNONAVESlausonAv57thStSATLANTICBLVDUNIONPACIFICRRBURLINGTONNORTHERNSANTAFERRE27thStCarmelitaAvE38thSt52NdPlE58thStE44thStMilesAvE25thStE51stStE48thStEmeryStCoutsAvE 49th StAlbanyStE52ndStTELEGRAPHRDFRUITLANDAVE54thStAlcoaAvIndianaStRoss StLeonisStE56thStE54thStE53rdStArbutusAvE15ThStLindberghLnE22NdStMalburgWyExchangeAvNobelStVioletAlBickettStAstorAvAyersAvE 52ndP lMcBirdAvLauraAvDunham StRansomStMaywoodAvE48thPlHamptonStCharterStE60thStE41stPlE24thStStauntonAv60thPlSHerbertAvE45thStBelgraveAvSIndianaStWalkerAvSierraPineAvBANDINIBLVDLOSANGELESJUNCTIONRRUNIONPACIFICRRE43rdStE58thPlSBonnieBeachPlPackersAvSevilleAvLugoStLosPalosStSSunolDrChambersStHolabird AvHawthorneAvFurlongPlAlcoaAv53rdSt55thStUNION PACIFIC RRBURLINGTON NORTHERN SANTA FE RRUNIONPACIFICRRMETRO BLUE LINE/SPT CO RRUNIONPACIFICRRE49ThStESlausonAvSheilaSt61st StE51stStL o n g B e a c h F r w y Belgrave AvDISTRICTBLVD26ThStE26thStAyersAvEVERNONAVIrv ing St RANDOLPHSTLomaVistaAv57thStEverettAvLomaVistaAvE37THSTESLAUSONAVE45thStE46thStE42ndStE50thStE52ndStE54thStPACIFICBLVDE28thST30thStE45thStE46thStSaintCharlesStE52ndStRossStE37thStALAMEDASTBOYLEAVSOTOSTSSotoStSSantaFeAvE 49th StMartinLutherKingJrBlvdE41stStE40thPlAlamedaStSSantaFeAvRegentStE 26th StSevilleAvDOWNEYRDSATLANTICBLVDE50thSt52ndSt54thSt56thSt58thSt55thSt58thStMayflowerAv61stPlWoodlawnAv61stStFigure H-20 1,200 2,400 3,600FeetLast Update: Hogle Ireland, August 2012, Source: PCR, Constraints Analysis of Potential HousingSites in Vernon, 2012.City BoundariesVernon City BoundaryVernon Sphere of InfluenceLEGEND´Highly Toxic Regulated SubstancesCompanies with Regulated Substances Exceeding Threshold QuantitiesCalifornia Accidental Release Prevention (CalARP) Program Vernon General Plan Housing Element 2014-2021 Housing Element - 32 Residual soil contamination resulting from prior manufacturing activities on the sites and from previously abandoned chemical waste, open disposal pits, aeration ponds, landfills or petroleum related activities (a high lead content in the soil is common). Six sites in Vernon are on the EPA Superfund List, but none of them are on the National Priority List. Approximately 130 miles of railroad track historically treated with herbicides for weed control. Rights-of way show patterns of contamination from spilling, overfilling, or transfer of chemicals. Four California EPA-permitted hazardous waste treatment, storage and disposal facilities Ten closed landfill sites Overfilling storage tanks, leaking pipes, and leaking tanks have resulted in residual soil contamination in Vernon. Sixteen sites have been declared Proposition 65 sites (determined by laboratory tests to have excessive carcinogenic or teratogenic chemical contamination). Remediation plans are required to decontaminate the soil. Due to high background and other petroleum contamination and lack of feasible clean-up options, several sites were remediated with covenants being recorded to advise future purchasers of the presence of contamination. Due to public health concerns, these sites would be unsuitable for future sensitive land uses such as housing. A significant potential for chemical spills or accidents exists due to the high concentration of underground storage tanks in Vernon. The City’s Underground Tank Program has resulted in the removal of over 1,000 tanks. Additionally, where structures were threatened by tank removal, numerous underground tanks were abandoned in place. Another component of hazardous materials control in Vernon is the “right to know” program. All businesses in the City are required to submit inventories of all hazardous materials used or stored. The City currently has 571 businesses that handle or store hazardous materials. Class C businesses with very high maximum daily volumes (2,001 to 1,000,000 pounds) are the most prevalent, and are located throughout the City. The risk Vernon General Plan 2014-2021 Housing Element Housing Element - 33 of upset from businesses handling such high volumes of chemicals, many of which are toxic, is a factor that must be considered in land use planning. If high levels of certain highly toxic chemicals are present in a business’ hazardous materials inventory, these businesses are further regulated through the California Accidental Release Prevention Program (CALARP). Such businesses are required to provide the City’s Environmental Health Department with a CALARP report detailing how they plan to prevent the release of such chemicals, as well as presenting a plan for clean-up and notification if there were an accidental release. Such regulated chemicals include ammonia and chlorine gas and could impact a large geographic area if released. As illustrated in Figure H-2, Vernon currently has 38 businesses regulated under CALARP. The locations of businesses throughout the community with underground storage tanks and/or use or storage of chemical materials indicate that the entire City is subject to chemical spills or accidents, thereby illustrating its inappropriateness for future residential development. In summary, Vernon’s prolonged history as an industrial City has resulted in significant background contamination. Industries that store or use hazardous materials are pervasive throughout the City. Noxious Odors Numerous industries that generate noxious odors operate in Vernon, including several focused on the slaughtering and rendering of animals. Overlay districts have been designated in the City’s General Plan and Zoning Ordinance to isolate the locations of offensive industrial uses responsible for excessive noxious odors. These overlay districts include a “Slaughtering Overlay” for uses which involve the slaughtering of animals, and a “Rendering Overlay” for the location of rendering facilities. These uses generate significant adverse effects related to odor and release of toxic materials, making residential land uses highly incompatible within their vicinity. Revisions to the Zoning Ordinance will include new standards to address odor control in the Rendering and Slaughtering Overlay Districts. Vernon General Plan Housing Element 2014-2021 Housing Element - 34 Noise As could be expected in a highly industrial city, properties in Vernon are exposed to high levels of noise emanating from stationary industrial activity, as well as from trucks, automobiles, and railroad operations. Numerous companies operate equipment such as large presses and pumps which produce excessive vibrations and generate noise well beyond the level of acceptability for noise-sensitive land uses within the vicinity. Arterial roadways in Vernon have a very high proportion of truck traffic (approximately 30 percent), thereby intensifying noise levels along the City’s roadways. In addition, four main railroad lines and a number of switching operations are located in the City, and these generate significant levels of noise day and night. Figure H-3, derived from the Noise Element, presents noise contours developed for Vernon in 2007 as part of the update to the General Plan. The Zoning Ordinance establishes a one-hour standard of 65 dB(A) between 7:00 A.M. and 10:00 P.M. within 0.10 mile of a school or residence, and a 60 dB(A) standard between 10:00 P.M. and 7:00 A.M. within 0.10 mile of a school or residence. As evidenced by the contour map, most properties in Vernon are exposed to noise levels of 65 CNEL6 or greater, and therefore are normally incompatible with sensitive land uses. The noise contours are based on roadway traffic and do not account for stationary noise sources. The probability is that areas mapped as being outside the 65 dB CNEL may in fact experience excessive noise levels from intermittent or other sources. Truck and Railroad Traffic Vernon is traversed by approximately 130 miles of railroad tracks, with approximately 96 at-grade and seven grade- separated railroad crossings. As previously mentioned, truck traffic is extremely heavy, comprising nearly one-third of all traffic in the City. These conditions not only contribute to excessive noise levels, but also create safety hazards for pedestrians, particularly a problem for the elderly, persons with disabilities, and families with children. 6 Community Noise Equivalent Level (CNEL) is a noise measure that accounts for increased human sensitivity to noise at night. Vernon General Plan 2014-2021 Housing Element Housing Element - 35 BANDINIBLVD61stStFruitlandAv58thSt60thStEWASHINGTONBLVD56thStSAlamedaStSLAUSONAVRANDOLPHSTSSANTAFEAVEAlcoaAvDistrictBlvdSotoStEasternAv54thStSBoyleAvPacific Blvd52ndStUnion Pacific AvEVernonAvGiffordAvE55thStLONGBEACHAVESlausonAvFruitlandAvLOSANGELESRIVERMaywood AvFishburnAv59thPlPineAvE26ThStE57thStE50thStLEONISBLVDTriggs StHolmesAvKingAvE46thStMalabarStSheilaStSevilleAvClarendonAvNoakesSt59thPlCoronaAvEVERNONAVESlausonAv57thStSATLANTICBLVDUNIONPACIFICRRBURLINGTONNORTHERNSANTAFERRE27thStCarmelitaAvE38thSt52NdPlE58thStE44thStMilesAvE25thStE51stStE48thStEmeryStCoutsAvE 49th StAlbanyStE52ndStTELEGRAPHRDFRUITLANDAVE54thStAlcoaAvIndianaStRoss StLeonisStE56thStE54thStE53rdStArbutusAvE15ThStLindberghLnE22NdStMalburgWyExchangeAvNobelStVioletAlBickettStAstorAvAyersAvE52ndP lMcBirdAvLauraAvDunham StRansom StMaywoodAvE48thPlHamptonStCharterStE60thStE41stPlE24thStStauntonAv60thPlSHerbertAvE45thStBelgraveAvSIndianaStWalkerAvSierraPineAvBANDINIBLVDLOSANGELESJUNCTIONRRUNIONPACIFICRRE43rdStE58thPlSBonnieBeachPlPackersAvSevilleAvLugoStLosPalosStSSunolDrChambersStHolabird AvHawthorneAvFurlongPlAlcoaAv53rdSt55thStUNION PACIFIC RRBURLINGTON NORTHERN SANTA FE RRUNIONPACIFICRRMETRO BLUE LINE/SPT CO RRUNIONPACIFICRRE49ThStESlausonAvSheilaSt61st StE51stStL o n g B e a c h F r w y Belgrave AvDISTRICTBLVD26ThStE26thStAyersAvEVERNONAVIrving St RANDOLPHSTLomaVistaAv57thStEverettAvLomaVistaAvE37THSTESLAUSONAVE45thStE46thStE42ndStE50thStE52ndStE54thStPACIFICBLVDE28thST30thStE45thStE46thStSaintCharlesStE52ndStRossStE37thStALAMEDASTBOYLEAVSOTOSTSSotoStSSantaFeAvE 49th StMartinLutherKingJrBlvdE41stStE40thPlAlamedaStSSantaFeAvRegentStE 26th StSevilleAvDOWNEYRDSATLANTICBLVDE50thSt52ndSt54thSt56thSt58thSt55thSt58thStMayflowerAv61stPlWoodlawnAv61stSt757060658070656565656565608065606570708060 6065 6070657070656070656575757065 7 5 60 7 0 65656565657060706560807560607070 6065806060607070 6560606560606560657065 7060Figure H-30 1,200 2,400 3,600FeetLast Update: Hogle Ireland, August 2012, Source: City of Vernon, 2007.City BoundariesVernon City BoundaryVernon Sphere of InfluenceLEGEND´2007 Noise ContoursNoise Contours (2007)80 CNEL75 CNEL70 CNEL65 CNEL60 CNEL Vernon General Plan Housing Element 2014-2021 Housing Element - 36 Although the construction of the Alameda Corridor has consolidated rail traffic between the Ports of Los Angeles and Long Beach and downtown Los Angeles, no plans have been announced to vacate existing mainline railroads. Some spur tracks have been eliminated, but have been replaced by truck transportation. Also, the rail lines are being considered as routes for future transit rail traffic connecting Orange County to downtown Los Angeles’ Union Station. Figure H-4 indicates the principal transportation elements that contribute to noise and pollution in the City of Vernon: the Long Beach Freeway, arterial roadways, collector streets and mainline railroads. Residential Service Adequacy Residential development requires the provision of services to meet the needs of the resident population. Services provided at the municipal level include education, recreation, and local retail goods and services. While few such residential services are situated within Vernon, they are generally located within close enough proximity to adequately serve currently existing residences in the City via car or public transportation. However, access to these residential services is along roadways with high levels of track traffic, railroad crossings, and loading activities. These conditions make pedestrian access to residential service facilities difficult and unsafe, particularly for children. However, areas that border the residential neighborhoods of the adjacent city of Maywood are in close proximity to community services, including schools, parks, and local shopping. Summary of Constraints to Residential Development Environmental degradation related to hazardous materials and background contamination, noxious odors, noise pollution and truck and railroad traffic present land use conflicts for future residential development in the City. In addition, the lack of adequate, safe access to residential services acts to constrain housing opportunities in Vernon. Although extensive industrial development throughout Vernon has resulted in environmental conditions that limit new housing sites, one or two areas along the City’s southern boundary could potentially accommodate a very limited amount of new residential development to meet the City’s good governance commitment to the State legislature. Vernon General Plan 2014-2021 Housing Element Housing Element - 37 BANDINIBLVD61stStFruitlandAv58thSt60thStEWASHINGTONBLVD56thStSAlamedaStSLAUSONAVRANDOLPHSTSSANTAFEAVEAlcoaAvDistrictBlvdSotoStEasternAv54thStSBoyleAvPacific Blvd52ndStUnion Pacific AvEVernonAvGiffordAvE55thStLONGBEACHAVESlausonAvFruitlandAvLOSANGELESRIVERMaywood AvFishburnAv59thPlPineAvE26ThStE57thStE50thStLEONISBLVDTriggs StHolmesAvKingAvE46thStMalabarStSheilaStSevilleAvClarendonAvNoakesSt59thPlCoronaAvEVERNONAVESlausonAv57thStSATLANTICBLVDUNIONPACIFICRRBURLINGTONNORTHERNSANTAFERRE27thStCarmelitaAvE38thSt52NdPlE58thStE44thStMilesAvE25thStE51stStE48thStEmeryStCoutsAvE 49th StAlbanyStE52ndStTELEGRAPHRDFRUITLANDAVE54thStAlcoaAvIndianaStRoss StLeonisStE56thStE54thStE53rdStArbutusAvE15ThStLindberghLnE22NdStMalburgWyExchangeAvNobelStVioletAlBickettStAstorAvAyersAvE52ndPlMcBirdAvLauraAvDunham StRansomStMaywoodAvE48thPlHamptonStCharterStE60thStE41stPlE24thStStauntonAv60thPlSHerbertAvE45thStBelgraveAvSIndianaStWalkerAvSierraPineAvBANDINIBLVDLOSANGELESJUNCTIONRRUNIONPACIFICRRE43rdStE58thPlSBonnieBeachPlPackersAvSevilleAvLugoStLosPalosStSSunolDrChambersStHolabird AvHawthorneAvFurlongPlAlcoaAv53rdSt55thStUNION PACIFIC RRBURLINGTON NORTHERN SANTA FE RRUNIONPACIFICRRMETRO BLUE LINE/SPT CO RRUNIONPACIFICRRE49ThStESlausonAvSheilaSt61st StE51stStL o n g B e a c h F r w y Belgrave AvDISTRICTBLVD26ThStE26thStAyersAvEVERNONAVIrv ing S t RANDOLPHSTLomaVistaAv57thStEverettAvLomaVistaAvE37THSTESLAUSONAVE45thStE46thStE42ndStE50thStE52ndStE54thStPACIFICBLVDE28thST30thStE45thStE46thStSaintCharlesStE52ndStRossStE37thStALAMEDASTBOYLEAVSOTOSTSSotoStSSantaFeAvE 49th StMartinLutherKingJrBlvdE41stStE40thPlAlamedaStSSantaFeAvRegentStE 26th StSevilleAvDOWNEYRDSATLANTIC BLVDE50thSt52ndSt54thSt56thSt58thSt55thSt58thStMayflowerAv61stPlWoodlawnAv61stStFigure H-40 1,200 2,400 3,600FeetLast Update: Hogle Ireland, July 30, 2007.Source: City of Vernon and Los Angeles County, 2006.Major Transportation CorridorsCollector StreetArterial StreetFreewayRailroadLEGEND´Major Transportation CorridorsCity BoundariesVernon City BoundaryVernon Sphere of Influence Vernon General Plan Housing Element 2014-2021 Housing Element - 38 4.0 HOUSING OPPORTUNITIES As described in Section 3.0, due to inherent incompatibilities between residential uses and the City’s heavy industrial environment, future residential development is for the most part not desirable or recommended anywhere in Vernon. The City’s policy over many decades has been to discourage development of any new housing units. However, given the City’s commitment to the State legislature to expand the voter base, sites must be identified where 30 to 50 new units could be built in Vernon, provided that impacts associated with pervasive industrial operations and extensive site contamination can be wholly addressed, and further provided that housing sites provide new residents with suitable access to schools, open space, and shopping. Proposed sites for new residential housing would be preferred along Vernon’s boundaries, near residential neighborhoods in the adjacent cities of Maywood and Huntington Park. These areas are less impacted from Vernon industrial uses and trucking traffic, but also have good access to services and amenities that support established residential neighborhoods in these adjacent cities. To assess the current potential for residential development in Vernon as required under Housing Element statutes, staff has identified both vacant properties and underutilized buildings, defined as dilapidated and/or unreinforced masonry structures suitable for demolition. City staff conducted a field survey of vacant and underutilized properties throughout the entire City. Although some of these sites are located throughout the City, staff subsequently narrowed the potential sites down to areas in the City that are in close proximity to community services and amenities. Potential sites within the Commercial Overlay District were also dismissed due to the potential impacts to residential uses being close to industrial uses. In addition, a key consideration was to ensure that any new residential development would not impede the ability of existing or future adjacent industrial properties to attract a broad range of industrial users, consistent with the City’s mission. To permit housing at the potential sites identified, the City is amending the Land Use Element to establish a Housing Overlay, where residential uses are permitted at a density of up Vernon General Plan 2014-2021 Housing Element Housing Element - 39 to 30 units per acre. A similar approach is being used in the Zoning Ordinance to correspond to the General Plan designation. In the Zoning Ordinance, the Housing (-H) overlay district will allow housing development with approval of a Development Agreement. This approach is being used given Vernon’s unique character as an industrial city. The Development Agreement will provide for maximum flexibility for development standards while ensuring appropriate features are incorporated into a project to address surrounding industrial businesses in Vernon. The Zoning Ordinance provisions for the Housing overlay district include that all Development Agreements, at a minimum address those standards outlined on pages 20 and 21 of this element. Potential Residential Housing Sites Two vacant sites and underutilized properties were considered to have some limited potential for residential development, and one site was identified as having the potential to accommodate emergency housing. These sites are described in Table H-7. The following discussion evaluates these sites in terms of environmental safety and residential service adequacy. Table H-7 Potential Housing Sites Site No. Location Zoning Maximum Density Assumed Density Acreage Total Units Potential Sites for Housing A 4675 E. 52nd Drive General Industry (I) 30 du/ac 24 du/ac 2.06 49 B 4459 E. 52nd Drive General Industry (I) 30 du/ac 24 du/ac 0.52 12 Total 2.58 61 Site A Site A is a 2.1-acre site located along the northern side of 52nd Drive and owned by the City of Vernon. The south side of 52nd Drive is a residential neighborhood located in Maywood. The site is approximately 500 feet southeast of the Atlantic Boulevard and District Boulevard intersection, and several hundred feet south of the Los Angeles River. Site A is entirely vacant. North of the site is a railroad line, and to the southeast Vernon General Plan Housing Element 2014-2021 Housing Element - 40 is Sanchez Upholstery Supply. Cal SDM, Inc., a custom metal fabrication shop and steam boiler company, is located to the northeast, across from the railroad tracks. Site B Site B is a half-acre site located in the southwestern portion of Vernon, near the intersection of District Boulevard, Fruitland Avenue, and Cudahy Avenue. The site is bounded by 52nd Street to the south, Fruitland Avenue to the north, and Cudahy Avenue to the east. The property shares three of its property boundaries with the City of Maywood. The site includes a dilapidated warehouse structure built in the 1930s that occupies nearly 50 percent of the site. The remaining site includes an asphalt area overgrown with weeds. Site B is surrounded by Pacific Coast Chemical (in Vernon) to the north, a parking area (in Maywood) to the west, residential uses (in Maywood) to the south, a union assembly hall (in Maywood) to the east, and Maywood Elementary School (in Maywood) to the southeast. Potential Emergency Shelter Sites Site C Site C is a 1.6-acre site located on the southeast corner of Alameda Street and 25th Street, immediately east of the Alameda Corridor. The site is primarily vacant and includes the remains of a building foundation. The site is bounded by produce distributors to the south, a pallet storage business to the southeast, a warehouse building to the east, and the Alameda Corridor to the west and north. Environmental Safety Environmental conditions in Vernon are generally incompatible with residential uses. However, the sites chosen for potential residential development and emergency shelters are located along the City’s periphery. The land uses surrounding the sites listed in Table H-9 include vacant lots, residential uses, a chemical distributor, an upholstery supply warehouse, an assembly hall, and an elementary school. All of the sites are exposed to truck traffic due to their locations near Alameda Street, Atlantic Boulevard, and District Boulevard. Site B is located near the intersection of 52nd Street and District Boulevard, which are both Collectors. Site C is Vernon General Plan 2014-2021 Housing Element Housing Element - 41 located at the intersection at Alameda Street, an Arterial, and 25th Street, a Collector. Site C is located along the Alameda Corridor, which includes a below-ground, triple-tracked rail line. The Noise Contour Map (Figure H-3) shows that 2007 noise levels exceed 70 CNEL all along the Alameda Corridor and I- 710 freeway, indicating residential uses are normally incompatible and should be discouraged. This would primarily affect the Site C, a potential location for emergency shelters. Site A and B are exposed to noise levels below 70 CNEL. Noxious odors are primarily related to numerous industries in Vernon involved in the slaughtering and rendering of animals, geographically concentrated within the General Plan Slaughtering and Rendering Overlay Districts east of Soto Street. All of the potential housing sites (Sites A, B, and C) are located more than one-half mile from these districts, and will not likely be subjected to the odor impacts, depending on prevailing wind conditions. City records indicate that all three potential housing and emergency shelter sites are exposed to levels of hazardous materials from underground tanks, soil contamination, and chemicals used for operations in the adjacent area. With approximately 570 businesses currently using or storing hazardous materials, over 80 underground storage tanks, and four hazardous waste treatment facilities, the presence of hazardous materials and hazardous waste is evident throughout the City. A total of 37 businesses utilize regulated substances containing highly toxic materials (CALARP). If an accidental release were to occur at any of these 37 facilities, evacuation would be required for a large geographic area. Table H-8 and Table H-9 describe the locational characteristics of each site and the nearby sources of toxic materials. Vernon General Plan Housing Element 2014-2021 Housing Element - 42 BANDINIBLVD61stStFruitlandAv58thSt60thStEWASHINGTONBLVD56thStSAlamedaStSLAUSONAVRANDOLPHSTSSANTAFEAVEAlcoaAvDistrictBlvdSotoStEasternAv54thStSBoyleAvPacific Blvd52ndStUnion Pacific AvEVernonAvGiffordAvE55thStLONGBEACHAVESlausonAvFruitlandAvLOSANGELESRIVERMaywood AvFishburnAv59thPlPineAvE26ThStE57thStE50thStLEONISBLVDTriggs StHolmesAvKingAvE46thStMalabarStSheilaStSevilleAvClarendonAvNoakesSt59thPlCoronaAvEVERNONAVESlausonAv57thStSATLANTICBLVDUNIONPACIFICRRBURLINGTONNORTHERNSANTAFERRE27thStCarmelitaAvE38thSt52NdPlE58thStE44thStMilesAvE25thStE51stStE48thStEmeryStCoutsAvE 49th StAlbanyStE52ndStTELEGRAPHRDFRUITLANDAVE54thStAlcoaAvIndianaStRoss StLeonisStE56thStE54thStE53rdStArbutusAvE15ThStLindberghLnE22NdStMalburgWyExchangeAvNobelStVioletAlBickettStAstorAvAyersAvE 52ndPlMcBirdAvLauraAvDunham StRansomStMaywoodAvE48thPlHamptonStCharterStE60thStE41stPlE24thStStauntonAv60thPlSHerbertAvE45thStBelgraveAvSIndianaStWalkerAvSierraPineAvBANDINIBLVDLOSANGELESJUNCTIONRRUNIONPACIFICRRE43rdStE58thPlSBonnieBeachPlPackersAvSevilleAvLugoStLosPalosStSSunolDrChambersStHolabird AvHawthorneAvFurlongPlAlcoaAv53rdSt55thStUNION PACIFIC RRBURLINGTON NORTHERN SANTA FE RRUNIONPACIFICRRMETRO BLUE LINE/SPT CO RRUNIONPACIFICRRE49ThStESlausonAvSheilaSt61st StE51stStL o n g B e a c h F r w y Belgrave AvDISTRICTBLVD26ThStE26thStAyersAvEVERNONAVIrv ing St RANDOLPHSTLomaVistaAv57thStEverettAvLomaVistaAvE37THSTESLAUSONAVE45thStE46thStE42ndStE50thStE52ndStE54thStPACIFICBLVDE28thST30thStE45thStE46thStSaintCharlesStE52ndStRossStE37thStALAMEDASTBOYLEAVSOTOSTSSotoStSSantaFeAvE 49th StMartinLutherKingJrBlvdE41stStE40thPlAlamedaStSSantaFeAvRegentStE 26th StSevilleAvDOWNEYRDSATLANTICBLVDE50thSt52ndSt54thSt56thSt58thSt55thSt58thStMayflowerAv61stPlWoodlawnAv61stStFigure H-50 1,200 2,400 3,600FeetLast Update: Hogle Ireland, August 2012, Source: City of Vernon, 2012.LEGEND´Housing SitesHousing SitesGeneral Plan and Zoning Housing Overlay DistrictSite for Housing ConsiderationGeneral Plan and Zoning Emergency Shelter Overlay DistrictCity BoundariesVernon City BoundaryVernon Sphere of Influence Vernon General Plan Housing Element Housing Element - 43 Table H-8 Characteristics of Vacant and Underutilized Sites in Commercial/Industrial Zones Site No. Assessor Parcel # Location Site Size (Acres) GP Designation and Zone Current Site Improvements Potential Sites for Housing A 6314-002-900 4675 E. 52nd Drive 2.06 Industrial Vacant land B 6313-022-030 4459 E. 52nd Drive 0.52 Industrial Dilapidated warehouse building (built in the 1930s) Potential Sites for Emergency Shelters C 6302-009-039 25th Street 1.61 Industrial Vacant land Source: City of Vernon, Community Services Department. Table H-9 Characteristics of Vacant and Underutilized Sites in Commercial/Industrial Zones Site No. Surrounding Land Uses Truck Traffic Noise Odor Railroad Hazards Nearby Sources of Toxic Materials Released into Air (within 1/2 mile) Potential Sites for Housing A Residential, small assembly hall, Maywood Elementary School, parking lot, chemical distributor Moderate Low Low Low Trichloroethane, Certain Glycol Ethers, Copper Compounds, Lead Compounds, Methyl Ethyl Ketone, Methyl Isobutyle Ketone, N- Butyl Alcohol, Toluene, Xylene (Mixed Isomers) B Residential, vacant lot, railroad tracks, upholstery supply warehouse Moderate Low Low Moderate Ethylene Glycol, Ethylene Oxide, Propylene Oxide Potential Sites for Emergency Shelters C Alameda Corridor, pallet storage yard, produce distributer, material goods distribution warehouse Moderate Moderate Moderate High Lead Compounds Source: City of Vernon, Community Services Department and Environmental Protection Agency, Toxic Release Inventory, 2012. http://www.epa.gov/enviro/facts/tri/search.html Vernon General Plan Housing Element Housing Element - 44 Residential Service Adequacy Existing infrastructure in the City—including water, sewer, and all dry utilities—is sufficient to accommodate existing housing in the City, and could accommodate development on the sites discussed in this inventory. However, new residential development in Vernon would also require that the new residents be provided basic residential services. The services provided at the local level include education, recreation, and grocery shopping. The estimated distances to these facilities from each site are presented in Table H-10. The California Tax Credit Allocation Committee (TCAC) has established criteria for appropriate distances between residential uses and services, and provides the basis for evaluating residential service adequacy in Vernon. TCAC’s distance criteria for public elementary, middle and high schools is a maximum of one-half mile from residential development. The nearest elementary school to potential residential Sites A and B sites is Maywood Elementary in Maywood; the nearest middle school is Nimitz Middle School in Huntington Park; and the nearest high school is Maywood Academy High School in Maywood. As indicated in Table H-9, both Sites A and B meet the one-half mile locational criteria for elementary schools. The TCAC has established a maximum one-mile distance criteria within inner city areas for the distance between residential development and a full-scale supermarket where grocery staples, fresh meat, and produce are sold. The closest full service grocery store to the potential residential sites in Vernon is a Food 4 Less, located on Slauson Avenue in Maywood. Review of Table H-9 indicates that both Sites A and B meets are located within one- mile of a Food 4 Less in Maywood. The TCAC’s locational criteria for public parks is a maximum of one-half mile from residential development. The nearest park to Sites A and B is Maywood Park at the intersection of 58th Street and Heliotrope Avenue in the City of Maywood. Adjacent to the park is the Maywood Activity Center, which includes a community center, gym, and indoor basketball court. Site A meets the one-half mile locational criteria for parks facility (Maywood Park). Site B is located approximately one mile away from Maywood Park. Vernon General Plan Housing Element Housing Element - 45 Table H-10 Residential Service Characteristics of Unimproved and Underutilized Sites in Commercial/Industrial Zone Site No. Nearest Elementary School Nearest Jr. High School Nearest High School Nearest Grocery Store Nearest Park/Rec. Center A ½ mile 1 ½ miles 1 mile ¾ mile ½ mile B 500 feet 1 ½ miles 1 mile ½ mile 1 mile Source: City of Vernon, Community Services Department. Both Sites A and B are located across the street from residential uses in the City of Maywood. Both sites are within walking distance to Maywood Elementary School and less than two miles from a junior high school, high school, grocery store, and park and community center. Due to the close proximity to Maywood’s residential neighborhoods, it makes if easier for children and adults to walk to residential services and avoid the truck traffic and railroad crossings typically found in the center of Vernon. Summary of Housing Opportunities Although future residential development is inappropriate in Vernon due to its pervasive industrial character, the shift in policy to allow for an increase in the City’s population to enhance government accountability has led the City to identify two sites for potential housing development and one site for emergency shelters. The potential sites are suited for residential use since they are generally close to schools and groceries stores located in adjacent communities. The number of residential units that would be could be built on these two sites will be able to accommodate the City’s RHNA of two future housing units. The following describes the City’s quantified objectives for the 2014-2021 planning period by income group. Since most of the City-owned residential dwelling units have undergone some rehabilitation since 2007, the City anticipates rehabilitating only seven City-owned residential units. As the remaining seven that were not renovated become vacant, the City will consider rehabilitating these units. (New HVAC systems were installed in these units in recent years.) The five privately owned residential units are considered in good condition and not in need of major repair; therefore, for this planning period, no rehabilitation of dwelling units are planned. In quantifying dwelling unit Vernon General Plan Housing Element Housing Element - 46 production goals in Vernon, the City wants to conserve and preserve all existing 31 housing units in the City. The City would like to produce up to 49 dwelling units, where at least two are for low and very low income categories. Table H-11 Quantified Objectives for 2014-2021 Category Very Low Income Low Income Moderate Income Above Moderate Income New Construction 2 47 0 0 Rehabilitated 0 0 7 0 Conserved 0 0 31 0 Vernon General Plan Housing Element Housing Element - 47 5.0 HOUSING PLAN The Housing Plan for the Vernon Housing Element sets forth goals, policies, and implementing programs to address the housing needs particular to the City of Vernon. Prior to presenting the goals, policies, and programs, an evaluation of the programs in the previous Housing Element (2000) is presented as a foundation for developing the Plan for the 2008-2014 Housing Element. 5.1 Evaluation of Previous Accomplishments State law (California Government Code Section 65588(a)) requires each jurisdiction to review its housing element as frequently as appropriate and evaluate: The appropriateness of the housing goals, objectives, and policies in contributing to the attainment of the state housing goal; The effectiveness of the housing element in attainment of the community’s housing goals and objectives; and The progress in implementation of the housing element. Table H-12 shows the progress the City made in implementing the 2008-2014 Housing Programs. An analysis of the effectiveness and continued appropriateness of these programs is provided, and the goals, policies, and programs from the 2008-2014 Housing Element have been updated to reflect this evaluation. The major focus of housing policy in Vernon is to preserve the existing housing stock in the City and to ensure that existing housing in the City is well maintained. A secondary goal is to identify a site or sites suitable for new housing pursuant to the City’s good governance initiative, and a site that can accommodate emergency shelters pursuant to the requirements of SB2. The Housing Element addresses the health and safety of residents living on or adjacent to industrial sites. The City actively discourages the occupation or construction of dwelling units on or near industrial sites since activities on industrial sites includes operations potentially hazardous to residents. In addition, all units are required to have adequate insulation, air conditioning, approved air and water filtration systems, and sound insulation to Vernon General Plan Housing Element Housing Element - 48 reduce potentially adverse air quality and noise-related impacts from adjacent industrial uses.7 7 Vernon does not require an adequate sites implementation/rezone program per Government Code Section 65584.09; the City’s RHNA of zero required no sites during the previous planning period. Vernon General Plan Housing Element Housing Element - 49 Table H-11 Housing Element Accomplishments for 2008-2014 Planning Period Policy/Program Accomplishments Goal H-1: Ensure that all housing units are maintained in decent, safe, and sanitary condition. Policy 1.1 Continue to enforce all relevant building and zoning codes to ensure that all residential units are adequately maintained. Progress: The City's Department of Community Services is responsible for code enforcement activities. Due to the limited number of units in the City, staff can accurately monitor all units and has determined that all are in good repair. Effectiveness: The City has been effective in maintaining housing conditions in the City, and responds to complaints as needed. By 2008, the City completed fully renovating 19 City-owned dwelling units and added heating, ventilation, and air conditioning (HVAC) systems and upgraded the insulation in seven other units. Continued Appropriateness: Code enforcement is an important component that ensures that the limited number of units in the City remains in good repair. Program 1 Maintenance of City-Owned Residences Program 2 Code Enforcement Policy 1.2 Require any remodeled residential units to be equipped with air conditioning and sound insulation to protect residents from exposure to adverse environmental conditions. Progress: The City actively pursues maintenance on City-owned units, providing renovations on vacated units and repairs as needed on occupied units. Effectiveness: The City successfully completed the renovation of 19 units in 2008. Renovations included adding HVAC systems, and providing insulation for sound protection and energy conservation purposes. Continued Appropriateness: The City owns a majority of residences in Vernon. The City is fully involved with the maintenance and upkeep of the properties, and will continue to provide these services on other units, as they are needed. All remodeled units will be required to provide HVAC systems and sound insulation protection, such as dual paned windows. Policy 1.3 Mitigate any residential displacement impacts occurring as a result of residential demolition. Progress: No residential units were demolished during the last planning period. Effectiveness: The City is committed to maintaining the existing housing units in the City. Continued Appropriateness: The City's primary housing goal is to preserve the existing housing units. The City is committed to mitigating residential displacement impacts, should they occur. Vernon General Plan Housing Element Housing Element - 50 Table H-11 Housing Element Accomplishments for 2008-2014 Planning Period Policy/Program Accomplishments Goal H-2: Maintain all existing dwelling units within the City. Policy 2.1 Provide for the retention of existing residential units in the City that are economically and physically sound. Progress: All units in the City were retained during the last planning period. Effectiveness: The 31 residential units in the City have all been determined to be in good condition. Continued Appropriateness: The major focus of housing policy prior to 2012 in Vernon was to preserve the existing housing stock and maintain safe and viable housing units. Policy 2.2 The City will accommodate the needs of disabled residents through establishment of a reasonable accommodation ordinance or procedures for existing units. Progress: As of 2012, there are no assisted housing units in the City. The City did not allow new housing prior to 2012. Effectiveness: While there are no federally or state-assisted units in Vernon, the City owns 26 of the 31 housing units in Vernon. These units are rented at levels that are affordable to very low-income tenants. City policy focuses on retention and maintenance of the 31 existing housing units, with no plans for removal of any units, City- owned or otherwise. Continued Appropriateness: While there is no assisted housing in the City that requires monitoring, the City continued this program in the 2008 Housing Element, discussing assisted housing to address Government Code Section 65583(a)(8). Program 3 Preservation of Assisted Housing Goal H-3: Continue to promote the availability of a range in existing unit types and sizes, and equal housing opportunity in the City’s housing market on the basis of age, race, sex, marital status, ethnic background, source of income, and other factors. Policy 3.1 Prohibit discrimination in the availability of existing housing. Progress: The City has not been advised of any discriminatory practices that have occurred in regards to the availability of housing. The City will take a proactive approach in enforcing antidiscrimination laws. Effectiveness: The City has received no complaints regarding any discriminatory actions and will continue to enforce all fair housing law. Continued Appropriateness: Prior to 2012, the City's Zoning Ordinance did not allow the development of new housing in the City. As such, housing discrimination related to the siting of housing was not an issue. This program was updated in 2008 to address a range of fair housing concerns related to the existing housing stock, including access for persons with disabilities or special needs, providing greater access to equal housing opportunity. Program 4 Housing Opportunities for Residents with Special Needs Program 5 Equal Housing Opportunity Vernon General Plan Housing Element Housing Element - 51 5.2 Goals and Policies GOAL H-1: Ensure that all housing units are maintained in decent, safe, and sanitary condition. POLICY H-1.1: Continue to enforce all relevant building and zoning codes to ensure that all residential units are adequately maintained. POLICY H-1.2: Require any new or residential units undergoing a major alteration to be equipped with air filtration systems (such as HVAC systems) and sounds insulation (such as dual-paned windows) to protect residents from exposure to adverse environmental conditions. POLICY H-1.3: Mitigate any residential displacement impacts occurring as a result of residential demolition. GOAL H-2: Maintain all existing dwelling units within the City. POLICY H-2.1: Provide for the retention of existing residential units in the City that are economically and physically sound. POLICY H-2.2: Continue to accommodate the needs of disabled residents through the adopted reasonable accommodation procedure. GOAL H-3: Create opportunities for the development of new housing in areas of the City that have the least potential for adverse impacts associated with established industrial uses and truck routes. Locate such new housing nearby community services. POLICY H-3.1: Implement the Housing Overlay Zone via the Zoning Ordinance and Zoning map to allow for a limited amount of new housing construction. POLICY H-3.2: Strategically locate sites for new housing so as to minimize noise, vibration, smoke, noxious gases, glare, heat, dust, odors, air pollution, and other adverse impacts associated with industrial uses, slaughtering and rendering uses, businesses that Vernon General Plan Housing Element Housing Element - 52 release toxic materials, and trucking and railroad facilities and routes. POLICY H-3.3: Encourage development of residential uses in strategic proximity to schools, recreational facilities, commercial areas, parks and other public spaces, and transit routes. GOAL H-4: Continue to promote the availability of a range in existing unit types and sizes, and equal housing opportunity in the City’s housing market on the basis of age, race, sex, marital status, ethnic background, source of income, homelessness, physical disabilities, and other factors. POLICY H-4.1: Prohibit discrimination in the availability of existing and new housing. POLICY H-4.2: Address the housing needs of special populations and extremely low-income households through emergency shelters, transitional housing, supportive housing, and single-room occupancy units. 5.3 Programs As discussed in this Element, the Vernon City Council has adopted several good governance reform measures, including a commitment to at least double the housing stock within the City. Residential development is will be permitted at strategic locations in Vernon. SCAG adopted a future housing need of two units in Vernon as part of the 2014-2021 Regional Housing Needs Assessment, recognizing that although incompatibility of locating housing in such a heavy industrial environment may not be appropriate, there may be certain areas in Vernon where housing may be suitable. As such, programs to increase the City’s housing stock are included below. As indicated in the goals and policies, the primary goals of the Housing Element is to ensure the maintenance of the City’s existing housing stock and to allow for limited new housing opportunities. The following programs will implement these goals. Program 1: Maintenance of City-Owned Residences The City owns 26 of the total 31 housing units in Vernon, all of which are rented. The City is responsible for the maintenance and upkeep of these units. As indicated in Section 2.0, Housing Needs Assessment, of this Housing Element, all of the City-owned units Vernon General Plan Housing Element Housing Element - 53 were determined to be in good repair. In addition, in recent years the City initiated an extensive project on all City-owned units to ensure the continued longevity of existing units. In 2007, the City renovated 12 units, and an additional 14 units were renovated between 2008 and 2011. Since 2007, all 26 units have undergone renovations. The City will continue to provide maintenance to these units, thus ensuring upkeep for the majority of Vernon’s housing stock. Responsible Agency: Department of Community Services Project Funding: Departmental Budget Timeframe: Ongoing as needed. Program 2: Code Enforcement Of the five non-City owned units located in Vernon, none was determined by the City to be in need of substantial rehabilitation. Due to the limited number of privately owned units in the City, a code enforcement program would have limited application. However, it is nonetheless imperative that residential units be adequately maintained for health, safety, and aesthetic concerns. Community Services staff is active in the community and will enforce the City’s code to eliminate and prevent unsafe conditions in residential units. Community Services staff responds quickly to code enforcement complaints in Vernon. Community Services staff is active in the community and will actively monitor all residential units in the City to ensure the health and safety of City residents.Staff will respond to reports of code violations within the week that they are reported, and enforce applicable laws to ensure the safety and preservation of all housing units within the City. Responsible Agency: Department of Community Services Project Funding: Departmental Budget Timeframe: Ongoing Program 3: Preservation of Assisted Housing State law (Chapter 1451, Statutes of 1989) requires the City to identify, analyze and propose programs within the Housing Element to address the potential conversion of all federal, State and locally assisted housing developments eligible to change to non-low-income use during the next ten-year period (2008-2018). Government Code Section 65583(8) defines assisted housing developments as the following: “multi-family rental housing that Vernon General Plan Housing Element Housing Element - 54 receives governmental assistance under federal programs listed in subdivision (a) of Section 65863.10, state and local multi-family revenue bond programs, local redevelopment programs, the federal Community Development Block Grant Program, or local in-lieu fees. Assisted housing developments shall also include multi-family rental units that were developed pursuant to a local inclusionary housing program or used to qualify for a density bonus pursuant to Section 65915-65917.” Vernon has no assisted housing in its jurisdiction, as confirmed by City and State HCD staff, and through review of “Inventory of Federally Subsidized Low-Income Rental Units at Risk of Conversion” (California Housing Partnership Corporation), and the “Use of Housing Revenue Bond Proceeds - 1994” (California Debt Advisory Commission). As a result, there is no housing at risk of losing its subsidized status that must be considered in the Housing Element. Responsible Agency: Department of Community Services Project Funding: Departmental Budget Timeframe: Ongoing Program 4: Housing Opportunities for Residents with Special Needs The Fair Housing Act, as amended in 1988, requires that cities and counties provide reasonable accommodation to rules, policies, practices, and procedures where such accommodation may be necessary to afford individuals with disabilities equal housing opportunities. The City has adopted procedures in their Zoning Ordinance for housing for persons with disabilities and will provide information to residents through the City’s website. Responsible Agency: Department of Community Services Project Funding: Departmental Budget Timeframe: Ongoing Program 5: Priority Water and Sewer Services In accordance with Government Code Section 65589.7, after the Vernon Housing Element is adopted by City Council, a copy will be immediately delivered to all public agencies or private entities that provide water or sewer services to properties within Vernon. Responsible Agency: Department of Community Services Project Funding: Departmental Budget Timeframe: 2013 Vernon General Plan Housing Element Housing Element - 55 Program 6: Provision of Adequate Sites The Land Use Element Housing Overlay policy allows up to 60 residential dwelling units citywide, which is more than adequate to meet RHNA objectives for all income levels (two units). According to the sites inventory capacity analysis, the 2.1-acre housing site (Site A) located at 4675 52nd Drive is estimated to accommodate up to 49 units. The 0.5-acre housing site (Site B) located at 4675 52nd Drive can accommodate up to 12 units. Adequate zoning is in place for Site A, via the Housing Overlay. Site B may be considered as a potential housing site in the future. Together, these two sites can accommodate the total dwelling units identified under the Housing Overlay policy, not to exceed 60 units. As described on pages 37-38, the Housing Overlay allows residential uses with approval of a Development Agreement. This permitting process is applied to all residential applications and is considered necessary given Vernon’s unique industrial character. Through a Development Agreement that City can assure that measures will be in place to create the best possible housing solutions. The Development Agreement must at a minimum ensure that adequate emergency access is provided, that the development includes suitable open space amenities, and parking be provided to meet the anticipated needs of residents. On the two sites where the Housing Overlay applies, Zoning Ordinance regulations will allow for densities of up to 30 units per acre. The overlay exclusively allows for residential uses (no mixed use). Given the size of the largest site, at least 16 units can be constructed, per Section 65583.2(h) and (i) of the Government Code. The Housing Overlay is being adopted in conjunction with adoption of the Housing Element. The site on 52nd Street is to be developed with units all affordable to lower-income households, with the developer seeking Low Income Housing Tax Credit funding. In the event this development project does not move forward, the City will continue to seek a developer who can provide similar housing. While no density bonus has been deemed necessary to incentivize development of affordable housing, the City recognizes that developers can request a density bonus pursuant to State law. Because land use policy will not allow for additional housing development beyond the two sites identified in this element and given that densities are sufficient to encourage affordable housing Vernon General Plan Housing Element Housing Element - 56 projects, the City does not see the need to adopt specific regulations for density bonuses. Thus, the City Zoning Ordinance will be amended simply to reference State law. With regard to housing persons in need of emergency shelter, in conjunction with adoption of the Housing Element the City has adopted Zoning Ordinance to establish an Emergency Housing overlay zone. This zone, applied to a large property in the northwest portion of Vernon, allows emergency shelters by right (see Figure H-5). The property is over five acres in size and can accommodate one or more shelters. Like all other properties in Vernon, the site is surrounded by industrial uses. However, this particular site is easily accessible from transit routes along Santa Fe Avenue and Alameda Street. The site is currently vacant and owned by the Alameda Corridor Transportation Agency. Responsible Agency: Department of Community Services Project Funding: Departmental Budget Timeframe: Development of housing to accommodate the RHNA by 2015; amend Zoning Ordinance by May 2013 to include reference to State law regarding density bonus provisions; immediate availability of Emergency Housing Overlay site for any application for such use. Program 7: Equal Housing Opportunity The Vernon City Clerk’s Department is responsible for referring equal housing opportunity questions. Any questions or concerns raised by residents will be accepted by the City Clerk and brought before City Council for resolution. In order to disseminate information on fair housing resources more broadly, the City will place a link on the City’s website that refers to the Housing Rights Center Frequently Asked Questions webpage on housing discrimination. Also, persons in need of transitional and supportive housing can readily be accommodated within any housing development proposed in the Housing Overlay zone. In conjunction with adoption of this Housing Element, the City has amended the Zoning Ordinance to define transitional and supportive housing as a standard residential uses of property permitted within the Housing Overlay zone. Any proposal for such housing is subject to the same permitting requirements (approval of a Development Agreement to define the site plan and development parameters) as any other type of housing. Vernon General Plan Housing Element Housing Element - 57 Responsible Agency: Department of Community Services; City Clerk Project Funding: Departmental Budget Timeframe: June 2013 5.3 Redevelopment Agency Dissolution On December 29, 2011 the California Supreme Court issued a ruling upholding AB 1X 26, legislation that called for the elimination of hundreds of local redevelopment agencies in the state, including the Redevelopment Agency for the City of Vernon. The City of Vernon elected to become the Successor Agency of the former Vernon Redevelopment Agency and established an Oversight Board. As the Successor Agency, the Oversight Board oversees certain fiscal management of former Agency fund. This includes carrying out existing projects that are in various stages of development. The City was not required to set aside 20 percent of the tax increate collected in the Industrial Redevelopment Project Area to be used by the Agency to increase the City’s supply of affordable housing, because it determined that were was no housing need in the City. Therefore, there are no existing housing set-aside funds for the Industrial Redevelopment Project Area. Vernon General Plan Housing Element Housing Element - 58 This page intentionally left blank. VERNON GENERAL PLAN SAFETY ELEMENT Vernon General Plan Safety Element Safety Element - 1 SAFETY ELEMENT 1.0 PURPOSE AND FOCUS 1.1 Purpose The Safety Element identifies the natural and man-made hazards which affect public safety in the City, and establishes policies the City will pursue to minimize associated risks to life and property. Because these hazards can have significant economic consequences, identifying, understanding, and guarding against these hazards greatly benefits those who own property, work, and live in Vernon. 1.2 Focus Several different types of events could create critical situations affecting public safety in Vernon. Generally, public safety risks can be divided into two categories: environmental events and events arising from human actions. In Vernon, environmental events include earthquakes and flooding. Human-caused hazards such as chemical spills, hazardous materials release, and train, truck or plane accidents have greater potential to cause upset in Vernon given its industrial Vernon General Plan Safety Element Safety Element - 2 nature. Increasingly in all cities in the nation, the threat of terrorist activity represents a new public safety concern requiring special treatment. This Element addresses each of these potential safety risks and discusses how the City will respond to each. Also addressed are evacuation routes necessary to move people away from hazardous conditions. 2.0 IDENTIFYING AND GUARDING AGAINST HAZARDS Four natural hazards of particular importance that could affect Vernon are identified in the Natural Hazard Mitigation Plan. Earthquakes represent a significant threat, with the associated strong ground shaking and possibility of liquefaction in some areas. Flooding is a concern as well, with Los Angeles River as the major source. Unusual rainfall amounts may also cause flooding if storm drain facilities are inadequate to accommodate the resulting high volume of runoff. Inundation from dam failure is a remote possibility but must nevertheless be addressed. The fourth natural hazard is a significant windstorm event. Southern California is occasionally raked by moderate to severe wind events called “Santa Ana winds” that blow hot, dry air into the Los Angeles Basin from the desert. These winds tend to be most severe downwind of mountain passes, but can affect the urban flatlands as well. Wind speeds of up to 65 miles per hour are not uncommon, and local gusts may substantially exceed these speeds. Vernon Fire Station #3 Vernon General Plan Safety Element Safety Element - 3 Since Vernon and its surrounding areas are completely urbanized, with little natural vegetation, there is almost no risk of damage from wildfires. Urban fire protection is discussed in Section 2.2 of this Element. Human-caused hazards include the risk of explosion or leaks from stored chemical and petroleum products, or from derailment or collision of railcars or trucks carrying hazardous chemical or materials. Chemical spills are also a concern because of the industrial nature of the uses in Vernon. Fire hazards are prevalent due to the nature of the industrial uses and intensely developed character of properties. A fire during a windstorm, which combines both a natural and a human- caused hazard, can represent a serious threat to public safety. Some events are particularly difficult to anticipate and prepare a programmed response for. Since the 9/11 attack on New York’s World Trade Center, the threat of terrorist activity has been of major concern to the nation and the world. As with both natural and human-caused hazards, a terrorist event could occur outside Vernon yet directly impact the City. Programs to deal with such an event require a cooperative approach with regional agencies. Activities such as a labor strike or other demonstration usually present a low risk to public safety, but public safety personnel must plan for responses to these situations to maintain public order. Railcars carrying materials through Vernon Vernon General Plan Safety Element Safety Element - 4 The City’s Standardized Emergency Management System (SEMS) Multi-Hazard Functional Plan (MHFP) discusses and contains programs and plans for emergency responses to the safety concerns described above. This document includes pre- emergency preparedness plans and programs for mutual aid between organizations for virtually any emergency situation. 2.1 Natural Hazards Seismic Event Southern California is one of the most seismically active regions of the United States, given its location at the edge of the Pacific Plate. Although no major faults have been identified by Alquist-Priolo statewide mapping efforts as crossing through Vernon, the many fault systems that traverse Los Angeles County and the broader region, along with unmapped blind thrusts, have the potential to cause damage in the City in the event of an earthquake. Figure S-1 identifies regional fault systems, including major faults within 20 miles of the City. Severe ground shaking can cause damage to buildings with corresponding threats of injury or loss of life. Figure S-1: Regional Faults Vernon General Plan Safety Element Safety Element - 5 A secondary effect of ground shaking is soil liquefaction, which can result in building instability or failure. This is not considered a serious threat in Vernon, but some areas of the City could be affected (see Figure S-2). Liquefaction can occur when loose, unconsolidated, water-laden soils lose their structure during strong ground shaking. These hazards can be mitigated at the development stage through the removal and re-compaction of suspect soils. Vernon’s standard practice of requiring engineering studies for new development projects reduces the risk of liquefaction hazards in those susceptible areas identified on Figure S-2. Figure S-2: Liquefaction Zone In addition to damage to buildings, earthquakes often result in damage to public and private infrastructure. Ruptured gas or oil lines may result in explosions or leaks, and facilities storing chemicals or flammable materials may also be damaged causing leaks or explosion. Water lines, sewer lines, and reservoirs can also be damaged. Electrical facilities, particularly transformer and power lines, are susceptible to damage resulting in a possible injury or loss of life as well as a power loss. To reduce the scope of damage in the event of an earthquake, Vernon will continue to require new construction to meet mandated seismic safety codes. Retrofit of older structures will continue pursuant to Municipal Code requirements, and Vernon General Plan Safety Element Safety Element - 6 Los Angeles River the City will continue ongoing efforts to upgrade infrastructure pursuant to the Capital Improvement Plan. In addition, the programs the City has in place to guard against hazardous materials spills and releases also help to protect these materials from being released during ground-shaking hazards. Through both preventative measures and strong, organized emergency response, Vernon will continue to take steps to minimize risks associated with earthquakes. Flooding Although the Los Angeles River flows through Vernon for a distance longer than three miles and would frequently overflow its banks under historic natural conditions, the river was contained within a concrete-lined flood control channel early in the twentieth century, substantially reducing the potential for overflowing of the river banks or overtopping of the dams that could cause flooding of adjacent areas. In the rainy season of 2004-2005, the Los Angeles area received the second highest rainfall ever recorded, approximately three times the normal amount, yet the river channel proved adequate to accommodate this flow. In the past, localized flooding has occurred during heavy rainstorms. However, storm drain improvements have substantially reduced this problem. Flood hazards related to storm events generally are described in terms of a 100-year or 500-year flood. A 100-year flood is defined as a major flood event that has a one percent or greater chance of occurring during any one year. Flood hazard planning practices address such storms, as well as 500-year events. These floods are considered severe; however, these floods can be reasonably predicted and therefore reasonably mitigated. With the flood control system of the Los Angeles River in place, the Federal Emergency Management Agency does not identify any 100-year floodplain areas in the City of Vernon. FEMA maps identify a small portion of southeast Vernon within the 500-year flood zone (Figure S-3). The existing flood control system appears to be adequate to serve the City’s needs. Vernon General Plan Safety Element Safety Element - 7 Figure S-3: FEMA Flood Hazard Zones Dam Inundation Dam inundation occurs when structural damage to a dam results in a flood. Dam failure can occur due to an earthquake, erosion, design flaw, or water overflow during storms. Dam inundation maps represent the best estimate of where water would flow in if a dam with a full reservoir suddenly failed completely. Figure S-4 shows areas that would be affected in the event of dam failure. Nearly all of the land in Vernon lies within the potential inundation areas for both Hansen Dam and Sepulveda Dam, which are located in separate areas of the San Fernando Valley, more than 20 miles northwest of the City. In the unlikely event that a catastrophic earthquake causes the collapse of either of these dams, water and debris would flow to and then generally along the Los Angeles River in a fairly narrow stream before spreading out over a swath of the coastal plain several miles wide, including Vernon. The official map from the U.S. Army Corps of Engineers predicts that the flow from Sepulveda Dam, 24 miles away from Vernon, would take more than eight hours to reach the City. Flow from Hansen Dam, also 24 miles away, is predicted to take more than 19 hours to reach Vernon. The flow from either dam would probably peak at a depth of 2 feet in the Vernon General Plan Safety Element Safety Element - 8 Figure S-4: Dam Inundation Areas vicinity of Vernon. The expected long delay between dam breach and the arrival of the flow should give ample time for emergency services to respond, as outlined in the City’s SEMS Multi-Hazard Functional Plan (MHFP). Windstorms Windstorms present a potential hazard through their ability to damage buildings and public facilities such as street traffic control lights and public signs. In addition to the damage to buildings, the most significant threat to public safety is from flying debris. While this problem is not usually as severe as that experienced in hurricanes or tornados, maintaining public awareness of the hazard is important. Regionally, the hot, dry Santa Ana winds can create severe brushfire dangers, but this is not a particularly severe problem in Vernon, as there is little vegetation. Vernon General Plan Safety Element Safety Element - 9 2.2 Human-caused Hazards Risk of Explosion and Hazardous Materials Spills Many varied materials of an explosive or hazardous nature are stored and used by many businesses in Vernon. Because of the industrial nature of the City, the geographic scope is citywide. In addition, the presence of major rail lines and transfer yards, together with the Long Beach Freeway (I-710) and Alameda Corridor, which carry high volumes of truck and train traffic to and from the ports, pose real threats in the event of a spill. To address local storage issues, the City Environmental Health Department maintains a complete inventory of the locations where hazardous materials are stored and used. A detailed response program defines the actions to be taken by the Fire Department and Environmental Health Department in the event of a problem involving a spill or explosion. This program focuses on the evacuation of persons, as well as containment and cleanup. With regard to terrorism concerns, possible targets in Vernon include the major rail yards, power generation facilities, and any business with significant volumes of hazardous materials. Federal agencies are responsible for safe-guarding transportation facilities, and Vernon will cooperate with these agencies in these efforts. With regard to protection of local businesses, routine patrol activities of the Police Department and heightened training and vigilance are undertaken in order to address these concerns. The City will provide Police personnel with appropriate training to minimize such threats. Hazardous Materials Emergency Response operate the Spartan Super Vac Hazardous Materials Unit Vernon General Plan Safety Element Safety Element - 10 Fire Department The Vernon Fire Department is rated as Class I by Insurance Services Office, Inc., one of only ten cities in California and 35 nationwide to earn this distinction. The Department provides a variety of emergency services, including fire protection, emergency medical services, urban search and rescue, and hazardous materials control. Staff at each of Vernon’s four fire stations is fully trained for fighting fires. Each station is equipped with three to six response vehicles, but also has its own specialization. Fire Station 1 at 3375 Fruitland Avenue serves both as Fire Department headquarters and training center. The personnel at Fire Station 2, rebuilt in 2007 at 4301 Santa Fe Avenue, adjacent to City Hall, are all trained as hazardous materials specialists. Paramedics trained in advanced life support at Fire Station 3, at 2800 Soto Street, respond to all emergency situations, and this station is also home to a squad trained in all manners of urban search and rescue techniques. Despite being in a completely urbanized area, Fire Station 4 sends specialized personnel to respond to wildfires through the statewide mutual aid system. 3.0 GOALS AND POLICIES Vernon has fewer than 200 permanent residents, but the employment population approaches 45,000 during a typical 24-hour period. Police, fire, and paramedic facilities and personnel must be adequate to provide services to this larger community of workers. Public safety personnel must be prepared to handle potential emergency situations of all kinds: hazardous materials spills, explosions, earthquakes, and train accidents. Additionally, as an industrial city, Vernon must be prepared for the possibility of labor issues such as strikes disrupting the City and requiring responses from public safety personnel. GOAL S-1 Minimize the risk to public health, safety, and welfare associated with the presence of natural and human-caused hazards. POLICY S-1.1: Periodically update and maintain the Multi-hazard Functional Plan in an effort to identify potential contingencies and emergency Vernon General Plan Safety Element Safety Element - 11 conditions and define the necessary response by public safety and other personnel. POLICY S-1.2: Cooperate with other jurisdictions in the southeast area of Los Angeles County to maintain an up-to-date emergency response system for the region. POLICY S-1.3: Prepare and disseminate information to residents and businesses on preparing for and responding to a major earthquake or potential terrorist threat. POLICY S-1.4: Maintain the public water distribution and supply system facilities to provide adequate capacity to meet both everyday and emergency fire-flow needs. POLICY S-1.5: Coordinate with the Los Angeles Unified School District for protection and or evacuation of school children in the event of an emergency condition, which could affect the schools in or near Vernon. GOAL S-2 Provide a high degree of protection for all residents and workers from hazardous materials and the hazards associated with transport of such materials. POLICY S-2.1: Continue to support and encourage State efforts to identify existing or previously existing hazardous waste generators or disposal sites in the City of Vernon. POLICY S-2.2: Continue to require every business to maintain a list of the chemicals and other hazardous materials used or stored on site in accordance with appropriate material safety data sheets and otherwise in accordance with law, and to provide that list to the Fire Department and Environmental Health Department. Require that the Fire Department and Environmental Health Department to maintain a list of such materials and the location where they are stored or used to permit emergency personnel to respond appropriately, if required. Vernon General Plan Safety Element Safety Element - 12 POLICY S-2.3: Permit new residential uses only within the Housing Overlay District. Strategically identify sites for new housing in areas determined to be most compatible for housing with limited hazard impacts. GOAL S-3 Maintain high standards for the provision of City emergency services. POLICY S-3.1: Establish and implement plans for continuity of government for Vernon in the event of a catastrophe. POLICY S-3.2: Require businesses handling, transporting, or producing materials considered acutely hazardous to prepare contingency plans for accidents involving these chemicals. POLICY S-3.3: Support the development and continued updating of public safety education programs. POLICY S-3.4: Undertake steps to inform all residents and businesses of the importance of visible and clearly legible signs and street numbers in shortening the response time of emergency personnel. POLICY S-3.5: Periodically review the City's emergency service equipment to determine if it is adequate to meet the needs of changing land uses and development types. POLICY S-3.6: Require new development projects that necessitate the purchase of public safety equipment to underwrite or share in purchase costs. POLICY S-3.7: Develop a new Emergency Operations Center (EOC) with adequate space and facilities to respond to any emergency situation which may arise. POLICY S-3.8: Continue to support the Vernon Fire Department in its effort to maintain its high rating. Vernon General Plan Safety Element Safety Element - 13 GOAL S-4 Provide a high degree of protection for all workers and residents in the event of any disaster. POLICY S-4.1: Review the risks related to a possible train derailment or collision, and develop appropriate response programs. POLICY S-4.2: Review the design of new development projects to consider public safety and issues such as emergency access, defensible space, and overall safety. POLICY S-4.3: Design and maintain an effective plan for the prompt evacuation of the City in the event of a dam inundation or other major disaster requiring the removal of workers or residents from Vernon. POLICY S-4.4: Identify facilities for use as emergency/disaster shelters for those unable to leave or required to stay within the City in the event of a major disaster or emergency event. Vernon General Plan Safety Element Safety Element - 14 This page intentionally left blank. VERNON GENERAL PLAN RESOURCES ELEMENT Vernon General Plan Resources Element Resources Element - 1 RESOURCES ELEMENT 1.0 PURPOSE AND FOCUS 1.1 Purpose As a fully developed city, Vernon has few remaining natural resources in the conventional sense of undeveloped land, native vegetation, and wildlife habitat. The two natural resources that are present and important are groundwater and the air. Both have been affected by urban development, but both sustain development in the City and respresent critical regional resources. Vernon’s groundwater serves as a portion of the City’s water supply. Clean air, of course, provides a healthier environment and may help minimize some aspects of global warming. The open spaces that exist in Vernon are limited to privately owned landscaping around buildings, utility easements, rail yards, and the Los Angeles River. Given the industrial nature of Vernon, expanses of open space are not needed for recreational purposes. However, open space does provide visual relief from hard urban surfaces. Vernon General Plan Resources Element Resources Element - 2 This Element establishes City policies intended to best manage the limited available natural resources in Vernon and to encourage continued participation in broader efforts to protect the environment from harmful human activities. 1.2 Focus This Resources Element combines two elements required by the California Government Code–the Conservation Element and the Open Space Element–and focuses on the protection and preservation of resources within the City. In addition to groundwater and air resources, additional resource issues addressed are local open space, historic/cultural resources, and the national issue of energy use. 2.0 IDENTIFYING AND PROTECTING LOCAL RESOURCES 2.1 Water Quality and Supply Potable water resources in Vernon are limited to the groundwater basins that underlie the City (and surrounding lands) and recycled water. Local groundwater is contained within the Los Angeles River and Gaspar aquifers, which supply a significant portion of the water used by businesses in Vernon. Because these basins extend beneath surrounding jurisdictions, activities both in Vernon and other cities affect the quantity and quality of groundwater. Potential contamination and depletion of the underground basins have been historic concerns, and conditions are continuously monitored to guard against possible interruption of supply. Water quality standards established by federal and State agencies and requirements for water quality monitoring protect industrial users from contamination and ensure sage drinking water supplies. In particular, National Pollution Discharge Elimination Systems (NPDES) requirements enforced by the State Regional Water Quality Control Board require the control and clean up of surface runoff prior to its discharge into storm drain systems and ultimately, into groundwater basins or surface waters. State agencies continue to press for percolation as a means of reclaiming stormwater runoff, both as a mechanism to replenish aquifers and to allow for continued natural cleaning processes. Given Vernon’s built-out condition and the severe lack of open space, clean-up and recharge via percolation proves difficult. Vernon General Plan Resources Element Resources Element - 3 As described in the Circulation and Infrastructure Element, three water agencies supply water within Vernon (see Figure CI-3). Most of the geographical are of Vernon is supplied by the City’s Water Department. The California Water Service Company (Cal Water), East Los Angeles District, Commerce System serves some of the northeast portion of Vernon, and a small portion of southeast Vernon is serviced by Maywood Mutual Water Company Number 3. Many of the food processing and other industries common in Vernon are water-intensive uses. Analysis of water resources for the City of Vernon Water Department, including supply sources, is contained in the 2010 Urban Water Management Plan (which is periodically updated). In 2005, water use in Vernon’s service area was approximately 12,000 acre-feet per year (AFY).1 By 2010, water use had decreased to approximately 9,000 AFY. Of that, approximately 84 percent of the water supply was obtained from groundwater sources. Less than eight percent was purchased from the Central Basin Municipal Water District (CBMWD), and slightly more than eight percent came from recycled water supplies. As reported in the City’s 2010 Urban Water Management Plan, water demand in 2025 is projected to increase to approximately 13,800 AFY (which assumed construction of a new power plant). As stated in the plan, Vernon’s infrastructure is designed to meet a high level of demand from the commercial and industrial sectors; associated water demand may shift over time depending on current businesses and industrial practices. By planning for this high level of demand, sufficient flexibility is provided over the long term to maintain the City’s business plan. Water conservation programs are in place, and internal water recycling by specific businesses helps reduce overall demand. Because Vernon is built out, new businesses will simply replace those that exist today, and water consumption over time normally would not be expected to increase significantly. By 2035, water supply is anticipated to increase substantially (by approximately 145 percent) due largely to the increase in supply from recycled water sources. The number of acre-feet produced from the City Water Department’s wells is not 1 An acre-foot of water equals 325,851 gallons, or about the amount of water a family of four consumes in a year. Vernon General Plan Resources Element Resources Element - 4 expected to substantially increase, and the amount purchased from CBMWD is expected to approximately double. By 2035, Vernon’s water supply profile is projected to be 37 percent from groundwater, 10 percent from CBMWD, and 53 percent from recycled sources. The majority of any new demand will be served throught the use of recycled water, indicating the City’s commitment to conservation of its water resources, good water management practices, and sustainability of resources. Parts of northeastern Vernon are within California Water Service Company’s (Cal Water’s) District. Since the area is completely urbanized, annual growth is very slow; since 1980 the amount of water used in the service area has never increased by more than 0.5 percent from year to year. Only 30 of Maywood Mutual Water Company #3’s 2,000 service connections are in the City of Vernon; the rest are in the Cities of Maywood and Bell. In 2006, Vernon’s connections totaled 34.5 acre-feet of water usage. Early in 2007 a new Matheson Tri-Gas plant opened in this area, which had been projected to add 150 annual acre-feet of usage, but has instead shown to only use water commensurate with a 30 acre- feet per year increase in water usage. Maywood Mutual #3 currently derives all of its water supplies from its own groundwater wells. Its three wells are capable of producing approximately 4,500 acre-feet per year, and have historically produced between 1,400 and 1,750 acre-feet per year. Agreements are in place with the Metropolitan Water District that would allow Maywood Mutual #3 to purchase 2,500 acre-feet of water per year if necessary, for a total possible supply of 7,000 acre-feet per year. This would be more than four times the current usage within Maywood Mutual #3’s service area. Maywood Mutual #3 reports that groundwater production is adequate for current and any foreseen future demand. 2.2 Air Quality The quality of the air in Southern California is determined by many regional factors: prevailing winds, persistent inversion conditions, the commute habits of 10 million-plus people within the air basin, and the presence of major ports and industry. Vernon lies within the South Coast Air Basin, a geographic area that extends from the Pacific Ocean to the San Gabriel Mountains, and from the Ventura County boundary Vernon General Plan Resources Element Resources Element - 5 east to the San Bernardino and San Jacinto Mountains. The air basin is a non-attainment area for federal and State air quality standards for ozone, particulate matter less than 10 microns in diameter (PM10), particulate matter less than 2.5 microns in diameter (PM2.5), and lead. The basin is a non-attainment area for State standards with regard to nitrogen dioxide (NO2). The South Coast Air Quality Management District (SCAQMD) regulates air quality improvement programs within the basin and works to improve regional air quality to achieve federal and State standards. At the local level, emissions from stationary sources (industry, power plants, etc.) and from vehicles discharge chemicals and particulate matter into the air, and these emissions are further transformed in the atmosphere by photochemical action into ozone and other health-threatening pollutants. As heavy industry is prevalent in Vernon, most local businesses are heavily regulated by SCAQMD. Emissions from trucks, cars, and trains are regulated by State and federal agencies, meaning the Vernon City Council and City staff have little ability to affect those factors that most significantly contribute to regional air quality conditions. However, the City recognizes its responsibility to participate in regional efforts to continue to improve air quality. City programs in this regard include City purchase and use of alternative fuel vehicles and fuel-efficient vehicles. In 2006, about 3.5 percent of the vehicles owned by the City used alternative fuels. As the City replaces its fleet of vehicles, consideration and priority will be given to the purchase of more vehicles using hybrid or electric engines or other emerging technologies that replace fossil fuels. Because motor vehicles represent a significant source of pollutant emissions, one key approach to reducing emissions is to reduce vehicle miles traveled. In 2006, businesses in Vernon employed 44,225 workers locally. Many employers have large workforces, offering opportunities for carpooling and other ride-sharing arrangements. Also, many Metro bus lines serve the City, and Blue Line light rail has stops that readily serve Vernon businesses (provided one is willing to walk or take bus connections from the train stations). The City is in a position to encourage transit use and ride sharing by serving as an information hub and clearinghouse for local businesses. Reducing the volume of cars on local streets can help reduce regional emissions and allow Vernon to contribute to regional air quality improvements. Vernon General Plan Resources Element Resources Element - 6 2.3 Global Warming In 2006, the California Legislature adopted AB 32, the Global Warming Solutions Act of 2006, to address concerns regarding the potential impact of climate change on the State’s economy and the environment. The legislation requires the California Air Resources Board to determine the level of greenhouse gases produced in 1990 and outline strategies to ensure that the level of emissions in 2020 do not exceed the 1990 level. The overall goal is to establish a comprehensive program of regulatory and market mechanisms to achieve real, quantifiable, cost-effective reductions of greenhouse gas emissions. Specifically, AB 32 (as codified in the California Health and Safety Code) requires the California Air Resources Board to: Establish a statewide greenhouse gas emissions cap for 2020, based on 1990 emissions Adopt mandatory reporting rules for significant sources of greenhouse gases Adopt a plan indicating how emission reductions will be achieved from significant greenhouse gas sources via regulations, market mechanisms, and other actions Adopt regulations to achieve the maximum technologically feasible and cost-effective reductions in greenhouse gas, including provisions for using both market mechanisms and alternative compliance mechanisms SB 375, passed into law in 2008, has the goal of fostering development patterns—and more compact patterns in particular—that reduce the need to drive, thereby reducing air pollution from car exhaust, conserving water, and protecting habitat, among other benefits. This law is designed to align regional land use, housing, and transportation plans with greenhouse gas reduction targets. In Vernon, emissions are regulated by the Southern California Air Quality District, as well as State and federal agencies. The agencies have imposed regulations to reduce emissions from both stationary and vehicular sources. These actions have led to a substantial improvement in air quality in the Southern California air basin and presumably have had a concurrent effect on greenhouse gas emissions. Further reductions are Vernon General Plan Resources Element Resources Element - 7 anticipated as new requirements are imposed by current legislation and regulations. The City of Vernon is a built out city, and the General Plan does not provide for any substantive increase in either square footage in industrial development or substantive increases in employment (see Table LU-1 in the Land Use Element). Future residential development is limited pursuant to the Land Use Element. This limited residential development will provide a new housing opportunity for local workers to live near places of employment in Vernon, furthering SB 375 goals. Given the limited changes anticipated as part of this General Plan, the issue of increased emissions resulting from growth is not a significant concern. 2.4 Energy Supplies Industrial businesses in Vernon require reliable energy supplies for industrial processes and refrigeration. In 1932, the citizens of Vernon supported a bond measure that authorized the City to construct a power plant. This enabled the City to build its own electric power generating plant—to meet the needs of this “exclusively industrial city”. Since then, the City has been able to provide reliable and comparatively low-cost electric power to its customers. In 2005, the City completed construction of the Malburg Generating Station, a new natural-gas-powered power plant that provides electricity to many businesses in Vernon. The City recognizes that energy conservation benefits consumers in the form of lower energy costs. Conservation also reduces the need for construction of costly new energy production facilities. Finally, conservation helps efforts to improve regional air quality by reducing pollutant emissions from older power generation plants in Southern California. Vernon. The City is committed to working with local businesses to help them be energy efficient and help keep rates low. 2.5 Open Space The major open space resources in Vernon consist of the Los Angeles River Channel and utility easements. No riparian habitat exists, as the Los Angeles River channel is concrete lined along this portion of the river. Given the City’s industrial character, Vernon does not contain and does not have a need for public parks. Private open spaces on industrial properties Vernon General Plan Resources Element Resources Element - 8 are limited as well, as most buildings are built to the sidewalk line, leaving limited area for on-site landscaping. Over time, requirements for site-specific runoff control may result in property owners devoting portions of setback or parking areas to green space. Additional green space may also be added through the middle of Vernon if plans progress for the “re-greening” of the Los Angeles River. The Los Angeles River Master Plan, adopted by the Los Angeles County Board of Supervisors in 1996, calls for a greenway along the bank, a trail and murals along the west levee, an interpretive exhibit near the Bandini Avenue crossing, and a passive park area near Atlantic Avenue. As of 2007, no funding source or preliminary plan for creation of additional open space within the City of Vernon currently exists. 2.6 Cultural Resources In 1847, the Mexican militia fought U.S. troops under the command of U.S. Army General Stephen Watts Kearny and U.S. Navy Captain Robert F. Stockton along the San Gabriel River. The battle of La Mesa, in present-day Vernon, occurred on January 9, 1847 and ended with the Mexicans overwhelmed by a strong American advance. On January 10, Mexican leaders surrendered peacefully to the Americans, who promptly occupied the city of Los Angeles. Between 1847 and the early years of the twentieth century, the lands that now comprise Vernon were dedicated largely to agriculture, with John B. Leonis representing one of the key ranchers/landholders in the area. Vernon incorporated in 1905 as an “exclusively industrial” city and was named after a dirt road, Vernon Avenue, crossing its center. In the following years, many diverse industries established major facilities in the City, taking advantage of the rail access and, with the construction in 1932 of a City-owned power plant, low-cost electricity. The industrial buildings that house these diverse industries well serve their industrial functions, but also display architecture representative of distinct periods and styles. The busy building period of the 1920s and ‘30s produced several Streamline Moderne structures, and wonderful brick buildings can be found throughout the City. A notable landmark is the Farmer John mural surrounding the company’s meat processing facility on Vernon Avenue. Vernon General Plan Resources Element Resources Element - 9 Vernon will assist in the effort to preserve the memory of early Los Angeles, and tell the story of its growth and development, through taking and retaining photographs of buildings and structures that may have architectural or historic interest. 3.0 GOALS AND POLICIES GOAL R-1 Conserve and protect the region's water and energy resources. POLICY R-1.1: Encourage water conservation and the use of recycled water in new developments and by all industries. POLICY R-1.2: Support the use of energy-saving designs and equipment in all new development and reconstruction projects. POLICY R-1.3: Seek and pursue the most practicable and cost-effective means of implementing National Pollutant Discharge Elimination Systems requirements. GOAL R-2 Contribute to the continued gradual improvement of air quality in the South Coast Air Basin. POLICY R-2.1: Coordinate and cooperate with the South Coast Air Quality Management District and Southern California Association of Governments in efforts to implement the regional Air Quality Management Plan. POLICY R-2.2: Encourage and facilitate the use of public transportation to reduce emissions associated with automobile use. POLICY R-2.3: Continue to expand the number of City-owned alternative fuels vehicles, hybrid vehicles, and other energy-efficient vehicles as they may be available. POLICY R-2.4: Maximize the amount of clean electrical power produced while minimizing emissions from power production plants. Vernon General Plan Resources Element Resources Element - 10 POLICY R-2.5: Consult with the Gateway Cities Council of Governments, regional planning agencies, and surrounding municipalities to coordinate land use, circulation, and infrastructure improvement efforts. GOAL R-3 Preserve established open spaces, and look for opportunities to create new open space areas that can benefit the health and welfare of workers and residents in Vernon. POLICY R-3.1: Continue to maintain landscaped areas at City facilities as appropriate. POLICY R-3.2: Cooperate with regional efforts to upgrade the appearance and open space value of the Los Angeles River Channel. POLICY R-3.3: Encourage private property owners and industries to establish and maintain private landscaped areas for the benefit of employees. POLICY R-3.4: Continue the City's street tree planting and tree maintenance programs. GOAL R-4 Recognize and preserve Vernon’s contributions to the industrial and architectural history of Los Angeles. POLICY R-4.1: Expand available cultural resource information by establishing a City-maintained database of historic sites and facilities. POLICY R-4.2: Support the efforts of interested agencies or private organizations to undertake surveys or other research efforts to document buildings and places in Vernon of historic and/or architectural significance. POLICY R-4.3: Ensure compliance with CEQA provisions regarding cultural resources at the time buildings or places of identified or potential historic or architectural merit are proposed for demolition. Vernon General Plan Resources Element Resources Element - 11 POLICY R-4.4: Establish local programs and practices that recognize places of local or other historic significance. Vernon General Plan Resources Element Resources Element - 12 This page intentionally left blank. VERNON GENERAL PLAN NOISE ELEMENT Vernon General Plan Noise Element Noise Element - 1 NOISE ELEMENT 1.0 PURPOSE AND FOCUS 1.1 Purpose The purpose of the Noise Element is to identify significant sources of noise in Vernon and to identify ways to protect people living and working in Vernon from extensive exposure to excessive or unhealthy noise levels. Per the California Administrative Code, all general plans must include a Noise Element. The Noise Element sets the framework for working toward and maintaining environmental noise control appropriate to individual communities. The Element establishes goals, policies, and programs that identify possible approaches to protecting the business community and the few people living in Vernon from excessive noise. 1.2 Focus In recognition of the adverse health effects associated with excessive noise, the California Government Code, Section 65302(f), identifies the types of community noise to be addressed in the General Plan. The Noise Element is to identify noise sources from: Freeways and street systems; Freight on-line railroad operations; Vernon General Plan Noise Element Noise Element - 2 Local industrial plants, including, but not limited to, railroad classification yards; and Other stationary ground noise sources identified by local agencies as contributing to the community noise environment. Vernon is unique in that its status as an all-industrial community establishes different sensitivities regarding noise than those present in typical suburban or even mixed-use urban areas. Local businesses are not significantly impacted by higher noise levels that would not be appropriate in a residential neighborhood or near schools, parks, or hospitals. 2.0 ABOUT NOISE Noise is often defined as unwanted, excessive, or irksome sound. Sound – and noise – consists of waves of energy that we receive and interpret. To describe the character of a particular noise, acousticians must have information about: The amplitude and amplitude variation of the acoustical wave, The frequency (pitch) content of the noise, and The duration of the noise. 2.1 Noise Metrics Definitions of the most commonly used terms encountered in community noise assessments and noise control are provided in the General Plan Glossary. Of these terms, the A-weighted sound pressure level, or dB(A), is the scale of measurement that is most useful in community noise measurement. This sound level is measured in decibels to provide a scale with the range and characteristics most consistent with that of peoples' sensitivity to sounds, as described below. Since decibels are logarithmic units, sound pressure levels cannot be added or subtracted by ordinary arithmetic means. For example, if one automobile produces a sound pressure level of 70 dB when it passes an observer, two cars passing simultaneously would not produce 140 dB. In fact, they would combine to produce 73 dB. This same principle can be applied to other traffic quantities as well. In other words, doubling the traffic volume on a street or the speed of the traffic will increase the traffic noise level by 3 dB. Conversely, halving the Vernon General Plan Noise Element Noise Element - 3 traffic volume or speed will reduce the traffic noise level by 3 dB. Sound pressure level alone is not a reliable indicator of loudness. The frequency or pitch of a sound also has a substantial effect on how humans will respond. While the intensity of the sound is a purely physical quantity, the loudness or human response depends on the characteristics of the human ear. Human hearing is limited not only to the range of audible frequencies, but also in the way it perceives the sound pressure level in that range. In general, the healthy human ear is most sensitive to sounds between 1,000 hertz (Hz) and 5,000 Hz, and perceives both higher and lower frequency sounds of the same magnitude with less intensity. To approximate the frequency response of the human ear, a series of sound pressure level adjustments is usually applied to the sound measured by a sound level meter. The adjustments, or weighting network, are frequency dependent. The A-scale approximates the frequency response of the average young ear when listening to most ordinary everyday sounds. When people make relative judgments of the loudness or annoyance of a sound, their judgments correlate well with the A-scale sound levels of those sounds. A range of noise levels associated with common indoor and outdoor activities is shown in Figure N-1. Vernon General Plan Noise Element Noise Element - 4 Figure N-1: Examples of Noise Levels The A-weighted sound level of traffic and other long-term noise-producing activities within and around a community varies considerably with time. Measurements of this varying noise level are accomplished by recording values of the A- weighted level during representative periods within a specified portion of the day. It is recognized that a given level of noise may be more or less tolerable depending on the duration of exposure experienced by an individual. There are numerous measures of noise Vernon General Plan Noise Element Noise Element - 5 Figure N-2: Examples of Noise at Southern California Locations exposure that consider not only the A- level variation of noise but also the duration of the disturbance. The State Department of Aeronautics and the California Commission on Housing and Community Development have adopted the community noise equivalent level (CNEL). This measure weights the average noise levels for the evening hours (7:00 P.M. to 10:00 P.M.), increasing them by 5 dB, and weights the late evening and morning hour noise levels (10:00 P.M. to 7:00 A.M.) by 10 dB. The daytime noise levels are combined with these weighted levels and are averaged to obtain a CNEL value. Figure N-2 indicates the outdoor CNEL at typical locations throughout the Southern California area. 2.2 Noise and Health Effects Sound levels which exceed 85 dB(A), when experienced for long durations during each working day, may result in severe temporary or even permanent hearing loss. State and federal safety and health regulations currently protect workers at levels of exposure that exceed 90 dB(A) for each eight-hour workday. Speech intelligibility is impaired when sound levels exceed 60 dB(A). The level of interference increases with sound level and the distance between speaker and listener. Sound levels that exceed 40 to 45 dB(A) are generally considered to be excessive for sleeping areas within a residence. 2.3 Community Noise Standards Vernon has established community noise standards to help guide land use decisions and protect sensitive uses from excessive noise levels, as shown in Figure N-3. Because the City consists almost exclusively of industrial uses and policy set forth in the Housing Element limits the construction of any new housing to only a few specifically identified sites in recognition of the hazards – including high noise levels – associated with widespread industrial activity, these Vernon General Plan Noise Element Noise Element - 6 standards discourage any new noise-sensitive use that would be incompatible with the City’s industrial focus. Similarly, zoning regulations prohibit community facilities such as schools, day care centers, and hospitals. Figure N-3: Community Noise Standards Vernon General Plan Noise Element Noise Element - 7 3.0 NOISE ENVIRONMENT IN 2007 In 2007, the City conducted a comprehensive noise survey of the community to document the noise environment. Measurements were taken at eleven locations, including two border locations in adjacent communities. Three measurements consisted of 24-hour recordings of the sound environment, and the balance were limited duration measurements at representative locations throughout Vernon and, as noted above, on the border of neighboring communities. In conjunction with an update to the Land Use and Housing Elements in 2013, focused noise measurements were taken near locations considered for permanent and emergency housing. The most significant noise-producing activity within Vernon involves the transportation systems: the arterial roadways and train movements along regional rail lines. In addition, many major manufacturing businesses create high noise levels. The only noise-sensitive land uses within the City are scattered residential units and the Vernon City Elementary School. Residences largely are clustered in four areas: on Vernon Avenue at Furlong Place, on Vernon Avenue between Downey Road and Alcoa Avenue, on Fruitland Avenue west of Downey Road, and on 52nd Place east of Atlantic Boulevard. The Emergency Shelter Overlay, which applies to a parcel in the northwest corner of the City, could accommodate emergency housing. Vernon City Elementary School is located at the southwest corner of Vernon Avenue and Santa Fe Avenue. The adjacent communities of Huntington Park and Maywood have residential neighborhoods and schools along and near their boundaries with Vernon. Vernon has long practiced good neighbor policies with respect to these uses, cooperating with adjacent cities to minimize noise impacts on sensitive uses. Vernon General Plan Noise Element Noise Element - 8 3.1 2007 CNEL Contours The noise measurements were modeled to create a community-wide “picture” of noise conditions. The CNEL contours for major arterial roadways and the I-710 freeway within the City were developed utilizing the Federal Highway Administration’s Traffic Noise Model and traffic data obtained from Caltrans and citywide traffic count data (2004-2007). The railroad contours were developed based on Wyle Laboratories’ computational procedures and on a computer model developed by the Federal Transit Administration. Operational data for the railroads was obtained from Amtrak and Metrolink schedules, the Southern California Regional Rail Authority, the Alameda Corridor Transit Authority, the Union Pacific Company, and the Federal Railroad Administration Office of Safety Analysis. These noise measurements and modeling results collectively can be represented by noise contour lines. Similar to the way topographic maps show contours indicated elevation change, the noise contour maps indicate decreasing noise levels as you move away from the noise source. Figure N-4 illustrates the noise contours for year 2007. 3.2 Transportation Noise Sources Noise along Arterial Roadways Figure N-4 shows that noise levels associated with truck and automobile traffic along Vernon’s arterial roadways are 70 CNEL along the roadway frontages. With regard to the gradual diminishment of noise as the receiver moves away from the street, the modeling does not take into account the mitigating effect of buildings that front the street. 7570606580656580606565707070756065757070658070706565656560707070 6065 7060707060756070707560606070706070608065657060706065706065657065606570706065606070606565656570706570657 0 756565656065656570656 0 658070606060656560657060656565756065707060607080 CNEL65 CNELNG (2007) NOISE CONTOURS This page intentionally left blank. Vernon General Plan Noise Element Noise Element - 11 Freeway Noise The CNEL generated in Vernon by traffic on the I-710 freeway is as high as 80 dB. However, the land uses affected by the traffic noise are largely industrial in nature and are not noise sensitive. Train Noise The City is impacted by noise from train movements on six primary rail lines, numerous spur lines, and activities at the Burlington, Northern & Santa Fe (BNSF) rail yard, as well as at the Union Pacific (UPRR) rail yard in the City of Commerce. The CNEL associated with train movements in and through Vernon is as high as 80 dB. However, the land uses affected by the traffic noise are largely industrial in nature and are not noise sensitive. The primary source of annoyance to residents in the vicinity of the UPRR line adjacent to Downey Road is train horn soundings at crossings. 3.3 Industrial Noise Sources In general, industrial noise within the City is not considered excessive because Vernon is a predominantly industrial city with few noise-sensitive properties. However, at the few scattered residences within the City, as well as at the Vernon City Elementary School, noise levels can exceed generally acceptable standards for these noise-sensitive uses. The impact is primarily related to noise generated by loading dock operations, trucks entering and leaving the area, and mechanical equipment located both inside and outside building. Adjacent to the City of Vernon are residential neighborhoods in the cities of Huntington Park and Maywood. Noise measurements taken in 2006 indicated that while average noise levels ranged up to 66.7 dB(A) and noise spikes registered 87.6 dB(A) during daytime hours, the measured CNELs of 61.5 dB in Huntington Park and 64 dB in Maywood were less than the exterior CNEL standard of 70 dB for residential properties in Vernon. Vernon General Plan Noise Element Noise Element - 12 4.0 FUTURE NOISE ENVIRONMENT Figure N-5 indicates projected noise contours for year 2030, assuming growth in regional traffic volumes through Vernon and anticipated activity along rail lines, the Alameda Corridor, and the regional rail lines. Land use policy provides for continued industrial use throughout the community, with provision for commercial uses within the Commercial Overlay to meet the needs of the daytime employee population and allow for a broader mix of uses on aging industrial sites. As indicated above, land use policy limits the introduction of any new noise-sensitive uses to specifically identified sites along the edges of the City. Thus, the City does not anticipate any new noise conflicts will arise in Vernon over the life of this General Plan. With regard to existing conditions where established residences and Vernon City Elementary School sometimes experience high noise levels, the City works with surrounding businesses to achieve noise standards established in the Zoning Ordinance. 5.0 GOALS AND POLICIES As an industrial city, the aim of the Noise Element is to address compatibility among neighboring businesses and industries, and to work with adjacent communities to resolve any conflicts that may be associated with individual businesses along Vernon’s municipal boundary. GOAL N-1 Reduce impacts from transportation noise sources to the extent they may affect industrial businesses. POLICY N-1.1: Encourage the effective enforcement of local, state, and federal noise levels by all appropriate City divisions. POLICY N-1.2: Review noise impacts when rail corridors are consolidated, and review ways to reduce impacts on adjacent businesses. POLICY N-1.3: Minimize adverse noise effects on new residential developments through carefully planned site design and construction approaches that limit noise intrusion, wherever practical. et006.80 CNEL75 CNEL70 CNEL65 CNEL60 CNELUTURE (2030) NOISE CONTOURS This page intentionally left blank. Vernon General Plan Noise Element Noise Element - 15 GOAL N-2 Incorporate noise and vibration considerations into land use planning decisions. POLICY N-2.1: Consider the noise levels likely to be produced by any new businesses or substantially expanded business activities locating near existing noise-sensitive uses such as schools, community facilities, and residences, as well as adjacent to established businesses involving vibration-sensitive activities. POLICY N-2.2: Encourage acoustical design in all new construction. POLICY N-2.3: Prohibit the establishment of new noise-sensitive land uses in Vernon, including but not limited to schools, day-care facilities, and community facilities. Permit new residential uses only within the Housing Overlay District, and require new developments to incorporate appropriate noise attenuation to achieve City noise standards. GOAL N-3 Develop measures to control non-transportation noise and similar impacts. POLICY N-3.1: Continue to enforce the noise and vibration performance standards in the City Code to mitigate conflicts among neighboring uses. POLICY N-3.2: Establish and maintain coordination among City agencies involved in noise abatement. POLICY N-3.3: City departments will comply with all state and federal OSHA noise standards, and all new City equipment purchases shall comply with state and federal noise standards. Vernon General Plan Noise Element Noise Element - 16 This page intentionally left blank. VERNON GENERAL PLAN APPENDIX A: IMPLEMENTATION PLAN Vernon General Plan Implementation Plan Implementation Plan A- 1 Appendix A: Implementation Plan This Implementation Plan guides City elected officials and staff in the overall effort to carry out adopted General Plan goals and policies. The purpose of the implementation programs is to enable the overall direction set forth in the General Plan to be translated from general terms to specific actions. Each implementation program is a procedure, program, or technique that requires City action, either alone or in collaboration with non-governmental or quasi-governmental organizations or state and federal agencies. Some of the implementation programs are processes or procedures the City currently administers on a day-to-day basis (such as development project review), while others identify new programs or projects. Completion of the identified programs will be subject to funding constraints. The implementation programs are organized into the following six subsections corresponding to the General Plan elements: Land Use Element Circulation and Infrastructure Element Housing Element Safety Element Natural Resources Element Noise Element Each implementation program relates directly to one or more General Plan policies, drawn from the various General Plan elements. For each program, the related General Plan policies are listed, along with the responsible City departments or other governmental agencies, the recommended time frame, and likely funding source or sources. The implementation programs are intended for use as the basis for preparing the Annual Report to the City Council on the status of the City’s progress in implementing the General Plan, as described in Section 65400 of the Government Code. Because many of the individual actions and programs act as mitigation for environmental impacts resulting from planned Vernon General Plan Implementation Plan Implementation Plan A- 2 development pursuant to the General Plan, the annual report can also provide a means of monitoring application of the mitigation measures as required by Public Resources Code Section 21081.6. The programs should be updated annually concurrent with the budget process and whenever the City’s General Plan is amended or updated to ensure continued consistency and usefulness. Vernon General Plan Implementation Plan Implementation Plan A- 3 LAND USE ELEMENT This section includes actions that will assist City officials, staff, and the public to implement the goals and policies of the Land Use Element. Action LU-1: Annual Review of General Plan. Annually review implementation of the General Plan to identify the effect of land development and use on City revenues and costs of providing public facilities and services. Agency/Department: Community Services and Water Department Funding Source: General Fund Time Frame: Annually Related Policies: All Action LU-2: CEQA Compliance and Site Development Review. Comply with the California Environmental Quality Act (CEQA) in the review of proposed development projects. Use the review process to require projects to address environmental concerns, fund needed public facilities, recognize groundwater resources and water quality, minimize traffic impacts, be compatible with surrounding development, and comply with all use and development standards of the City. Agency/Department: Community Services and Water Department Funding Source: Development Fees Time Frame: Ongoing Related Policies: All Action LU-3: Capital Improvement Program. Continue to implement and update the Capital Improvement Program (CIP) to address phasing and construction of roadway and infrastructure improvements throughout the City. Use the five-year CIP process to prioritize, finance, and complete projects identified in the CIP. Update the CIP every two years to respond to changes in local priorities and available funding sources. Agency/Department: All departments associated with the CIP Funding Source: Identified funding sources in the CIP Time Frame: Annually Related Policies: LU-2.6, CI-1.1, CI-1.5, CI-1.10, CI-1.11, R-2.3 Vernon General Plan Implementation Plan Implementation Plan A- 4 Action LU-4: Operating Budget. Continue to adopt and update the City’s Operating Budget to maintain desired levels of City services and infrastructure. Agency/Department: Finance Department Funding Source: General Fund Time Frame: Annually Related Policies: LU-3.2, LU-3.3, LU-3.4, CI-2.4, CI-6.3, S-3.8, R-2.1 Action LU-5: Promote Manufacturing. Through zoning regulations and economic development strategies and programs, promote manufacturing uses in the City. Agency/Department: Community Services and Water Department Funding Source: General Fund Time Frame: Ongoing Related Policies: LU-1.1, LU-1.2, LU-1.4 Action LU-6: Lot Consolidation. Coordinate with property owners in consolidating and merging properties for redevelopment of older and underutilized properties. Agency/Department: Community Services and Water Department Funding Source: General Fund Time Frame: Ongoing Related Policies: LU-2.2, LU-2.4, LU-2.7 Action LU-7: Code Enforcement. Continue to enforce property maintenance standards, noise regulations, and other property related regulatory standards in the Zoning Code, City Code, and other City ordinances, in efforts to keep properties throughout the City well maintained, and to prevent blight by neglect. Agency/Department: Community Services and Water Department Funding Source: General Funds Time Frame: Ongoing Related Policies: LU-2.3, LU-3.1, H-1.1, S-3.4 Action LU-8: Zoning Ordinance. Review and amend the Zoning Ordinance to ensure that the purpose and intent of zoning classifications, overlays, and standards clearly implement the description of relevant General Plan land use designations. Agency/Department: Community Services and Water Department Funding Source: General Fund Time Frame: Ongoing Related Policies: LU-1.1, LU-1.2, LU-1.3, LU-1.4, LU-1.5 Vernon General Plan Implementation Plan Implementation Plan A- 5 CIRCULATION AND INFRASTRUCTURE ELEMENT This section includes actions that will assist City officials, staff, and the public to implement the goals and policies of the Circulation and Infrastructure Element. Action CI-1: Automated Traffic Surveillance and Control System (ATSAC). Conduct a study to determine if ATSAC would be a beneficial and cost-effective system for the City to operate and maintain. Agency/Department: Community Services Department, Public Works Division Funding Source: General Fund, State Gas Tax; grants Time Frame: Complete by 2008 Related Policies: CI-1.11 Action CI-2: Traffic Control, Safety, and Maintenance. Complete intersection capacity improvements, provide for the widening of Soto Street, and improve striping and signage as set forth in the Circulation and Infrastructure Element and General Plan Program EIR. Agency/Department: Community Services Department, Public Works Division Funding Source: State Gas Tax; grants; General Fund Time Frame: Ongoing Related Policies: CI-1.5, CI-1.6, CI-1.7, CI-1.12 Action CI-3: Soto Street Widening. At the time properties along Soto Street are redeveloped or as otherwise dictated by City plans for the widening of Soto Street, require the dedication of right-of-way to achieve the road standard for Soto Street established in the Circulation and Infrastructure Element. Complete the road widening project at the time adequate right-of-way has been acquired and/or dedicated. Agency/Department: Community Services Department, Planning and Public Works Divisions Funding Source: State Gas Tax; grants; General Fund Time Frame: Ongoing for dedication; complete widening by 2015 Related Policies: CI-1.5, CI-1.6, CI-1.7, CI-1.12 Action CI-4: Coordinate with Adjacent Jurisdictions. Continue to coordinate intersection maintenance and improvements with adjacent jurisdictions so that intersections along Soto Street, Pacific Boulevard, Slauson Avenue, Alameda Street, Atlantic Boulevard, Bandini Boulevard, and Downey Road operate at an acceptable Level of Service. Vernon General Plan Implementation Plan Implementation Plan A- 6 Agency/Department: Community Services Department, Public Works Division Funding Source: General Fund Time Frame: Ongoing Related Policies: CI-1.8, CI-1.10 Action CI-5: Coordinate with Rail Companies. Coordinate with railroad companies in removing obsolete rail spurs. Work to minimize traffic impacts to City streets from trucks using Hobart Yard facilities and other multi-modal transportation yards. Agency/Department: Community Services Department, Planning and Public Works Divisions Funding Source: General Fund Time Frame: Ongoing Related Policies: CI-1.2, CI-1.3, CI-1.11 Action CI-6: Interstate 710 Freeway Improvements. Work with Caltrans on all plans, activities, and projects regarding Interstate 710 that may directly impact Vernon’s roadway facilities and traffic patterns. Coordinate with the Gateway Cities Council of Governments and Southern California Association of Governments with studies and programs regarding the improvements to the I- 710 freeway. Agency/Department: Community Services Department, Planning and Public Works Divisions Funding Source: General Funds; Redevelopment Fund Time Frame: Ongoing Related Policies: CI-1.10 Action CI-7: Minimize Parking Impacts. Work with businesses to develop creative strategies and solutions to address parking shortages. Require new development projects to meet the minimum parking standards in the Zoning Ordinance for both trucks and automobiles, including truck trailer storage, employee parking, and visitor parking. Agency/Department: Community Services Department, Planning Division Funding Source: Development Fees Time Frame: Ongoing Related Policies: CI-2.1, CI-2.2, CI-2.3, CI-2.4 Vernon General Plan Implementation Plan Implementation Plan A- 7 Action CI-8: Metropolitan Transportation Authority. Work with the Metropolitan Transportation Authority (Metro) to achieve the following: Implement the Metro’s Congestion Management Plan (CMP) within the City. Continue to provide local and regional connections through Metro local and rapid bus lines. Improve access to local Metro stations. Agency/Department: Community Services Department, Public Works Division Funding Source: General Fund Time Frame: Ongoing Related Policies: CI-1.8, CI-1.9, CI-1.12 Action CI-9: Water Services and Supplies. As needed, require studies to determine water infrastructure requirements for future development projects, and determine which recommendations should be incorporated into the design of projects. As permitted by law, require the dedication of necessary rights-of-way and construction of water infrastructure improvements for all new development projects. Agency/Department: Community Services Department, Water Department Funding Source: Water Rates Time Frame: Ongoing Related Policies: CI-3.1, CI-3.2, CI-3.3, CI-3.4 Action CI-10: Urban Water Management Plan. Continue to implement and update Vernon’s Urban Water Management Plan in an effort to provide long-term planning and visioning for managing its water resources and providing a reliable supply of water. Agency/Department: Community Services Department, Water Department Funding Source: Water Rates Time Frame: Ongoing Related Policies: CI-3.1, CI-3.3, S-1.4 Action CI-11: Water Quality. Continue to maintain the quality of Vernon's drinking water by inspecting water well installations and monitoring general water quality. Continue to take routine water samples at various locations in the City and submit them to a water quality laboratory for analysis. Promote working with water agencies that supply water to Vernon to ensure adequate water quality. Vernon General Plan Implementation Plan Implementation Plan A- 8 Agency/Department: Community Services Department, Water Department Funding Source: Water Rates Time Frame: Ongoing Related Policies: CI-3.3 Action CI-12: Cross Connection Control Program. Continue to implement the Cross Connection Control Program, which provides additional protection for the drinking water system. The function of the program is to prevent the water supply from being contaminated by the backflow of industrial fluids through the inspection of water piping systems, and the permitting and installation of specific plumbing devices at locations where there is a potential for backflow resulting in contamination. Backflow prevention devices are required to be tested annually by certified testers. Agency/Department: Community Services Department, Water Department and Environmental Health Department Funding Source: Water Rates and Health Permit Fees Time Frame: Ongoing Related Policies: CI-3.1 Action CI-13: Energy. Continue to provide high quality electric and gas services to Vernon businesses at competitive rates. Agency/Department: Light and Power Department; Gas Department Funding Source: Electric and Gas Rates Time Frame: Ongoing Related Policies: CI-6.1, CI-6.2, CI-6.3, CI-6.4, CI-6.5, R-1.2 Action CI-14: National Pollutant Discharge and Elimination System (NPDES) Compliance. Prior to making land use decisions, the City will utilize available methods to estimate increases in pollutant loads and flows resulting from projected future development. In addition, applicants for new development and redevelopment projects shall be required to demonstrate accomplishment of the following NPDES objectives: Use of Best Management Practices (BMPs) to mitigate projected increases in pollutant loads and flows. Minimized pollutant loading during and after construction. Limited disturbance of natural water bodies and natural drainage systems. Pollution prevention methods, source controls and treatment using small collection strategies located at, or as close as possible to, the source. Vernon General Plan Implementation Plan Implementation Plan A- 9 Agency/Department: Environmental Health Department; Community Services and Water Department Funding Source: Development Fees Time Frame: Ongoing Related Policies: CI-5.4, R-1.3 Action CI-15: Wastewater Treatment Services and Sewer Maintenance and Upgrades. As needed, require studies to determine sewer infrastructure requirements for future development projects, and determine which recommendations should be incorporated into the design of projects. As permitted by law, require the dedication of necessary right-of-way and construction of sewer infrastructure improvements for all new development projects. Continue to provide funding to repair, maintain, and upgrade the City’s wastewater collection system. Agency/Department: Community Services and Water Department, Public Works Division Funding Source: Development Fees, General Fund Time Frame: Ongoing Related Policies: CI-4.1, CI-4.2, CI-4.3 Action CI-16: Storm Drain Maintenance and Quality. As needed, prepare studies to determine the adequacy of the storm drain infrastructure for development proposals and/or to prevent localized flooding. Require developers to incorporate necessary improvements into the design of the project. Continue to monitor storm drains and water quality in an ongoing effort to prevent pollution of the storm drain system which leads directly to the Los Angeles River. Continue to monitor storm water control activities through hazardous materials inspections and continue to provide educational materials for businesses regarding storm water pollution. Agency/Department: Community Services and Water Department, Public Works Division; Environmental Health Department Funding Source: Health Permit Fees; development fees; General Fund Time Frame: Ongoing Related Policies: CI-5.1, CI-5.2, CI-5.3, CI-5.4 Action CI-17: Community Information. Continue to use communications services, such as the City’s website, to inform interested parties of information regarding announcements and upcoming events, as well as information about City departments, business permitting requirements, etc. Agency/Department: Information Technology Department Funding Source: General Fund Time Frame: Ongoing Related Policies: CI-7.1 Vernon General Plan Implementation Plan Implementation Plan A- 10 Action CI-18: High Technology Services. Continue to offer fiber-optic cabling and other state- of-the-art communication services to Vernon businesses. Encourage data centers to locate in Vernon. Consider ways to provide wireless communications services to all areas of the City. Agency/Department: Information Technology Department Funding Source: General Fund and Fiber Optic Rates Time Frame: Ongoing Related Policies: CI-7.1 Action CI-19: New Sidewalks and Ramps. Provide funding for new sidewalks and ramps throughout the City. Place priority on replacing sidewalks that have been identified as deficient and a hazard to the public safety. Agency/Department: Community Services and Water Department, Public Works Division Funding Source: City Parcel Tax; General Fund Time Frame: Ongoing Related Policies: CI-1.1 Vernon General Plan Implementation Plan Implementation Plan A- 11 HOUSING ELEMENT Housing Element Implementation Programs are included in the Housing Element chapter. Vernon General Plan Implementation Plan Implementation Plan A- 12 SAFETY ELEMENT This section includes actions that will assist City officials, staff, and the public to implement the goals and policies of the Safety Element. Action S-1: Los Angeles County Flood Control District. Encourage the Los Angeles County Flood Control District to regularly maintain flood control channels and structures within its jurisdiction to protect properties from flood hazard, and to complete necessary repairs in a timely manner. Agency/Department: Community Services and Water Department, Public Works Division Funding Source: Los Angeles County Time Frame: Ongoing Related Policies: S-4.3 Action S-2: Geologic Hazard Assessments. Pursuant to state law, geologic and/or geotechnical studies are required for proposed new development projects located in areas identified as susceptible to liquefaction. Compliance with the recommendations set forth in site specific geologic and/or geotechnical studies will be made a condition of the site development permit for all new development projects. Agency/Department: Community Services and Water Department, Building Division Funding Source: Development Fees Time Frame: Ongoing Related Policies: S-1.1 Action S-3: Standardized Emergency Management System (SEMS) Multi-Hazard Functional Plan. Continue to implement the City’s SEMS Multi-Hazard Functional Plan according to requirements and provisions of the State’s Standardized Emergency Management system. Establish community evacuation routes and when necessary, provide emergency/disaster shelter facilities. Agency/Department: Police and Fire Departments Funding Source: General Fund Time Frame: Ongoing Related Policies: S-1.1, S-1.5, S-3.1, S-3.7, S-4.1, S-4.3, S-4.4 Vernon General Plan Implementation Plan Implementation Plan A- 13 Action S-4: Water Department’s Emergency Response and Recovery Plan. Implement the Emergency Response and Recovery Plan in the event of natural disasters, technological incidents, and national securities emergencies to safeguard the City’s water supply and service area. Agency/Department: Community Services and Water Department Funding Source: Water Rates Time Frame: Ongoing Related Policies: S-1.4 Action S-5: Adequate Public Safety and Emergency Response. Evaluate the need for additional fire and police facilities and resources. Require adequate street widths and clearance for emergency access. Agency/Department: Vernon Police and Fire Departments; Community Services and Water Department Funding Source: General Funds; state and federal grants Time Frame: Ongoing Related Policies: S-1.2, S-1.3, S-1.5, S-3.3 Action S-6: City of Vernon Fire Department. Provide emergency response services to Vernon businesses covering fire protection, medical emergencies, urban search and rescue, and hazardous materials control. If the City budget permits, continue to maintain the Class I rating for the Fire Department by the Insurance Services Office and provide Vernon’s fire personnel with the most advanced fire and rescue training and with state-of the-art equipment and apparatus. Agency/Department: Fire Department Funding Source: General Fund; State and federal grants Time Frame: Ongoing Related Policies: S-3.3, S-3.4, S-3.5, S-3.6, S-3.8, S-4.2 Action S-7: Hazardous Materials Monitoring Program (Ordinance 961). Continue to implement the Hazardous Materials Monitoring Program that monitors establishments where hazardous materials are produced, stored, handled, disposed of, treated, emitted, discharged, or recycled. The Program also directs and coordinates emergency response in the event of releases of hazardous materials. Agency/Department: Environmental Health and Fire Department Funding Source: General Fund Time Frame: Ongoing Related Policies: S-2.1, S-2.2, S-3.2 Vernon General Plan Implementation Plan Implementation Plan A- 14 Action S-8: Hazardous Waste. Continue to implement activities so that hazardous wastes generated by Vernon businesses are handled and disposed according to federal, state, and local regulations. Assist businesses and consultants in the preparation and oversight of site assessments and mitigation activities. To minimize present and future threats to human health and the environment, the program actively promotes waste reduction options for hazardous waste generators. Agency/Department: Environmental Health Department Funding Source: Permit Fees Time Frame: Ongoing Related Policies: S-2.1, S-2.2, S-3.2 Action S-9: Underground Storage of Hazardous Substances (Ordinance 944). Continue to implement the Underground Storage of Hazardous Substances program to regulate the permitting, inspection, installation, and removal of underground tanks. Operating permits are issued following the proper installation and testing of tank systems with appropriate leak detection equipment. Agency/Department: Environmental Health Department Funding Source: Permit Fees Time Frame: Ongoing Related Policies: S-2.1, S-2.2, S-3.2 Vernon General Plan Implementation Plan Implementation Plan A- 15 RESOURCES ELEMENT This section includes actions that will assist City officials, staff, and the public to implement the goals and policies of the Resources Element. Action R-1: Support Water Conservation. Conduct public education to raise business and property owner awareness about the need for water conservation. Use the City’s website to promote and encourage the use of water conservation activities and water-conserving fixtures for industrial businesses. Agency/Department: Community Services and Water Department; Public Works Department Funding Source: General Fund Time Frame: Ongoing Related Policies: CI-3.4, R-1.1 Action R-2: Promote Energy Conservation. Continue to promote energy conservation by the public and private sector. Continue to implement Title 24 standards in building codes and work with energy providers to encourage energy conservation activities and promote energy conservation programs. Use the City website and City events to educate the public about the availability of energy conservation programs. Agency/Department: Community Services and Water Department, Building Division; Light and Power Department; Gas Department Funding Source: General Fund Time Frame: Ongoing Related Policies: R-1.2 Action R-3: Enforce Title 24 Building Codes. Update building code as needed to adhere to the most recent California’s State Title 24 Building Codes, including the Energy and the California Green Building Standards Code, to ensure more energy- efficient development. Agency/Department: Community Services and Water Department, Building Division Funding Source: General Fund Time Frame: Ongoing Related Policies: R-1.2 Vernon General Plan Implementation Plan Implementation Plan A- 16 Action R-4: Coordinate with Other Agencies. Continue to participate and coordinate with the South Coast Air Quality Management District (SCAQMD) and neighboring jurisdictions to identify and encourage projects that improve mobility and reduce congestion on major roadways. Implement and interpret the General Plan in a manner consistent with SCAQMD’s Air Quality Management Plan. Agency/Department: Community Services and Water Department Funding Source: General Fund Time Frame: Ongoing Related Policies: R-2.1. R-2.2. R-2.3, R-2.4 Vernon General Plan Implementation Plan Implementation Plan A- 17 NOISE ELEMENT This section includes actions that will assist City officials, staff, and the public to implement the goals and policies of the Noise Element. Action N-1: Noise Regulations. Continue to enforce City noise regulations contained in the Zoning Ordinance to protect residents and school children from excessive noise levels associated with stationary noise sources. Periodically evaluate regulations for adequacy and revise, as needed, to address community needs and changes in legislation and technology. Agency/Department: Community Services and Water Department; Environmental Health Department Funding Source: General Fund Time Frame: Ongoing Related Policies: N-1.1, N-1.2, N-1.3, N-2.1, N-2.2, N-3.1, N-3.2, N-3.3 Action N-2: Siting of New Businesses near Noise-sensitive Land Uses. Review development proposals at properties to determine whether the proposed use has the potential to exceed City one-hour noise standards. As appropriate, require acoustical analyses for all proposed activities that have the potential to exceed the standards, and require mitigation measures if noise analyses show an increase in noise levels beyond the City standards. Agency/Department: Community Services and Water Department; Environmental Health Department Funding Source: General Fund Time Frame: Ongoing Related Policies: N-1.1, N-1.2, N-1.3, N-2.1, N-2.2, N-3.1, N-3.2, N-3.3 Action N-3: Noise Insulation Standards. Implement provisions of the California Noise Insulation Standards (Title 24) that specify that indoor noise levels for multi-family residential living spaces shall not exceed 45 dB CNEL. Agency/Department: Community Services and Water Department Funding Source: Development Fees Time Frame: Ongoing Related Policies: N-1.1, N-1.2, N-1.3, N-2.1, N-2.2, N-3.1, N-3.2 Vernon General Plan Implementation Plan Implementation Plan A- 18 This page intentionally left blank. VERNON GENERAL PLAN APPENDIX B: GLOSSARY Vernon General Plan Glossary Glossary - 1 GLOSSARY This Glossary draws from the California General Plan Glossary (from the State of California General Plan Guidelines) as the basis for definitions of abbreviations and terms used in the Vernon General Plan. Additional definitions have been added that are specific to Vernon. Access: A way of approaching or entering a property, including ingress (the right to enter) and egress (the right to leave). Affordable Housing: Under state and federal statutes, housing that costs no more than 30 percent of gross household income. Housing costs include rent or mortgage payments, utilities, taxes, insurance, homeowner association fees, and other related costs. Air Basin: A geographical area in California defined as a distinct air basin for the purpose of managing the air resources of the state on a regional basis. An air basin generally has similar meteorological and geographic conditions throughout. Air Quality Standards: The prescribed (by the Environmental Protection Agency and the California Air Resources Board) level of pollutants in the outside air that cannot be exceeded legally during a specified time in a specified geographical area. Ancillary Use: An activity or use on a property that is directly related to a main use on the same property, and is subordinate and directly related to, and dependent upon, a principal use, building or structure. Aquifer: An underground, water-bearing layer of earth, porous rock, sand, or gravel through which water can seep or held in natural storage. Aquifers generally hold water to be used as a water supply. Arterial: A major street carrying the traffic of local and collector streets to and from freeways and other major streets, with controlled intersections and generally providing direct access to nonresidential properties. At-grade intersection: A junction at which two or more transport axes cross at the same level. A-Weighted Decibel (dBA): A numerical method of rating human judgment of loudness. The A-weighted scale reduces the effects of low and high frequencies in order to simulate human hearing. Biodiesel: A diesel-equivalent processed fuel derived from biological sources (such as vegetable oils) which can be used in unmodified diesel-engine vehicles. Vernon General Plan Glossary Glossary - 2 California Environmental Quality Act (CEQA): A state law enacted in 1971 that requires governmental agencies at all levels to consider the impact proposed projects may have on the environment. Caltrans: California Department of Transportation Census: The official decennial enumeration of the population conducted by the federal government. City: City, with a capital "C," generally refers to the government or administration of the City of Vernon. City, with a lower case "c" may mean any city. Conservation: The management of natural resources to prevent waste, destruction, or neglect. CNEL: Community Noise Equivalent Level. In order to account for increased human sensitivity at night, this measure weights the average noise level at night by adding five dB to the measurement during the 7:00 P.M. to 10:00 P.M. time period and an additional ten dB on noise measured during the 10: P.M. to 7:00 A.M. time period. Vernon uses this measure in its noise standard. Collector: A relatively low-speed and low-volume street for moving traffic between arterial and local streets, and generally providing direct access to properties. Councils of Governments: Regional bodies that exist throughout the United States, typically defined to serve an area of several counties, and address issues such as regional and municipal planning, economic and community development, cartography and GIS, hazard mitigation and emergency planning, aging services, water use, pollution control, transit administration, and transportation planning. Vernon is part of the Gateway Cities Council of Governments (COG). Compatibility: The characteristics of different uses or activities that permit them to be located near each other in harmony and without conflict. The designation of permitted and conditionally permitted uses in zoning districts is intended to achieve compatibility within the district. Consistent: Free from variation or contradiction. Dam inundation: Structural damage to a dam resulting in a flood. Dam failure can occur due to an earthquake, erosion, design flaw, or water overflow during storms. Decibel (dB): A unit measuring the magnitude of a sound, equal to the logarithm of the ratio of the intensity of the sound to the intensity of an arbitrarily chosen standard sound, specifically a sound just barely audible to an unimpaired human ear. For environmental noise from aircraft and other transportation sources, an A-weighted sound level (abbreviated dBA) is normally used. The A-weighting scale adjusts the Vernon General Plan Glossary Glossary - 3 values of different sound frequencies to approximate the auditory sensitivity of the human ear. Dedication: The turning over by an owner or developer of private land for public use, and the acceptance of land for such use by the governmental agency having jurisdiction over the public function for which it will be used. Derailment: An accident on a railway whereby a train leaves the rails. Designation: A generalized category of land use type, with associated standards of use and development. Development: Development has the meaning of Section 65927 (California Government Code) and is also any human-caused change to improved or unimproved real estate that requires a permit or approval from any agency of the city or county, including but not limited to, buildings or other structures, mining, dredging, filling, grading, paving, excavation or drilling operations and storage of materials. “Development” means, on land, in or under water, the placement or erection of any solid material or structure; discharge or disposal of any dredged material or of any gaseous, liquid, solid, or thermal waste; grading, removing, dredging, mining or extraction of any materials; change in the density or intensity of use of land, including, but not limited to, subdivision pursuant to the Subdivision Map Act (commencing with Section 66410 of the Government Code), and any other division of land except where the land division is brought about in connection with the purchase of such land by a public agency for public recreational use; change in the intensity of use of water, or of access thereto; construction, reconstruction, demolition, or alteration of the size of any structure, including any facility of any private, public, or municipal utility; and the removal or harvesting of major vegetation other than for agricultural purposes, kelp harvesting, and timber operations which are in accordance with a timber harvesting plan submitted pursuant to the provisions of the Z’berg-Nejedly Forest Practice Act of 1973 (commencing with Section 4511 of the Public Resources Code). As used in this section, “structure” includes, but is not limited to, any building, road, pipe, flume conduit, siphon, aqueduct, telephone line, and electrical power transmission and distribution line. “Development” does not mean a “change of organization”, as defined in Government Code Section 56021 or a “reorganization”, as defined in Government Code Section 56073. Element: A division of the General Plan referring to a topic area for which goals, policies, and programs are defined (e.g., land use, housing, circulation). EPA (Environmental Protection Agency): The United States agency charged with setting policy and guidelines and carrying out legal mandates for the protection of national interests in environmental resources. Fault: A fracture in the earth's crust forming a boundary between rock masses that have shifted. Vernon General Plan Glossary Glossary - 4 Floor-Area Ratio (FAR): The floor area of the building or buildings on a site or lot divided by the area of the site or lot. General Plan: A legal document which takes the form of a map and accompanying text adopted by the local legislative body. The plan is a compendium of policies regarding the long-term development of a jurisdiction. The state requires the preparation of seven elements or divisions as part of the plan: land use, housing, circulation, conservation, open space, noise, and safety. Ground Shaking: Ground movement resulting from the transmission of seismic waves during an earthquake. Groundwater: The supply of fresh water under the ground surface in an aquifer or soil that forms a natural reservoir. Hazardous Materials: An injurious substance, including pesticides, herbicides, toxic metals and chemicals, liquefied natural gas, explosives, volatile chemicals, and nuclear fuels. Historic: A historic building or site is one that is noteworthy for its significance in local, state, or national history or culture, its architecture or design, or its works of art, memorabilia, or artifacts. Household: According to the Census, a household is all persons living in a dwelling unit, whether or not they are related. Both a single person living in an apartment and a family living in a house are considered households. Implementation: An action, procedure, program, or technique that carries out General Plan policy. Intensity: the total building square footage, percent of lot coverage, or floor-area ratio established on a property. For the purposes of this General Plan, the intensity of non- residential development is described through the use of floor-area ratio. Intersection: Where two or more roads cross at grade. Intersection Capacity Utilization (ICU): A tool for measuring a roadway intersection's capacity. The method is applied using peak hour volumes and considers the geometric configuration of intersections when measuring capacity. Land Use: A description of how land is occupied or used. Vernon General Plan Glossary Glossary - 5 Level of Service (LOS): The efficiency and quality of traffic operations. Six categories of LOS – the letter designations A to F – are used to identify traffic conditions, with LOS A representing excellent conditions and LOS F representing extreme congestion. Liquefaction: A process by which water saturated granular soils transform from a solid to a liquid state due to groundshaking. This phenomenon usually results from shaking from energy waves released in an earthquake. Local Street: A street providing direct access to properties and designed to discourage through traffic. Lot: A legally recognized parcel of land abutting on one or more public or city-approved private streets. Lot coverage: The percentage of the total lot area covered by structures. Lot line: A line bounding a lot as described in a property survey. Mitigate: To ameliorate, alleviate, or avoid to the extent reasonably feasible. Noise: Any sound which exceeds the appropriate actual or presumed ambient noise level which annoys or tends to disturb humans, or which causes or tends to cause an adverse psychological or physiological effect on humans. Noise Contours: Continuous lines of equal noise level usually drawn around a noise source, such as an airport or highway. The lines are generally drawn in five-decibel increments so that they resemble elevation contours in topographic maps. Nonconforming Use: An established use of a building or land which was legally initiated but which does not conform to the present code because of subsequent changes in land use regulations. Open Space (general descriptive term): Land without buildings. This is a general, descriptive term which places no restrictions on the use of the land. The definition of open space includes constructed open space (e.g. parks and plazas) and natural open space (essentially unimproved, with native habitat). Overcrowding: The federal government defines an overcrowded household as one with more than one person per room, excluding bathrooms, kitchens, hallways, and porches. Severely overcrowded households are households with greater than 1.5 persons per room. Overlay: A land use designation or a zoning designation that modifies the basic underlying designation in some specific manner. Vernon General Plan Glossary Glossary - 6 Overpayment: State and federal standards specify overpayment occurs if a household pays 30 percent or more of its gross income on housing. Parcel: The basic unit of land entitlement. A designated area of land established by plat, subdivision, or otherwise legally defined and permitted to be used or built upon. Planning Area: The planning area is the land areas addressed by the General Plan. For a city, the planning area boundary typically coincides with the sphere of influence and encompasses land both within the City limits and potentially annexable land. PM (Particulate matter): Solid or liquid particles of soot, dust, smoke, fumes, and aerosols. PM10: Particulate matter less than 10 microns. A major air pollutant consisting of tiny solid or liquid particles of soot, dust, smoke, fumes and aerosols. The size of the particles (10 microns or smaller, about 0.0004 inches or less) allows them to easily enter the air sacs in the lungs where they may be deposited, resulting in adverse health effects. PM10 also causes visibility reduction and is a criteria air pollutant. Private: Of or concerning a particular person or group; not owned by a government body. Public: Of the people as a whole, or for the use and benefit of all. Rail yard: A complex series of railroad tracks for storing, sorting, or loading/unloading, railroad cars and/or locomotives. Yards may have multiple industries adjacent to them where railroad cars are loaded or unloaded and then stored before they move on to their new destination. Reclaimed water: Former wastewater (sewage) that has been treated and purified for reuse, rather than discharged into a body of water. Also known as recycled water. Recycled water: See “reclaimed water.” Redevelopment: Redevelopment, under the California Community Redevelopment Law, is a process with the authority, scope, and financing mechanisms necessary to provide stimulus to reverse current negative business trends, remedy blight, provide job development incentives, and create a new image for a community. It provides for the planning, development, redesign, clearance, reconstruction, or rehabilitation, or any combination of these, and the provision of public and private improvements as may be appropriate or necessary in the interest of the general welfare. In a more general sense, redevelopment is a process in which existing development and use of land is replaced with newer development and/or use. Regional: Pertaining to activities or economies at a scale greater than that of a single jurisdiction and affecting a broad homogeneous area. Vernon General Plan Glossary Glossary - 7 Regional Housing Needs Assessment (RHNA): The Regional Housing Needs Assessment (RHNA) is based on State of California projections of population growth and housing unit demand and assigns a share of the region's future housing need to each jurisdiction within the SCAG (Southern California Association of Governments) region. These housing need numbers serve as the basis for the update of the Housing Element in each California city and county. Regulation: A rule or order prescribed for managing government. Remediation: Removal of pollution or contaminants from environmental media such as soil, groundwater, sediment, or surface water for the general protection of human health and the environment. Rendering: Rendering is a process that converts waste animal tissue into stable, value- added materials. Rendering can refer generally to any processing of animal byproducts into more useful materials, or more narrowly to the rendering of whole animal fatty tissue into purified fats like lard or suet. Right-of-way: A strip of land occupied or intended to be occupied by certain transportation and public use facilities, such as roads, railroads, and utility lines. Sanitary Sewer: A system of subterranean conduits that carries refuse liquids or waste matter to a plant where the sewage is treated, as contrasted with storm drainage systems (that carry surface water) and septic tanks or leach fields (that hold refuse liquids and waste matter on site). Seismic: Caused by or subject to earthquakes or earth vibrations. Setback: The distance from a defined point of line governing the placement of buildings, structures, parking, or uses on a lot. Sewer: Any pipe or conduit used to collect and carry away wastewater from the generating source to a treatment plant or discharge outfall. Site: A parcel of land used or intended for one use or a group of uses and having frontage on a public or an approved private street. Slaughtering: The killing of animals to produce food products. Southern California Association of Governments (SCAG): The Southern California Association of Governments is a regional planning agency that encompasses six counties: Imperial, Riverside, San Bernardino, Orange, Los Angeles, and Ventura. SCAG is responsible for preparation of the Regional Housing Needs Assessment (RHNA). Vernon General Plan Glossary Glossary - 8 Special Needs Groups: Those segments of the population which have a more difficult time finding decent affordable housing due to special circumstances. Under state planning law, these special needs groups consist of seniors, disabled, large households, female-headed households with children, farmworkers, homeless, and students. Special Assessment District: A unique geographic area in which the market value of real estate is enhanced due to the influence of a public improvement and in which a tax is apportioned to recover the costs of the public improvement. Sphere of Influence: The probable physical boundaries and service area of a local agency, as determined by the Local Agency Formation Commission of the county. Spur rail line: A short side track that connects with the main track of a railroad system. Standards: (1) A rule or measure establishing a level of quality or quantity that must be complied with or satisfied. The California Government Code (Section 65302) requires that General Plans describe "standards". Examples of standards might include the number of acres of parkland per 1,000 population that the community will attempt to acquire and improve. (2) Requirements in a zoning ordinance that govern building and development as distinguished from use restrictions; for example, site design regulations such as lot area, height limit, frontage, landscaping, and floor area ratio. Stormwater runoff: Stormwater is a term used to describe water that originates during precipitation events or runoff water from overwatering that enters the stormwater system. Stormwater that does not soak into the ground becomes surface runoff, which either flows into surface waterways or is channeled into storm sewers. Subdivision: The division of a tract of land into defined lots, either improved or unimproved, which can be separately conveyed by sale or lease, and which can be altered or developed. "Subdivision" includes a condominium project as defined in Section 1350 of the California Civil Code and a community apartment project as defined in Section 11004 of the Business and Professions Code. Tax increment: Additional tax revenues that result from increases in property values within a redevelopment area. State law permits the tax increment to be earmarked for redevelopment purposes but requires at least 20 percent to be used to increase and improve the community’s supply of affordable housing. Toxic: Poisonous. Traffic Model: A mathematical representation of traffic movement within an area or region based on observed relationships between the kind and intensity of development in specific areas. Units At-Risk of Conversion: Housing units that are currently restricted to low-income housing use and will become unrestricted and possibly be lost as low-income housing. Vernon General Plan Glossary Glossary - 9 Use: The purpose for which land or a building is designed, arranged, or intended, or for which the land or building may be occupied or maintained. Vacant: Lands or buildings that are not actively used for any purpose. Volume-to-Capacity Ratio (V/C): A ratio between volume and theoretical roadway capacity, V/C is used to measure the performance of roadway facilities. Volume is established either by a traffic count (in the case of current volumes) or by a forecast for a future point in time. Capacity refers to the vehicle carrying ability of a roadway at free flow speed. Zoning: The division of a city or county by legislative regulations into areas, or zones, which specify allowable uses for real property and size restrictions for buildings within these areas; a program that implements policies of the General Plan. Requirements vary between zones, but they must be uniform within the same zone. The Zoning Code consists of a map and text. Vernon refers to its zoning code as the Zoning Ordinance. Zoning Map: The officially adopted zoning map of the city specifying the location of zoning districts within all geographic areas of the city. Vernon General Plan Glossary Glossary - 10 This page intentionally left blank. VERNON GENERAL PLAN APPENDIX C HOUSING ELEMENT APPENDIX Vernon General Plan Housing Element Housing Element Appendix –C- 1 Residential Units within the City of Vernon Jurisdiction 1. 3376 E. 50th Street 2. 3378 E. 50th Street 3. 3380 E. 50th Street 4. 3382 E. 50th Street 5. 3384 E. 50th Street 6. 3386 E. 50th Street 7. 3388 E. 50th Street 8. 3390 E. 50th Street 9. 3345 Fruitland Avenue 10. 3349 Fruitland Avenue 11. 3353 Fruitland Avenue 12. 3357 Fruitland Avenue 13. 3361 Fruitland Avenue 14. 3365 Fruitland Avenue 15. 4321 Furlong Place 16. 4322 Furlong Place 19. 4325 Furlong Place 17. 4323 Furlong Place 18. 4324 Furlong Place 20. 4326 Furlong Place 21. 4327 Furlong Place 22. 4328 Furlong Place 23. 4329 Furlong Place 24. 4330 Furlong Place 25. 2328 E. Vernon Avenue 26. 2332 E. Vernon Avenue 27. 2334 E. Vernon Avenue 28. 3550 E. Vernon Avenue 29. 3560 E. Vernon Avenue 30. 2801 Leonis Boulevard 31. 2833 Leonis Boulevard Attachment B COMPREHENSIVE ZONING ORDINANCE OF THE CITY OF VERNON 2015 Comprehensively Updated January 2008 Amended February 2013 Amended ______ 2015 COMPREHENSIVE ZONING ORDINANCE OF THE CITY OF VERNON Chapter 26 of The Code of the City of Vernon Effective Date of This Ordinance January 16, 2008 Amended February 5, 2013 Amended ___________, 2015 Table of Contents Chapter 26. Comprehensive Zoning Ordinance COMPREHENSIVE ZONING ORDINANCE OF THE CITY OF VERNON PART PAGE Article I. Introduction. ............................................................................................................ I-1 Sec. 26.1.1.Title. ......................................................................................................................... I-1 Sec. 26.1.2.Purpose and Intent. ............................................................................................... I-1 Sec. 26.1.3.Interpretation and Conflicts. ................................................................................ I-1 Sec. 26.1.4.Applicability. ........................................................................................................... I-1 Sec. 26.1.5.Vested Right............................................................................................................ I-2 Sec. 26.1.6.Severability. ............................................................................................................. I-2 Sec. 26.1.7.Statute of Limitations for Actions Attacking General Plan, Zoning Ordinance, or Zoning Decisions. .......................................................... I-2 Article II. Definitions. ........................................................................................................... II-1 26.2.Purpose of Definitions; Words Defined. ............................................. II-1 Sec. 26.2.1.Definitions (A). ..................................................................................................... II-1 Sec. 26.2.2.Definitions (B). ..................................................................................................... II-2 Sec. 26.2.3.Definitions (C). ..................................................................................................... II-2 Sec. 26.2.4.Definitions (D-E). ................................................................................................ II-3 Sec. 26.2.5.Definitions (F-G). ................................................................................................ II-4 Sec. 26.2.6.Definitions (H-I). ................................................................................................. II-4 Sec. 26.2.7.Definitions (J-K). ................................................................................................. II-5 Sec. 26.2.8.Definitions (L). ..................................................................................................... II-5 Sec. 26.2.9.Definitions (M-O). ............................................................................................... II-6 Sec. 26.2.10.Definitions (P-Q). ................................................................................................ II-8 Sec. 26.2.11.Definitions (R). ..................................................................................................... II-9 Sec. 26.2.12.Definitions (S). ................................................................................................... II-10 Sec. 26.2.13.Definitions (T). ................................................................................................... II-10 Sec. 26.2.14.Definitions (U-V). .............................................................................................. II-11 Sec. 26.2.15.Definitions (W-Z). ............................................................................................. II-12 Article III. Zone and Overlay Zones. .................................................................................... II-1 Sec. 26.3.1.Zone and Overlay Zones of the City. .............................................................. III-1 Sec. 26.3.2.Comprehensive Zoning Map. ........................................................................... III-2 Sec. 26.3.3.Uncertainty as to Overlay Zone Boundaries. .................................................. III-2 Sec. 26.3.4.Keeping of Zoning Map. ................................................................................... III-2 Sec. 26.3.5.Non-Applicability to City of Vernon……………………………………III-2 Article IV. Zones, Permitted Uses, Development Standards, and Site Planning Standards. ............................................................................................................................ III-1 Sec. 26.4.1.General Industry (I) Zone. ................................................................................ IV-1 Sec. 26.4.2.Commercial-1 (C-1) Overlay Zone. ................................................................. IV-9 Sec. 26.4.3.Commercial-2 (C-2) Overlay Zone. ............................................................... IV-11 Table of Contents Chapter 26. Comprehensive Zoning Ordinance Sec. 26.4.4.Slaughtering (S) Overlay Zone. ....................................................................... IV-12 Sec. 26.4.5.Rendering (R) Overlay Zone. .......................................................................... IV-13 Sec. 26.4.6.Housing (H) Overlay Zone. ............................................................................ IV-13 Sec. 26.4.7.Truck and Freight Terminal (T) Overlay Zone. ........................................... IV-15 Sec. 26.4.8.Emergency Shelter (E) Overlay Zone. ........................................................... IV-16 Article V. Regulations Applicable to the I Zone and Overlay Zones. ................................. IV-1 Sec. 26.5.1.Off-Street Parking and Loading Facilities. ....................................................... V-1 Sec. 26.5.2.Street Dedication and Improvements. .............................................................. V-9 Sec. 26.5.3.Legal Nonconforming Status. ............................................................................ V-9 Article VI. Special Regulations and Procedures. .................................................................. V-1 Sec. 26.6.1.Purpose. ................................................................................................................ VI-1 Sec. 26.6.2.Variances. ............................................................................................................. VI-1 Sec. 26.6.3.Conditional Use Permit. ..................................................................................... VI-5 Sec. 26.6.4.Minor Conditional Use Permit. ....................................................................... VI-12 Sec. 26.6.5.Temporary Use Permits. .................................................................................. VI-17 Sec. 26.6.6.Zoning Ordinance or Text Amendment. ...................................................... VI-21 Sec. 26.6.7.Interpretations, Minor Exceptions, and Appeals. ........................................ VI-22 Sec. 26.6.8.Development Agreement. ................................................................................ VI-23 Sec. 26.6.9.Reasonable Accommodation. .......................................................................... VI-24 Sec. 26.6.10.Density Bonuses. ............................................................................................... VI-25 Article VII. Zoning Regulations for Adult or Sexually Oriented Businesses. ..................... VI-1 Sec. 26.7.1.Purpose. .............................................................................................................. VII-1 Sec. 26.7.2.Definitions. ........................................................................................................ VII-1 Sec. 26.7.3.Location Requirements. ................................................................................... VII-1 Article VIII. Zoning Regulations for Off-Site Outdoor Advertising Structures. ............... VII-1 Sec. 26.8.1.Application of Article. ..................................................................................... VIII-1 Sec. 26.8.2.Development Agreement Required. .............................................................. VIII-1 Sec. 26.8.3.General Conditions. ......................................................................................... VIII-1 Article IX. Zoning Regulations for Drive-through and Drive-up Facilities. .................... VIII-1 Sec. 26.9.1.Purpose. ................................................................................................................ IX-1 Sec. 26.9.2.Application of Article. ........................................................................................ IX-1 Sec. 26.9.3.General conditions. ............................................................................................. IX-1 Article X. Enforcement. ........................................................................................................ IX-1 Sec. 26.10.1.Application of Article. ......................................................................................... X-1 Comprehensive Zoning Map of the City of Vernon Article I. Introduction. I-1 Chapter 26. Comprehensive Zoning Ordinance Chapter 26. Comprehensive Zoning Ordinance Article I. Introduction. I Sec. 26.1.1. Title. This Chapter and the accompanying Zoning Map shall be known as the “Comprehensive Zoning Ordinance of the City of Vernon” (hereinafter this “Chapter”), which for convenience may be referred to as the “Zoning Ordinance” or “this Ordinance”. Sec. 26.1.2. Purpose and Intent. The purpose of this Chapter is to consolidate and coordinate all existing zoning regulations and provisions into one comprehensive zoning plan that designates, regulates, and restricts the use, location, and size of Buildings, Ancillary Structures, and land for industrial uses and other permitted purposes and that establishes performance and development standards in order to protect the public health, safety, and welfare. To achieve these purposes, this Chapter establishes one Zone within the City (Industrial) and various Overlay Zones of such number, shape, and area as have been deemed best suited to carry out these regulations and provide for the administration and enforcement of said regulations. It is declared that in the enactment of this Chapter, the City Council has given due and special consideration to the industrial nature of the City, and to the City’s continuing focus on providing a suitable location for industry and the infrastructure and services required to serve industrial activities. The City’s intent is to continue to support the ongoing industrial character of the City, while recognizing the changing industrial environment throughout the United States and globally, and to respond appropriately. The City Council has further seriously considered the impact of the City’s pervasive industrial environment and resulting land use incompatibilities with certain other uses as a result of, among other issues, the storage, use, transportation, and processing of hazardous materials; background contamination; noxious odors; noise pollution; and truck and railroad traffic throughout the City. Sec. 26.1.3. Interpretation and Conflicts. This Chapter supersedes and replaces all prior zoning codes or ordinances and amendments thereto, and represents the entire and complete zoning ordinance for the City as of the date of its effective date. Wherever the requirements of this Chapter are at variance with the requirements of any other lawfully adopted rule, regulation, or ordinance, the most restrictive or that imposing the higher standards shall govern. Sec. 26.1.4. Applicability. This Chapter shall apply as follows: Sec. 26.1.4-1. Buildings, Ancillary Structures, and Lots. Except as provided by this Chapter, no Building, Ancillary Structure, or Lot shall hereafter be used or occupied and no Building or Ancillary Structure or part thereof shall be erected, moved, or altered unless in conformity with the regulations herein specified for the Zone or Overlay Zone in which it is located, and then only after securing all permits and licenses required by any law or ordinance. Article I. Introduction. Chapter 26. Comprehensive Zoning Ordinance I-2 Sec. 26.1.4-2. Licenses and Permits. No City official, officer, or employee or anyone acting on behalf of such person shall issue any license or permit for uses, Buildings, or purposes contrary to, or in violation of, the provisions of this Chapter. Sec. 26.1.4-3. Authority. Whenever a power is granted to or a duty imposed upon a public officer by this Chapter, the power may be exercised or the duty may be performed by the City Council, that officer or a duly authorized representative of that officer, or a person authorized pursuant to law or ordinance, unless this Chapter expressly provides otherwise. Sec. 26.1.5. Vested Right. Nothing in this Chapter shall create or be construed to create any vested right in any Person. Sec. 26.1.6. Severability. If any provision or clause of this Chapter or the application thereof to any Person or circumstance is held invalid, such invalidity shall not affect other provisions or applications of this Chapter which can be carried out without the invalid provision or application, and to this end the provisions of this Chapter are declared to be severable. Sec. 26.1.7. Statute of Limitations for Actions Attacking General Plan, Zoning Ordinance, or Zoning Decisions. Except as otherwise provided in the California Government Code Section 65009, no action or proceeding to attack, review, set aside, void, or annul the City Council’s decision to adopt or amend its general plan or this Code, or any decision on the granting or denial of a Conditional Use Permit, Minor Conditional Use Permit, Temporary Use Permit, Variance, or Development Agreement, or to determine the reasonableness, legality, or validity of any condition attached to a Conditional Use Permit, Minor Conditional Use Permit, Temporary Use Permit, Variance, or Development Agreement or any other permit, or concerning any of the proceedings, acts, or determinations taken, done, or made prior to any decision in connection with any of the above, shall be maintained by any Person unless such action or proceeding is commenced and service is made on the City Council within ninety (90) days after the date of the City Council’s decision. Thereafter all Persons are barred from any such action or proceeding or any defense of invalidity or unreasonableness of such decision or of such proceedings, acts, or determinations. Article II. Definitions. II-1 Chapter 26. Comprehensive Zoning Ordinance Article II. Definitions. II 26.2. Purpose of Definitions; Words Defined. For the purpose of this Chapter, certain words and terms are defined and shall be construed as herein set forth unless otherwise expressly stated, or unless the context clearly indicates a different intention. Words defined herein may have different definitions in different Chapters of this Code. Sec. 26.2.1. Definitions (A). Adult or Sexually Oriented Businesses shall have the same meaning as defined in Chapter 5, “Business License Taxes and Other City Taxes,” Article VI, “Business Permit Regulations for Adult or Sexually Oriented Businesses or Similar Businesses” (See Code Section 5.81.2, “Definitions A-B”), and shall be deemed to be a First Amendment Protected Use. Amendment shall mean a change in the wording, context, or substance of this Chapter or a change in the Zone or Overlay Zone boundaries or Zone or Overlay Zone classifications upon the Zoning Map. Ancillary Structure shall mean any structure that is built or constructed to be used in connection with the use of the Property on which it is located, including items such as a fence, wall, steps, sign, or other structure built or composed of parts joined together in some definite manner, excluding a Building, and shall also include any equipment anchored to the ground. Ancillary Use shall mean a use customarily incidental or subordinate to a Person’s Permitted Use, as further described in Section 26.4.1-2(h), “Ancillary Use,” such as office space or showroom space that does not occupy more than twenty percent (20%) of the gross Floor Area occupied by the Person’s Permitted Use. Ancillary Use shall include mail-order or internet sales in connection with a Permitted Use. Ancillary Retail Use shall mean a Retail Use customarily incidental or subordinate to a Person’s Permitted Use, as further described in Section 26.4.1-4(b) that does not occupy more than ten percent (10%) of the gross Floor Area occupied by the Person’s Permitted Use. Any retail activity exceeding this limit shall be considered a primary use of property and subject to the land use regulations applicable to such use. Ancillary Retail Use shall not include mail-order or internet sales in connection with a Permitted Use. Auto Wrecker - see Junk or Salvage Business. Awning shall mean an architectural projection that provides weather protection, identity, or decoration, and which projects from and is wholly supported by the exterior wall of a building to which it is attached, requiring no additional structure(s) for support. An awning is typically composed of canvas or other similar material, Article II. Definitions. Chapter 26. Comprehensive Zoning Ordinance II-2 Sec. 26.2.2. Definitions (B). Bars shall mean establishments that primarily serve alcoholic beverages (not including restaurants that primarily serve food, and that also serve alcoholic beverages), including, without limitation, taverns and nightclubs. Bar shall not include an Adult or Sexually Oriented Business, even if it serves alcoholic beverages. Billboard - See Outdoor Advertising Structure. Building shall mean any structure having a permanent roof supported by columns or walls and attached to the ground. Sec. 26.2.3. Definitions (C). Canopy shall mean any fixed roof-like structure or architectural projection of rigid construction that is structurally independent or supported by attachment to a Building on one end and by not less than one stanchion on the outer end. Cell Tower shall mean a structure intended to support equipment used to transmit and/or receive telecommunications signals, including monopoles, guyed, and lattice construction steel structures. CEQA shall mean the California Environmental Quality Act, California Public Resources Code Sections 21000-21177. Change of Use shall mean any new use or change of activity, including any commencement of a new business activity, purpose, or use that requires a permit from the Department of Public Works, Water and Development Services pursuant to this Chapter, except that a use permitted by a Temporary Use Permit or a Special Events Permit shall not be considered a Change of Use. Chapter shall mean this Chapter 26; Comprehensive Zoning Ordinance of the City of Vernon. City shall mean the City of Vernon. City Council shall mean the City Council of the City of Vernon. Code shall mean the Municipal Code of the City of Vernon. Cold Storage Warehouse shall mean a Building or part of a Building used primarily to store non- durable, perishable goods under refrigeration at temperatures of thirty-five degrees Fahrenheit (35º) or lower, excluding areas used for the processing, preparing, or packaging of such goods for storage. Commercial Use shall mean businesses that provide goods or services, including but not limited to banks, publishing and printing shops, equipment rental and leasing, Offices, automotive repair, and Urgent Care Facilities. Community Facilities shall mean Buildings and facilities intended to be used by the general public (or segments of the general public), including, without limitation, private schools (including special purpose schools, such as nursery schools or special interest schools, but not including trade schools), Article II. Definitions. II-3 Chapter 26. Comprehensive Zoning Ordinance libraries, museums, senior citizen centers, day care centers, hospitals and emergency rooms, multi-use facilities, such as YMCAs and community centers, cemeteries, and other similar facilities, but not including a Religious Use or a Convention and Entertainment Venue, as defined below. Conditional Use Permit shall mean a discretionary permit granted by the City Council for certain uses of Property not permitted of right because such uses require special review and may be subject to special conditions. The requirements for a Conditional Use Permit are set forth in Section 26.6.3. Contractor’s Yard shall mean a permanent site that houses a contractor’s equipment or materials which are stored outdoors. Convention and Entertainment Venues shall mean establishments providing space for public or private gatherings and meetings, including but not limited to banquet rooms, auditoriums, conference/convention facilities, and facilities for participant or spectator recreation or entertainment. This definition does not include Adult or Sexually Oriented Businesses, Religious Uses, or Bars. Sec. 26.2.4. Definitions (D-E). Data Center shall mean a Building with a controlled environment used for housing a large amount of electronic equipment, typically computers and communications equipment, for the purpose of creating a hosted computer environment. Density shall mean the total number of permanent residential dwelling units per acre of land, exclusive of all existing public Right-of-way surfaces or similar property. Development Agreement shall mean a contract duly executed and legally binding between the City of Vernon and a developer(s) pursuant to Government Code Sections 65864 through 65869.5 et seq. Development Standards shall mean the development and performance standards described in Section 26.4.1-7, “Development Standards and Site Planning Standards,” and/or development and performance standards identified for individual Overlay Zones in this Chapter. Digital Display shall mean the face of a sign or Outdoor Advertising Structure that is comprised of a digital or electronic face with intermittent changeable messages. Director shall mean the City of Vernon Director of Public Works, Water, and Development Services. Drive-Through or Drive-Up Facilities. An establishment that sells products or provides services to occupants in vehicles, including drive-in or drive-up windows and drive-through services examples include fast food restaurants, banks, and pharmacies. Dwelling Unit - see Residence. Emergency Shelter, pursuant to California Health and Safety Code Section 50801(e), shall mean a facility that provides immediate and short-term housing to homeless persons or families on a first- come, first-serve basis where the individual(s) must vacate the facility each morning and have no Article II. Definitions. Chapter 26. Comprehensive Zoning Ordinance II-4 guaranteed bed for the next night. No individual or household may be denied emergency shelter because of inability to pay. Sec. 26.2.5. Definitions (F-G). First Amendment Protected Uses shall mean those uses with legal precedent to be protected by the First Amendment to the United States Constitution, specifically those uses constitutionally protected due to “freedom of association” in the form of intimate association (“intimate human relations”) or expressive association (“engaging in those activities protected by the First Amendment – speech, assembly, petition for the redress of grievances, and the exercise of religion”). First Amendment Protected Uses shall include but not be limited to Adult or Sexually Oriented Businesses and Tattoo Parlors. Floor Area shall mean the total horizontal area of all floors contained within the exterior walls of all Buildings, measured by the exterior dimensions of the Building, on a Lot. It shall include elevated storage areas and platforms, walkways, and similar interior structures or facilities used to provide access to such storage areas, but not where the same are used to provide access solely to machinery or equipment and are not normally occupied, except to maintain the equipment. Outdoor dining areas and balconies shall be considered floor area for determining the required parking and loading requirements. It shall not include Awnings, or Garages that are required parking for a Permitted Residential Use. Floor Area Ratio shall mean the ratio of the Floor Area of all Buildings on a Lot to the buildable area of that Lot. Force Majeure shall mean an event that is not within the control of the owner of the Property, including, without limitation, earthquake, flood, fire, and acts of war or terrorism. Freight Terminal shall mean any Lot, Building, or portion thereof where goods or freight, excluding perishable goods, are transferred or redistributed from one vehicle to another; provided, however, that such use in connection with the operation of a Warehouse Use or Cold Storage Warehouse shall not be deemed to be a Freight Terminal. A Freight Terminal shall not include any use involved in the storage of products for more than 72 hours. (For products stored longer than 72 hours, see “Warehouse Use”). Fueling Station shall mean any establishments engaged in the retail sale of gasoline, diesel, and alternative fuel, lubricants, parts, and accessories, that may include accessory minor maintenance and repair of automobiles and light trucks, vans, or similar size vehicles (i.e., vehicles that have gross vehicle weights less than 10,000 pounds). Minor repair does include body and fender work. Garage shall mean a structure or portion of a structure completely enclosed by walls or doors on all sides that is designed or used to shelter one (1) or more Parking Spaces. Sec. 26.2.6. Definitions (H-I). Hazardous Waste Facility shall mean any facility or location which has a primary function to store or process, treat, transfer, dispose of, or recycle all substances defined as hazardous waste, acutely hazardous waste, extremely hazardous waste, or biohazardous waste as defined by the State of Article II. Definitions. II-5 Chapter 26. Comprehensive Zoning Ordinance California in Health and Safety Code Sections 25110.02, 25115, 25117, and 117635 or in any amendments to or recodifications of such statutes. The definition shall not include the storage, use, generation, recycling, or disposal of hazardous materials as a secondary effect, product, or input of a Permitted Use on the same Lot as the Permitted Use. Hotel shall mean any building containing two (2) or more individual rooms or suites of rooms intended or designed to be used, or which are used, rented, or hired out to be occupied for sleeping or housing purposes by guests. Hotels include motels, boarding houses, rest homes, sanitariums, dormitories, and any other structure or Building other than a Residence or Emergency Shelter used for the housing or sleeping of humans. Incidental Use shall mean a use that is in connection with a Person’s Permitted Use, as further described in Section 26.4.1-4(a), “Incidental Use,” such as office space, design area or showroom space, that occupies more than twenty percent (20%) but less than fifty percent (50%) of the gross Floor Area occupied by the Person’s Permitted Use. Incidental Use shall not include a Retail Use, but may include mail-order or internet sales in connection with a Permitted Use. Industrial Gas Manufacturing shall mean the separation of the constituents of air into liquid or gaseous form for storage, transport, or cylinder filling, and the distribution and sale of those products, as well as other related welding gases. Industry or Industrial Use shall mean the manufacture or production of any saleable article, substance, or commodity, so long as the process adds substantial value to the article, substance, or commodity, and shall not include tasks primarily consisting of collecting, sorting, shipping, distributing, or inspecting goods from or in a warehouse or terminal. Industrial Use includes uses ancillary to the manufacturing or production process, such as storage, use, generation, and disposal of hazardous materials (as defined in federal and state laws and regulations) incidental to a manufacturing or production process; recycling incidental to a manufacturing or production process; and use of space for Ancillary Use. Sec. 26.2.7. Definitions (J-K). Junk or Salvage Business shall mean an auto wrecker or any business dealing in, selling, distributing, or buying for resale scrap materials (that is, used or waste materials) that require processing or recycling to be useful, including, without limitation, metal, cloth, paper, glass, wood, cardboard, plastics, or comparable matter, including used consumer products, but shall not include a yard ancillary to an Industrial Use. Junk or Salvage Business shall not include a business that processes or recycles the scrap materials on-site as a Recycling Facility. Sec. 26.2.8. Definitions (L). Landscaping shall mean an area devoted to the growing of plants, including trees, shrubs, grasses, or groundcovers for the visual or aesthetic enjoyment of people. Landscaping may include synthetic turf, fountains or sculpture in a minor portion of the area. Legal Nonconforming Building or Standards shall mean a Building or Ancillary Structure or portion thereof which was lawfully erected or altered and maintained but which, because of the application of this Chapter, no longer conforms to the regulations set forth in this Code applicable to Article II. Definitions. Chapter 26. Comprehensive Zoning Ordinance II-6 the Zone or Overlay Zone in which such Building or Ancillary Structure is located, including failure to comply with the Development Standards or Site Planning Standards applicable to such Zone or Overlay Zone. Legal Nonconforming Use shall mean a use which was lawfully established and maintained but which, because of the application of this Chapter, no longer conforms to the regulations set forth in this Chapter applicable to the Zone or Overlay Zone in which such use is located. Loading Space shall mean an off-street space that is maintained for the parking of a vehicle while loading or unloading merchandise or materials from the vehicle into a Building located on the same Lot as the space. Lot shall mean a quantity or parcel of land in the possession of, or owned by, or recorded as the property of the same claimant or Person, and that is: (a)A parcel of real property when shown as a delineated parcel of land with a number or other designation on a tract or plat map recorded in the office of the County Recorder; (b)A parcel of land, the dimensions and boundaries of which are defined by a record of survey recorded pursuant to the provisions of the Subdivision Map Act of the State in the office of the County Recorder; or (c)A legal lot or parcel as defined in the California Subdivision Map Act. (d)Where parcels of land in the same ownership are separately legally described and are developed as permitted by this Code, such individual parcels shall be considered as separate Lots, but if a covenant that ties two or more Lots has been recorded, all of the tied Lots shall be treated as one Lot. Sec. 26.2.9. Definitions (M-O). Major Alteration or Repair shall mean a renovation, alteration, or repair for which the hard costs charged, incurred, or paid for such renovation, alteration, or repair, over a three year period, commencing when the permit, if required, is issued, or if no permit is required, when the physical portion of the renovation, alteration, or repair is commenced, equals or exceeds fifty percent (50%) of the current fair market value of all of the Buildings located on the same Lot. For purposes of this Chapter, the cost of the renovation, alteration, or repair shall exclude any costs incurred for environmental investigation, testing, and remediation. For purposes of this Chapter, current fair market value shall be determined based only on the value of the Building, and shall not include the value of the unimproved land, any personal property or equipment, or any parking lot or landscaping. Fair market value shall not include the cost or value of the contemplated renovation, alteration, or repair, and shall be determined without reference to damage caused by an event of Force Majeure, if any. If the owner and the City do not agree on the current fair market value, the parties shall rely on a current appraisal by an independent third party MAI appraiser having at least five (5) years’ commercial real estate appraisal experience in the Los Angeles, California metropolitan area, obtained by the owner, at the owner’s expense. Article II. Definitions. II-7 Chapter 26. Comprehensive Zoning Ordinance Manure Fertilizer Business shall mean a business dealing in, buying, selling, handling, processing, or storing of manure; provided, however, that Manure Fertilizer Business shall not mean or include: (a) the storage and drying, grinding, and grading of manure upon the Property where the same is produced as a result of or in connection with the operation of any business permitted in the S Overlay Zone; (b) manufacture of chemical fertilizers; or (c) fertilizer generated from sludge. Marijuana Dispensary, Store, Co-op, or Cultivation Operation shall mean and include any location, structure, facility, residence, or similar to the same used, in full or in part, as a place at or in which marijuana is sold, traded, exchanged, bartered for in any way, made available, located, stored, placed, planted, cultivated, or processed, including any of the foregoing if used in connection with the delivery of marijuana. Massage Parlor – shall mean any establishment, where, for any form of consideration, massages, alcohol rub, fomentation, electric or magnetic treatment, or similar treatment or manipulation of the human body is administered, unless such treatment or manipulation is administered by a medical practitioner, chiropractor, acupuncturist, physical therapist or similar professional person licensed by the state of California. This definition does not include an athletic club, health club, school, gymnasium, state licensed cosmetology or barber establishment, reducing salon, spa or similar establishment where massage or similar manipulation of the human body is offered as an incidental or accessory service. Master Plan of Streets shall mean the Master Plan of Streets of the City of Vernon. Minor Alteration or Repair shall mean a renovation, alteration, or repair for which the hard costs charged, incurred, or paid for such renovation, alteration, or repair, over a three year period, commencing when the permit, if required, is issued, or if no permit is required, when the physical portion of the renovation, alteration, or repair is commenced, does not equal or exceed fifty percent (50%) of the current fair market value of all of the Buildings located on the same Lot. For purposes of this Chapter, the cost of the renovation, alteration, or repair shall exclude any costs incurred for environmental investigation, testing, and remediation. For purposes of this Chapter, current fair market value shall be determined based only on the value of the Building, and shall not include the value of the unimproved land, any personal property or equipment, or any parking lot or landscaping. Fair market value shall not include the cost or value of the contemplated renovation, alteration, or repair, and shall be determined without reference to damage caused by an event of Force Majeure, if any. If the owner and the City do not agree on the current fair market value, the parties shall rely on a current appraisal by an independent third party MAI appraiser having at least five (5) years’ commercial real estate appraisal experience in the Los Angeles, California metropolitan area, obtained by the owner, at the owner’s expense. Minor Conditional Use Permit shall mean a discretionary permit granted by the Director for certain uses of Property not permitted of right because such uses require special review and may be subject to special conditions. New Construction shall mean the construction of a new Building that is not attached to an existing Building. Occupancy shall mean the purpose for which a Building, or part thereof, is used or intended to be used. Article II. Definitions. Chapter 26. Comprehensive Zoning Ordinance II-8 Offices shall mean uses where professional , administrative, or common business services are provided and which are not Ancillary Uses or Incidental Uses as defined by this Ordinance,, such as but not limited to real estate firms, medical and professional offices, stock brokerages, and bond and insurance firms. Outdoor Advertising Structure shall mean any sign, logo, picture, transparency, mechanical device, billboard, or other representation (whether or not it includes words or logos) that is located off-site from the Property where the product or service is offered and is intended to attract attention to any commodity, good, product, or service for any business or non-profit purpose or entity. An Outdoor Advertising Structure shall not include any such sign or other structure that directs attention to the activity conducted, sold, or offered upon the Property where the sign or other structure is located. Outdoor Storage and Activities shall mean any use of Property for purposes of temporary or permanent storage of raw materials, storage or display of finished products or other materials, and including installation or storage of equipment (whether operational in the business or not operational) that is located outside of a Building, except for parking of cars and trucks. Sec. 26.2.10. Definitions (P-Q). Parking Space shall mean a readily accessible space or area other than a street or alley that is permanently reserved, maintained, and accessible for the parking of one (1) motor vehicle. Permitted Use shall mean a use that is permitted on a Lot, either by right as set forth in this Ordinance or by means of a Conditional Use Permit, Minor Conditional Use permit, Temporary Use Permit, or as a Legal Nonconforming Use. Person shall mean an individual, entity, or governmental agency other than the City of Vernon. Petroleum Refinery shall mean an establishment or plant primarily engaged in producing gasoline, kerosene, distillate fuel oils, residual fuel oils, lubricants, and other products from crude petroleum and its fractionation products through straight distillation, redistillation, cracking, or other processes. Petroleum-Related Use shall mean an establishment or plant for the blending or processing of petroleum products but not including a Petroleum Refinery or Petroleum Storage Facility. Petroleum- Related Use does not include storage of fuel as an Ancillary Use to a Permitted Use. Petroleum Storage Facility shall mean an establishment, including a tank farm, for keeping and storing gasoline, kerosene, distillate fuel oils, residual fuel oils, lubricants, and other petroleum products, but not including storage of fuel as an Ancillary Use. Petroleum-Related Use does not include storage of fuel as an Ancillary Use to a Permitted Use. Property shall mean all adjacent Lots under common ownership. Public Storage shall mean a structure or series of structures divided into small sections and used by the general public for storage of goods or materials. Public Utilities shall mean facilities owned or operated by an entity that is not the City of Vernon, that is subject to governmental regulation such as the California Public Utilities Commission, and that Article II. Definitions. II-9 Chapter 26. Comprehensive Zoning Ordinance provides an essential commodity or service such as water, power, transportation, or communication to the public. It shall include electrical substations, water or wastewater treatment plants, and similar facilities of public agencies or public utilities, but shall not include property used solely for telecommunications antennas, cell towers, and related equipment. Sec. 26.2.11. Definitions (R). Recycling Facility shall mean a facility that recycles used or waste materials, excluding Hazardous Waste, to convert and redistribute them, or a significant portion of them, as raw materials or to convert them and manufacture a product made wholly or partly from recycled materials, including a biodiesel facility. For these purposes, recycling shall mean a process involving reconstituting materials that would otherwise become waste and returning them to the economic mainstream in the form of raw materials for new reuses or reconstituted products which meet the quality standards necessary to be used in the marketplace. Recycling Facility does not include recycling activities undertaken as an Ancillary Use to a Permitted Use. Religious Use shall mean use of a Lot for religious assemblies, institutions, or structures. Religious Use shall not include any Residence on the Lot. Rendering Plant shall mean an establishment where one or more of the following items is cooked, melted down, extracted, clarified, or otherwise processed to produce oil, tallow, grease, fertilizer (other than fertilizer from manure), animal feed, or ash: carcasses of animals or fowl, dead animals or fowl, fish, blood, offal, bones, meat, animal or vegetable fat, feathers, food scraps or waste, and other animal, fowl, or fish byproducts. Rendering Plant shall not include an establishment exclusively producing fats, oils, lard, or similar products for human consumption; nor, a rendering process in connection with and incidental to a slaughterhouse, abattoir, packing plant, or similar establishment producing food for human consumption. Residence shall mean and include one or more rooms in a Building managed or used as living quarters, including, without limitation: a Building or Buildings used as a single-family dwelling or a multi-family dwelling; a Building or Buildings used as a live-in treatment facility, substance abuse center, half-way house, or home for senior citizens, disabled persons, or other residential care facilities; and dwelling units reserved for use by a resident owner, caretaker, watchman, emergency personnel, or maintenance personnel. Emergency Shelter is specifically excluded from this definition. Residential Use shall mean the development and use of a property exclusively with a Residence or Residences, and any accessory uses or Buildings customarily associated with a Residence, such as but not limited to private recreational facilities, private open space, and on-site support facilities to residents of the property. Retail Use shall mean a business providing the point of final sale of goods directly to customers, including, without limitation, restaurants and coffee shops, grocery stores, and vehicle sales. Retail Use shall not include mail-order or internet sales. Right-of-way shall mean the planned future ultimate width of a Street as determined by the Master Plan of Streets. Article II. Definitions. Chapter 26. Comprehensive Zoning Ordinance II-10 Sec. 26.2.12. Definitions (S). Salvage Yard – see Junk or Salvage Business. Server Farm – see Data Center. Site Planning and/or Site Development Standards shall mean the land use standards described in Section 26.4.1-8, “Site Planning Standards,” and/or site planning standards identified for individual Overlay Zones in this Chapter. Slaughtering shall mean the industrial process of butchering animals and dressing and preparing the products of their carcasses for food or other purposes. Solid Waste Facility shall mean any facility or location that stores, processes, or transfers solid waste as defined in California Public Resources Code Section 40191, or in any amendments to or recodifications of such statute, and related regulations. Sound Level shall mean the quantity in decibels measured by a sound level meter satisfying the requirements of American National Standards Specification for Sound Level Meters S1.4. The sound level meter shall be set at “A” weighting and at “SLOW” dynamic characteristic. Special Event Permit shall mean a permit issued by the Vernon Fire Department for a short duration special event such as indoor or outdoor sales event of product normally stored or produced onsite, outdoor or indoor meeting, ground breaking ceremony, holiday or special occasion party or similar event. Static Display shall mean the face of a sign or Outdoor Advertising Display that has a fixed, printed face and does not have a Digital Display. Street shall mean (a) any public road or street (including a highway or freeway) or sidewalk owned or controlled by any governmental entity, or (b) any private recorded thoroughfare that affords a means of access to an abutting Lot. Supportive Housing shall mean housing with no limit on length of stay that is occupied by the target population as defined in the California Health and Safety Code Section 50675.14, and that is linked to on-site or off-site services that assist tenants to retain the housing, improve their health status, maximize their ability to live, and when possible, to work in the community. Sec. 26.2.13. Definitions (T). Tattoo Parlors shall mean establishments whose principal business activity is one or more of the following: (a) using ink or other substances that result in the permanent coloration of the skin through the use of needles or other instruments designed to contact or puncture the skin; or (b) creation of an opening in the body of a person for the purpose of inserting jewelry or other decoration. Tattoo Parlors are considered a First Amendment Protected Use. Article II. Definitions. II-11 Chapter 26. Comprehensive Zoning Ordinance Telecommunications Antenna shall mean a physical device or system through which electromagnetic, wireless telecommunications signals authorized by the Federal Communications Commission are transmitted or received. Temporary Use Permit shall mean a permit granted by an authorized agent of the City for certain uses of Property not permitted of right because such uses might not meet the normal development or use standards of the applicable zone, but may otherwise be acceptable because of their temporary nature. Trade School shall mean a facility or teaching unit designed to educate an adult on the skills needed to perform a specific job, apprentice education, and similar training. Trailer shall mean any vehicle or structure having no foundation other than wheels, blocks, skids, jacks, horses, or skirting, and which is, has been, or reasonably may be equipped with wheels or other devices for transporting the structure from place to place whether by motor power or other means. The term Trailer shall include camp car, house car, mobile home, camper, recreational vehicle (RV), or other vehicle whose uses may include cooking or sleeping. Trailer Park shall mean any Lot or portion thereof used or designed to accommodate two (2) or more Trailers used for housekeeping or sleeping or living quarters, and such definition shall include trailer courts, mobile home courts, and mobile home parks. Transitional Housing shall mean temporary rental housing with length of stay that ranges between six (6) months to two (2) years for homeless individuals or families who are transitioning to permanent housing, operated under program requirements that call for the termination of assistance and recirculation of the assisted unit to another eligible program recipient at some predetermined future point in time. Transportation-Related Use shall mean any use that is the same or similar to a Freight Terminal or Truck Terminal, or that supports the movement of goods or people, such as taxi dispatch. A Transportation-Related Use shall not include a public Street or railroad Right-of-way. Trash to Energy Facilities shall mean the process of creating energy in the form of electricity or heat from waste conversion. Truck Terminal shall mean any Lot, Building, or portion of a lot or a building used primarily for the storage, maintenance, repair, or servicing of highway-type vehicles carrying persons or property including, but not limited to, trucks and buses. Truck Terminal does not include parking of vehicles in connection with a Permitted Use or repairing or maintaining vehicles used in connection with a Permitted Use on the same Lot as the Permitted Use. Sec. 26.2.14. Definitions (U-V). Urgent Care Facility shall mean a facility used to provide medical screenings or to treat patients who have an injury or illness that requires immediate care, but is not serious enough to warrant a visit to a hospital emergency room. Article II. Definitions. Chapter 26. Comprehensive Zoning Ordinance II-12 Variance shall mean an exception to the required Development Standards or Site Planning Standards applicable to a Property granted by the City Council based on the criteria and findings set forth in Section 26.6.2, “Variances.” Vibration shall mean discrete ground movement as measured by peak particle velocity in inches per second. Sec. 26.2.15. Definitions (W-Z). Warehouse Use shall mean a Building or portion thereof used primarily for the storage of saleable goods or raw materials to be incorporated into saleable goods (including storage for distribution to other locations for wholesale or retail sale), but not including a Cold Storage Warehouse. The storage of scrap materials shall not constitute a Warehouse Use. Wholesale Use shall mean a Building or part of a Building used primarily for the storage and distribution of merchandise that is sold in large volumes to retailers or other professional businesses, but not to a standard retail consumer. Wholesale Use includes the storage and distribution of merchandise for more than 72 hours. The storage and sale of scrap materials shall not constitute a Wholesale Use. Zone and Overlay Zone shall mean a section of the City to which regulations governing the use, area, size of Buildings and Ancillary Structures, and other uniform regulations apply. Zoning Map shall mean the Comprehensive Zoning Map of the City of Vernon, as further described in Section 26.3.2, “Comprehensive Zoning Map.” Article III. Zone and Overlay Zones. III-1 Chapter 26. Comprehensive Zoning Ordinance Article III. Zone and Overlay Zones. III Sec. 26.3.1. Zone and Overlay Zones of the City. Sec. 26.3.1-1. Establishment of Zone and Overlay Zones. As a result of its commitment to making property available for Industrial Use and to carry out the purposes and provisions of this Chapter, the entire City of Vernon is hereby zoned for General Industry (I Zone). All property within the City is located within the General Industry Zone (the I Zone), and must conform to the standards of use and the Development Standards and Site Planning Standards for the I Zone. Within the I Zone, special categories of Overlay Zones have been established for the purpose of allowing special uses that are not otherwise permitted within the City. The Zone and the Overlay Zones are designated as follows, and either the name or the symbol may be used to refer to the General Industry Zone (the I Zone) or any of the Overlay Zones. The boundaries of each of the Overlay Zones are set forth in detail on the Zoning Map. The I Zone is the General Industry Zone. The Overlay Zones are: C-1 C-2 E H - - - - Commercial-1 Overlay Zone Commercial-2 Overlay Zone Emergency Shelter Overlay Zone Housing Overlay Zone R - Rendering Overlay Zone S - Slaughtering Overlay Zone T - Truck and Freight Terminal Overlay Zone Sec. 26.3.1-2. Uses Permitted of Right. It is the City’s intent to provide an acceptable location within the County of Los Angeles for Industrial Uses, including those that may not be compatible with land use elsewhere in much of the County. As a result of this intent and the City’s pervasive industrial environment, Industrial Uses are permitted in the I Zone and each of the Overlay Zones. Certain non-Industrial Uses are permitted in the I Zone in accordance with Section 26.4.1-2, “Uses Permitted of Right,” et seq. Certain non-Industrial Uses may be permitted in the C-1, C-2, E, H, R, S, and T Overlay Zones, as set forth in the descriptions of the uses permitted in those Overlay Zones. Sec. 26.3.1-3. Uses that Require a Conditional Use Permit. All uses that are not specifically permitted under this Chapter and are not specifically prohibited by this Chapter require a Conditional Use Permit or other entitlement as may be specified in this Chapter. Sec. 26.3.1-4. Prohibited Uses. Uses that are prohibited in Section 26.4.1-5, “Uses That Are Prohibited or Limited,” shall not be permitted in any Zone or other Overlay Zone and are not be eligible for a Conditional Use Permit or other entitlement, in any Zone or other Overlay Zone. Sec. 26.3.1-5. Determination of Category of Use. The Director shall have the authority to determine if a proposed use is substantially similar to a use that is permitted of right and may therefore be located in the City or in a particular Overlay Zone. If the Director determines that a use is not Article III. Zone and Overlay Zones. Chapter 26. Comprehensive Zoning Ordinance III-2 specifically prohibited, is not permitted of right, or is substantially similar to a use that is permitted of right and may not otherwise be permitted through another entitlement process, the owner or applicant shall have the right to apply for a Conditional Use Permit or a Minor Conditional Use Permit in accordance with Sections 26.6.3, “Conditional Use Permit,” and 26.6.4, “Minor Conditional Use Permit.” Sec. 26.3.1-6. Legal Nonconforming Uses. Notwithstanding the terms of this Ordinance, uses that were in existence and permitted of right or by use of a Conditional Use Permit prior to the effective date of this Ordinance shall be permitted to remain on the Lot on which they are currently located, as Legal Nonconforming Uses in accordance with the terms of Section 26.5.3, “Legal Nonconforming Status,” and in accordance with their existing Conditional Use Permit, if applicable. Sec. 26.3.2. Comprehensive Zoning Map. A part of this Chapter is a Map that shows the location and boundaries of the various Overlay Zones established by this Chapter. This Map shall be known, cited, and referred to as the “Comprehensive Zoning Map of the City of Vernon” and may be referred to in this Chapter as the Zoning Map. Said Zoning Map, together with all notations, references, and other information shown thereon, is the official zoning map of the City of Vernon and shall be as much a part of this Chapter as if the matters and information set forth by said Zoning Map were all fully described herein. Copies of the Zoning Map are on file with the Department of Public Works, Water, and Development Services and are available on request. In the event of a conflict between the terms of this Chapter and the Zoning Map, the terms of this Chapter shall control. Sec. 26.3.3. Uncertainty as to Overlay Zone Boundaries. Where uncertainty exists with respect to the boundaries of any of the Overlay Zones, as shown on the Zoning Map, the determination of the City Council as to the location thereof shall be final and conclusive. Any decision regarding the boundaries of an Overlay Zone shall follow the then existing Lot lines. Sec. 26.3.4. Keeping of Zoning Map. The City Clerk shall keep a true and correct copy of the current Zoning Map at his or her office in the City Hall of the City. At the end of each calendar year, or more often at the direction of the City Clerk, said Zoning Map shall be revised to reflect all Amendments to this Chapter or the Zoning Map. Sec. 26.3.5. Non-Applicability to City of Vernon. Except as otherwise required by law, the requirements of this Chapter, and of the General Plan, do not apply to actions taken by the City to use or authorize the use of property that it owns or controls. Article IV. Zones, Permitted Uses, Development Standards, and Site Planning Standards. IV-1 Chapter 26. Comprehensive Zoning Ordinance Article IV. Zones, Permitted Uses, Development Standards, and Site Planning Standards. IV Sec. 26.4.1. General Industry (I) Zone. Sec. 26.4.1-1. Purpose and Intent. (a)The General Industry (I) Zone is intended to provide for the orderly development and operation of most types of Industrial Use and to promote the concentration of such uses in a manner that will foster mutually beneficial relationships with each other. The regulation of uses and establishment of Development Standards and Site Planning Standards set forth in the I Zone are those deemed necessary to promote the orderly operation and efficient functioning of the City. The right to use and maintain Legal Nonconforming Uses and Legal Nonconforming Building and Standards in the I Zone and all Overlay Zones are governed by Section 26.5.3, “Legal Nonconforming Status.” (b)Residential Uses are permitted only in the H Overlay Zone. (c)Commercial Use and Retail Use are permitted only in the C-1 and C-2 Overlay Zones. (d)First Amendment Protected Uses and Religious Uses are only permitted in the C-2 Overlay Zone. (e)Emergency Shelters are permitted only in the E Overlay Zone. (f)Rendering Plants are permitted only in the R Overlay Zone. (g)Slaughtering is permitted only in the S Overlay Zone. (h)Hazardous Waste Facilities, Solid Waste Facilities, Truck Terminals, Freight Terminals, and/or Transportation-Related Uses are permitted only in the T Overlay Zone. (i)Fueling Stations are permitted only in the C-1, C-2 and T Overlay Zones. (j)All of the above uses that are permitted in specified Overlay Zones are not permitted in other areas of the I Zone, and are not eligible for a Conditional Use Permit or Minor Conditional Use Permit in other areas of the I Zone, even if they are less intensive uses than the Permitted Uses within the I Zone or an Overlay Zone, (k)All of the above uses that are permitted in specified Overlay Zones are subject to the standards and regulations outlined for the Overlay Zone in which they are located. (l)Uses that are prohibited under this Chapter, even if less intensive than the Permitted Uses, shall not be permitted in the I Zone or any Overlay Zone. Determination of whether uses fit within the definition of Permitted Uses shall be in the discretion of the Director, as described in Section 26.3.1-5, “Determination of Category of Use.” Article IV. Zones, Permitted Uses, Development Standards, and Site Planning Standards. Chapter 26. Comprehensive Zoning Ordinance IV-2 Sec. 26.4.1-2. Uses Permitted of Right. The following uses of Buildings and land are permitted of right in the I Zone. (a)Industrial Use. (b)Data Centers. (c)Cold Storage Warehouses. (d)Industrial Gas Manufacturing. (e)Telecommunications Antenna and Cell Towers. (f)Warehouse Use (other than Cold Storage Warehouses). (g)Wholesale Use. (h)Ancillary Use. Each occupant or user on the Property and each tenant in a multi- tenant Building shall be permitted to dedicate a portion of that Person’s space to an Ancillary Use in connection with that Person’s Permitted Use, if the following criteria are satisfied: (1)The Permitted Use for such Person is that Person’s majority use. (2)The Ancillary Use is located upon the same Lot as that Person’s Permitted Use. (3)The Ancillary Use is used solely and exclusively by the Person for that Person’s Permitted Use. (4)Ancillary Use includes offices and showrooms ancillary to the Permitted Use, but does not include the right to sell at retail (Ancillary Retail Use), but does include the right to sublease to a separate tenant office space only within an existing office area. Ancillary Use does not include Outdoor Storage and Activities. (5)The cumulative total area dedicated to all Ancillary Uses (including any Ancillary Retail Use permitted with a Minor Conditional Use Permit) shall not exceed twenty percent (20%) of the gross floor area occupied by a Permitted Use. (i)Any activity or use undertaken by the City. Article IV. Zones, Permitted Uses, Development Standards, and Site Planning Standards. IV-3 Chapter 26. Comprehensive Zoning Ordinance Sec. 26.4.1-3. Uses That May Be Permitted by Conditional Use Permit. Uses that are not specifically permitted pursuant to Section 26.4.1-2, “Use Permitted of Right,” and are not specifically prohibited by Section 26.4.1-1, “Purpose and Intent,” or Section 26.4.1-5, “Uses That Are Prohibited or Limited,” or Section 26.4.1-6, “Uses That May Constitute Legal Nonconforming Use” may be permitted in the I Zone only with a Conditional Use Permit. Without limiting the generality of the foregoing, the following uses require a Conditional Use Permit: (a)Refineries. (b)Generating facilities, power plants, cogeneration facilities. (c)Trash to Energy Facilities. (d)Petroleum Related Uses, Petroleum Storage Facilities. (e)Recycling Facilities. (f)Trade Schools. (g)Public Utilities. Sec. 26.4.1-4. Uses That May Be Permitted by Minor Conditional Use Permit. The uses set forth in this Section 26.4.1-4, may be permitted in the I Zone with a Minor Conditional Use Permit. (a)Incidental Use. Each occupant or user on the Property and each tenant in a multi- tenant Building shall be permitted to dedicate a portion of that Person’s space to an Incidental Use in connection with that Person’s Permitted Use, if a Minor Conditional Use Permit is approved and the following criteria are satisfied: (1)The Permitted Use for such Person is that Person’s majority use; (2)The Incidental Use is located upon the same Lot as that Person’s Permitted Use. (3)Incidental Use includes offices, design areas and showrooms related to the Permitted Use, but does not include the right to sell at retail. Incidental Use does not include Outdoor Storage and Activities. (4)The cumulative total area dedicated to all Incidental and Ancillary Uses (including Ancillary Retail Uses) shall not exceed fifty percent (50%) of the gross floor area occupied by a Permitted Use. (b)Ancillary Retail Use. Each occupant or user on the Property and each tenant in a multi-tenant Building shall be permitted to dedicate a portion of that Person’s space to an Ancillary Retail Use in connection with that Person’s Permitted Use, if the following criteria are satisfied: (1)The Permitted Use for such Person is that Person’s majority use; Article IV. Zones, Permitted Uses, Development Standards, and Site Planning Standards. Chapter 26. Comprehensive Zoning Ordinance IV-4 (2)The Ancillary Retail Use is located upon the same Lot as that Person’s Permitted Use and sufficient parking is provided. (3)The Ancillary Retail Use is used solely and exclusively by the Person for that Persons’ Permitted Use and the sell at retail is only for products manufactured onsite or products imported and stored in bulk as part of the Persons’ Permitted Use. (4)Ancillary Retail Use includes the right to sell at retail any day week but does not include Outdoor Storage and Activities including the outdoor display of merchandise. (5)The cumulative total area dedicated to all Ancillary Uses (including any Ancillary Retail Use) shall not exceed twenty percent (20%) of the gross floor area occupied by a Permitted Use. Sec. 26.4.1-5. Uses That Are Prohibited or Limited. (a)No Motel, Hotel, Trailer, or Trailer Park is permitted in any Zone or Overlay Zone. The provisions of this Section do not apply to portable units which (a) have been acknowledged in writing by the owner or user to be units that are to be used temporarily and solely in connection with a construction project on the same Lot by persons who have a separate existing, permanent Residence, (b) have received written approval from the Director for such temporary usage, and (c) are not used for bathing or sleeping. The provisions of this Section do not apply to Trailers used solely to move goods. (b)No Marijuana Dispensary, Store, Co-op, or Cultivation Operation is permitted in any Zone or Overlay Zone. (c)No Convention and Entertainment Venue is permitted in any Zone or Overlay Zone. Sec. 26.4.1-6. Uses That May Constitute Legal Nonconforming Use. The following uses are not permitted in any Zone or Overlay Zone, except that any such use that exists as of the effective date of this Ordinance may be maintained as a Legal Nonconforming Use, subject to the terms of Section 26.5.3, “Legal Nonconforming Status.” (a)Community Facilities (b)Bars (c)Junk or Salvage Business (d)Public Storage (including mini-storage) facilities (e)Manure Fertilizer Business (f)Contractor’s Yard Article IV. Zones, Permitted Uses, Development Standards, and Site Planning Standards. IV-5 Chapter 26. Comprehensive Zoning Ordinance (g)Residences located outside of the H Overlay Zone (h)Freight Terminals, Solid Waste Facilities, Truck Terminals, Transportation-Related Use, or Hazardous Waste Facilities located outside of the T Overlay Zone (i)Commercial or Retail Uses located outside of the C-1 or C-2 Overlay Zones (j)Slaughtering located outside of the S Overlay Zone (k)Rendering Plants located outside of the R Overlay Zone (l)Fueling Stations located outside of the C-1, C-2 ant T Overlay Zones Sec. 26.4.1-7. Development and Performance Standards. The following development and performance standards (Development Standards) apply to all Buildings, Ancillary Structures, land, uses, and businesses in the I Zone. (a)All Buildings, Ancillary Structures, land, uses, and businesses in the I Zone must comply with the following Development Standards at all times. (1)Fire, Explosion, and Environmental Hazards. All storage of, and activities involving, hazardous, flammable, or explosive materials shall be provided with adequate safety devices against the hazard of fire and explosion and with adequate fire-fighting and fire-suppression equipment and devices that meet the standards and requirements of the Vernon Fire Department, as such standards and requirements may change from time to time. The storage of or activities involving acutely hazardous materials above the exempt amount, as established by the State of California Fire Code, shall not be permitted within five hundred (500) feet of the outside property line of a school site for students grades kindergarten through twelfth (12th) grade. (2)Radioactivity and Electrical Disturbances. (i)Except with the prior approval of the City Council as to specific uses, the use of radioactive materials within any Zone or Overlay Zone shall be limited to measuring, gauging, and calibration devices, and tracer elements in X-ray and like apparatus. In no event shall radioactivity, when measured at any point along any Lot line, be in excess of two and seven-tenths (2.7) by ten (10) to the eleventh (11th) power microcuries per milliliter of air at any moment of time. (ii)Radio and television and other telecommunications transmitters shall be operated at the regularly assigned wavelengths (or within the authorized tolerances therefor) as assigned thereto by the appropriate governmental agency. All electrical and electronic devices and equipment shall be suitably wired, shielded, and controlled so that in operation they shall not, beyond any point along any Lot line, emit any electrical impulse or wave which will adversely affect the operation and control of any other electrical or electronic device or equipment. Article IV. Zones, Permitted Uses, Development Standards, and Site Planning Standards. Chapter 26. Comprehensive Zoning Ordinance IV-6 (3)Outdoor Storage and Activities. Outdoor Storage and Activities (other than off-street parking and loading, which are governed by Section 26.5.1, “Off- Street Parking and Loading Facilities”) are permitted only in compliance with the following requirements: (i)No materials or wastes may be deposited on a Lot in such form or manner that they may be transferred off the Lot by natural causes or forces. (ii)Wastes which might cause fumes or dust, which constitute a fire hazard, or which may be edible by or otherwise attractive to rodents or insects shall be stored only in closed containers in required enclosures. (iii)Outdoor Storage and Activities of all materials, products, and inoperative equipment shall be screened or otherwise hidden so as not to be visible from the Street; however, the screen shall not exceed ten (10) feet in height as measured from grade level. The screen shall be maintained in good repair. Operational equipment used in the business located on the Lot is not required to be screened. (iv)A minimum six-foot high screening wall shall be provided on the interior lot lines of any lot with outdoor storage and activities that abuts a Lot with an existing Residential Use or any Lot that is zoned for Residential Use. Screening walls shall follow the lot line of the Lot to be screened, or shall be so arranged within the boundaries of the Lot so as to substantially hide the outdoor storage and activities from adjoining residential properties. (v)No Outdoor Storage and Activities are permitted on any area of a Lot that is required to be available for fire department access, as such access requirements are set forth in the Code. (vi)Outdoor Storage and Activities, including operational equipment used in the business located on the Lot, shall not occur if such usage would result in a reduction or elimination of the parking, loading, or maneuvering required for the Permitted Use located on the property unless approved by the Director pursuant to Section 26.5.1-6(q), “Reduction in Required Parking Spaces.” Outdoor Storage and Activities existing on the effective date of this Ordinance that violate these provisions may be continued as a legally nonconforming usage for the period described in Section 26.5.3-2(e). (4)Weed and Debris Abatement. All landscaped areas (on the Property, as well as contiguous planted areas within the public Right-of-way) shall be kept free from weeds, overgrown grass and shrubbery, and debris. Any diseased, dead, damaged, or decaying plant materials shall be removed. Article IV. Zones, Permitted Uses, Development Standards, and Site Planning Standards. IV-7 Chapter 26. Comprehensive Zoning Ordinance (5)No Vehicular Encroachment. No vehicle (including a truck trailer) when parked or stopped on a Lot shall extend into the Right-of-way. (b)All Buildings, Ancillary Structures, land, and businesses in the I Zone must comply with the following Development Standards upon a Change of Use or upon the occurrence of an event described in Table 26.5.3-3 Right to Continue Nonconforming Uses and Buildings that requires compliance with the Development Standards. (1)Vibration. Upon a Change of Use or the occurrence of an event described in Table 26.5.3-3 Right to Continue Nonconforming Uses and Buildings that requires compliance with the Development Standards, all of the businesses located on the Lot shall be operated so that, cumulatively with existing Vibrations of all new and existing equipment of all businesses on the Lot, the steady ground Vibration inherently and recurrently generated shall not exceed four hundredths of one inch (0.04) per second particle velocity when measured at any point along the Lot line of the Lot on which the source of the Vibration is located. The cumulative effect of Vibrations in excess of four hundredths (0.04) of one inch measured at any point along the Lot line on which the source of the Vibration is located shall be permitted only with a Conditional Use Permit. (2)Noise. Upon a Change of Use or the occurrence of an event described in Table 26.5.3-3 Right to Continue Nonconforming Uses and Buildings that requires compliance with the Development Standards, all of the businesses located on the Lot shall be operated in compliance with the following noise standards. (i)The following noise standards, unless otherwise specifically indicated, shall apply to all Lots within the designated noise zones, measured cumulatively with existing noise from all businesses on the Lot. Table 26.4.1-7(b)(2) Noise Standards Noise Zone Time Interval Allowable Exterior Noise Lots located within one tenth (1/10) of a mile of any residence or school located in Vernon or abutting communities. 10:00 P.M. to 7:00 A.M. 7:00 A.M. to 10:00 P.M. 60 dBA 65 dBA All other Lots Any time 75 dBA (ii)No Person, in any location within the City, shall create any noise, or allow the creation of noise, on any Lot owned, leased, occupied or otherwise controlled by such Person which causes the cumulative noise level when measured at any point along the Lot line of the Lot on which the source of the noise is located to exceed: Article IV. Zones, Permitted Uses, Development Standards, and Site Planning Standards. Chapter 26. Comprehensive Zoning Ordinance IV-8 (A)The applicable noise standard for a cumulative period of more than thirty (30) minutes in any hour; or (B)The applicable noise standard plus five (5) dBA for a cumulative period of more than fifteen (15) minutes in any one hour; or (C)The applicable noise standard plus ten (10) dBA for a cumulative period of more than five (5) minutes in any hour; or (D)The applicable noise standard plus fifteen (15) dBA for a cumulative period of more than one (1) minute in any hour; or (iii)In the event the ambient noise level exceeds any of the noise limit categories set forth in subsections (A), (B), or (C) of subsection 2(ii) of this Section, the cumulative period applicable to such category shall be increased to reflect the ambient noise level, plus 5 dBA. (iv)If a Lot is located on a boundary between two (2) different noise zones, the noise level standard applicable to the quieter noise zone shall apply. (v)If the noise source is continuous and cannot reasonably be discontinued or stopped for a time period whereby the ambient noise level can be determined, the measured noise level obtained while the source is in operation shall be compared directly to the Lot’s designated noise zone for the time of day the noise level is measured. (vi)Any noise source in excess of the standards set forth herein shall be permitted only with a Conditional Use Permit. (3)Water Usage. No Person shall increase water demand and usage associated with any Property by more than five hundred (500) acre-feet from the prior calendar year except with a Conditional Use Permit. Sec. 26.4.1-8. Site Planning Standards. The following Site Planning Standards shall apply to all Buildings, Ancillary Structures, land, uses, and businesses in the I Zone. Legal Nonconforming Uses and Legal Nonconforming Buildings or Standards are required to comply with the Site Planning Standards at the time of the occurrence of an event described in Table 26.5.3-3 Right to Continue Nonconforming Uses and Buildings that requires compliance with the Site Planning Standards. (a)Building Intensity. The total gross Floor Area of all Buildings on any Lot shall not exceed a Floor Area Ratio (FAR) of 2:1. (b)Off-Street Parking and Loading. Off-street parking and loading facilities shall be provided in accordance with the provisions of Section 26.5.1, “Off-Street Parking and Loading Facilities.” (c)Building Setback. Every Building or Structure shall be set back not less than fifteen (15) feet from the curb face, as shown on the Master Plan of Streets. The Director Article IV. Zones, Permitted Uses, Development Standards, and Site Planning Standards. IV-9 Chapter 26. Comprehensive Zoning Ordinance shall designate the distance from the center of the Street in any case in which the planned future ultimate width of a Street is not specified or a Street is not symmetrical. (d)Ancillary Structure Setback. Where a Lot or parcel of land in any Zone or Overlay Zone abuts a Street as shown on the Master Plan of Streets, every Ancillary Structure on such Lot or parcel shall be set back as follows: (1) if the Ancillary Structure is equal to or greater than twenty (20) feet in height, it shall be set back not less than fifteen (15) feet from the curb face, as shown on the Master Plan of Streets; and (2) if the Ancillary Structure is less than twenty (20) feet in height, it shall be set back not less than to the ultimate planned right of way width of the street as shown on the Master Plan of the Streets, except in no case shall the structure be set back less than eight (8) feet from the curb face, as shown on the Master Plan of Streets. The Director shall designate the distance from the center of the Street to the curb face in any case in which the Master Plan of Streets does not specify a planned future ultimate width from curb to curb or a Street is not symmetrical. (e)No Encroachment. Except as otherwise provided in Chapter 22 Streets and Sidewalks Article VI Encroachments Section 22.32 Encroachment to be authorized by license before issuance of permit; exceptions of the Code, no Building or Ancillary Structure shall encroach into the planned future ultimate width of a Street. (f)Barriers. Where parking, loading, or maneuvering areas adjoin a Street or Streets, a twelve (12) gauge wrought iron fence not less than eight (8) feet in height, a masonry or concrete wall not less than thirty (30”) inches in height, or a landscaped area a minimum of four (4) feet in width measured from the property line, or an equivalent protective device as approved by the Director, shall be established along such full frontage, except at driveways, walkways, or other openings where such are necessary. Where a barrier or a landscaped area adjoins a driveway, a ten-inch (10”) concrete- filled steel pipe or equivalent protective device shall be installed on driveways used for trucks, and an eight inch (8”) concrete filled steel pipe or equivalent protective device shall be installed on driveways used exclusively by automobiles. (g)Minimum Lot Size. Except in the C-1 and C-2 Overlay Zones, no new Lot shall be established for any use in the I Zone unless the Lot is at least one acre in size and complies with Code Section 28.28, “Lots to Conform to Minimum Requirements.” (h)Trash Enclosures. All trash disposal areas shall be enclosed on three (3) sides, shall have two (2) block walls and one (1) lockable gate. The gate’s overall height shall be a minimum of six (6) feet; its overall width shall be a minimum of eight (8) feet. All block walls shall be a minimum six (6) feet tall. Sec. 26.4.2. Commercial-1 (C-1) Overlay Zone. Sec. 26.4.2-1. Purpose and Intent. The purpose of the Commercial-1 (C-1) Overlay Zone is to accommodate at limited and specific areas of the City those business uses that complement and do not detract from the purposely established industrial character of the City. The C-1 Overlay Zone is intended to provide areas for the development of mercantile facilities, including Commercial Uses, Retail Uses, Offices, services, and business operations that would serve existing businesses and Article IV. Zones, Permitted Uses, Development Standards, and Site Planning Standards. Chapter 26. Comprehensive Zoning Ordinance IV-10 surrounding uses by improving access to a greater range of facilities and services. The regulation of uses and establishment of Development Standards and Site Planning Standards set forth in the C-1 Overlay Zone are those deemed necessary to promote the orderly operation and efficient functioning of the City. Sec. 26.4.2-2. Uses Permitted of Right in the C-1 Overlay Zone. Uses permitted of right in the I Zone are permitted of right in the C-1 Overlay Zone. Sec. 26.4.2-3. Uses That May Be Permitted by Conditional Use Permit in the C-1 Overlay Zone. Uses permitted in the I Zone with a Conditional Use Permit may be permitted in the C-1 Overlay Zone subject to a Conditional Use Permit. Sec. 26.4.2-4. Uses That May Be Permitted by Minor Conditional Use Permit. The uses set forth in this Section 26.4.2-4, “Uses That May Be Permitted by Minor Conditional Use Permit,” may be permitted in the C-1 Overlay Zone with a Minor Conditional Use Permit. (a)Commercial or Retail Uses. (b)Fueling stations. (c)Incidental Use, including the right to sell at retail, and Ancillary Retail Use. (d)Uses permitted with a Minor Conditional Use Permit in the I Zone. Sec. 26.4.2-5. Development Standards and Site Planning Standards in the C-1 Overlay Zone. (a)The Development Standards of Section 26.4.1-7, “Development and Performance Standards,” Table 26.4.107(b)(2), “Noise Standards,” and Section 26.4.1-8, “Site Planning Standards,” shall apply to all newly constructed Buildings and Ancillary Structures, land, and uses in the C-1 Overlay Zone. (b)New uses in existing Buildings in the C-1 Overlay Zone shall be required to comply with the Development Standards of Section 26.4.1-7, “Development and Performance Standards.” No new Lot shall be established for any use in the C-1 Overlay Zone unless the Lot is at least twenty-five thousand (25,000) square feet in size and complies with Code Section 28.28, “Lots to Conform to Minimum Requirements”. (c)All parcels and Lots located in the C-1 Overlay Zone shall dedicate a minimum of five percent (5%) of the gross square footage of the Lot to irrigated Landscaping that is visible from the Street. (d)The City Council may impose as part of the Conditional Use Permit, or the Director may impose as part of the Minor Conditional Use Permit, any other requirements as are reasonably necessary to protect nearby owners and occupants from traffic, noise, odor, dust, and similar concerns. Article IV. Zones, Permitted Uses, Development Standards, and Site Planning Standards. IV-11 Chapter 26. Comprehensive Zoning Ordinance Sec. 26.4.3. Commercial-2 (C-2) Overlay Zone. Sec. 26.4.3-1. Purpose and Intent. The purpose of the Commercial-2 (C-2) Overlay Zone is to accommodate at limited and specific areas of the City those uses that may ordinarily conflict with the purposely established industrial character of the City. The C-2 Overlay Zone is intended to provide areas for the development of commercial and retail facilities, including Commercial Uses, Retail Uses, Offices, services, and business operations, at locations where such commercial and retail facilities would complement and serve existing business and surrounding uses by improving access to a greater range of facilities and services. The C-2 Overlay Zone is intended to accommodate a higher level of intensity of uses than the C-1 Overlay Zone. The regulations for the C-2 Overlay Zone are those deemed necessary to promote the orderly operation and efficient functioning of the City. Sec. 26.4.3-2. Uses Permitted of Right in the C-2 Zone. The following uses of Buildings and land are permitted of right in the C-2 Zone. (a)Uses permitted of right in the I Zone.. (b)Commercial or Retail Uses whose purpose is engaging in business associated with First Amendment Protected Uses. Sec. 26.4.3-3. Uses That May Be Permitted by Conditional Use Permit in the C-2 Zone. Uses permitted in the I Zone with a Conditional Use Permit may be permitted in the C-2 Overlay Zone subject to a Conditional Use Permit. Sec. 26.4.3-4. Uses That May Be Permitted by Minor Conditional Use Permit. The uses set forth in this Section 26.4.3-4, “Uses That May Be Permitted by Minor Conditional use Permit,” may be permitted in the C-2 Overlay Zone only with a Minor Conditional Use Permit. (a)Commercial or Retail Uses. (b)Fueling Stations. (c)Incidental Use, including the right to sell at retail, and Ancillary Retail Use. (d)Religious Uses. (e)Uses permitted with a Minor Conditional Use Permit in the I Zone. Sec. 26.4.3-5. Development Standards and Site Planning Standards. (a)Sections 26.4.1-7, “Development and Performance Standards,” and 26.4.1-8, “Site Planning Standards,” shall apply to all newly constructed Buildings and Ancillary Structures, land, and uses in the C-2 Overlay Zone. (b)No new Lot shall be established or approved for any use in the C-2 Overlay Zone unless the Lot is at least twenty-five thousand (25,000) square feet in size and complies with Code Section 28.28. Article IV. Zones, Permitted Uses, Development Standards, and Site Planning Standards. Chapter 26. Comprehensive Zoning Ordinance IV-12 (c)All parcels and Lots located in the C-2 Overlay Zone shall dedicate a minimum of five percent (5%) of the gross square footage of the Lot to irrigated Landscaping that is visible from the Street. (d)The City Council may impose as part of the Conditional Use Permit, or the Director may impose as part of the Minor Conditional Use Permit, any other requirements as are reasonably necessary to protect nearby owners and occupants from traffic, noise, odor, dust, and similar concerns. (e)New uses in existing Buildings in the C-2 Overlay Zone shall be required to comply with Section 26.4.1-7, “Development and Performance Standards.” Sec. 26.4.4. Slaughtering (S) Overlay Zone. Sec. 26.4.4-1. Purpose and Intent. The purpose of the Slaughtering (S) Overlay Zone is to permit the Slaughtering of animals at limited and specific locations, with such land use controls as will adequately accommodate such specialized operations and will minimize traffic, noise, vibration, dust, odors, smoke, or risk of disease that is obnoxious to or interferes with the operation of other uses in the I Zone and the other Overlay Zones. The provisions of this S Overlay Zone are intended to ensure that the City will function safely and efficiently and provide an attractive industrial environment. Sec. 26.4.4-2. Uses Permitted of Right in the S Overlay Zone. Uses permitted of right in the I Zone are permitted of right in the S Overlay Zone. Sec. 26.4.4-3. Uses That May Be Permitted by Conditional Use Permit in the S Overlay Zone. The uses set forth in this Section 26.4.4-3, “Uses That May Be Permitted by Conditional Use Permit,” may be permitted in the S Overlay Zone only with a Conditional Use Permit. (a)All uses permitted in the I Zone with a Conditional Use Permit are also permitted in the S Overlay Zone with a Conditional Use Permit. (b)Lots encompassing one acre or more of area may be used for the slaughtering of animals. Sec. 26.4.4-4. Development Standards and Site Planning Standards in the S Overlay Zone. (a)The Development Standards of Section 26.4.1-7, “Development and Performance Standards,” and the Site Planning Standards of Section 26.4.1-8, “Site Planning Standards,” shall apply to all newly constructed Buildings, Ancillary Structures, land, and uses in the S Overlay Zone. (b)New uses in existing Buildings in the S Overlay Zone shall be required to comply with the Development Standards of Section 26.4.1-7, “Development and Performance Standards.” (c)The City Council may impose as a part of the Conditional Use Permit any other requirements as are necessary to protect nearby owners and occupants from the traffic, noise, odor, dust, vibration, risk of infection or disease, and similar concerns. Article IV. Zones, Permitted Uses, Development Standards, and Site Planning Standards. IV-13 Chapter 26. Comprehensive Zoning Ordinance Sec. 26.4.5. Rendering (R) Overlay Zone. Sec. 26.4.5-1. Purpose and Intent. The purpose of the Rendering (R) Overlay Zone is to allow for Rendering Plants at limited and specific locations, with such land use controls as will adequately accommodate their specialized operations and will minimize traffic, noise, vibration, dust, odors, smoke, or risk of disease that is obnoxious to or interferes with the operation of other uses in the I Zone and the other Overlay Zones. The provisions of the R Overlay Zone are intended to ensure that the City will function safely and efficiently and provide an attractive industrial environment. Sec. 26.4.5-2. Uses Permitted of Right in the R Overlay Zone. Uses permitted of right in the I Zone are permitted of right in the R Overlay Zone. Sec. 26.4.5-3. Uses That May Be Permitted by Conditional Use Permit in the R Overlay Zone. The uses set forth in this Section 26.4.5-3, “Uses That May Be Permitted by Conditional Use Permit,” may be permitted in the R Overlay Zone only with a Conditional Use Permit. (a)All uses permitted in the I Zone with a Conditional Use Permit are also permitted in the R Overlay Zone with a Conditional Use Permit. (b)Lots encompassing one acre or more of area may be used for a Rendering Plant. Sec. 26.4.5-4. Development Standards and Site Planning Standards in the R Overlay Zone. (a)The Development Standards of Section 26.4.1-7, “Development and Performance Standards,” and the Site Planning Standards of Section 26.4.1-8, “Site Planning Standards,” shall apply to all newly constructed Buildings, Ancillary Structures, land, and uses in the R Overlay Zone. (b)New uses in existing Buildings in the R Overlay Zone shall be required to comply with the Development Standards of Section 26.4.1-7, “Development and Performance Standards.” (c)The City Council may impose as a part of the Conditional Use Permit any other requirements as are necessary to protect nearby owners and occupants from the traffic, noise, odor, dust, vibration, risk of infection or disease, and similar concerns. Sec. 26.4.6. Housing (H) Overlay Zone. Sec. 26.4.6-1. Purpose and Intent. The purpose of the Housing (H) Overlay Zone is to accommodate housing at limited and specific areas of the City pursuant to General Plan policy, and to locate such housing in a manner that minimizes potential conflicts between residential and industrial uses. The regulation of uses and establishment of Standards and Findings set forth in the H Overlay Zone are those deemed necessary to promote health and safety of residents and businesses, and the orderly operation and efficient functioning of the City. Given the industrial nature of Vernon, this Section 26.4.6, “Housing (H) Overlay Zone,” establishes a Development Agreement as the entitlement process for establishing any new Residential Use in the H Overlay Zone. A Development Agreement will allow tailored development standards to be applied to proposed residential projects, thereby providing flexibility in responding to the unique land use conditions in Vernon. Article IV. Zones, Permitted Uses, Development Standards, and Site Planning Standards. Chapter 26. Comprehensive Zoning Ordinance IV-14 Sec. 26.4.6-2. Uses Permitted of Right in the H Overlay Zone. Uses permitted of right in the I Zone are permitted of right in the H Overlay Zone. Sec. 26.4.6-3. Uses That May Be Permitted by Conditional Use Permit in the H Overlay Zone. All uses permitted in the I Zone with a Conditional Use Permit are also permitted in the H Overlay Zone with a Conditional Use Permit. Sec. 26.4.6-4. Uses That May Be Permitted by Development Agreement in the H Overlay Zone. Residential Uses, including single-family housing, multi-family housing, supportive housing, transitional housing, and other similar forms of housing are permitted in the H Overlay Zone with a Development Agreement. Sec. 26.4.6-5. Development Standards and Site Planning Standards in the H Overlay Zone. (a)For any nonresidential Permitted Use in the H Overlay Zone, the Development Standards of Section 26.4.1-7, “Development and Performance Standards,” and the Site Planning Standards of Section 26.4.1-8, “Site Planning Standards,” shall apply to all Buildings, Ancillary Structures, land, and uses. (b)For any proposed Residential Use in the H Overlay Zone, the approved Development Agreement specific to that Residential Use shall define the Development Standards and Site Planning Standards that apply to all Buildings, Ancillary Structures, land, and uses associated with that Residential Use. Where the approved Development Agreement is silent with regard to any Development Standard or Site Planning Standard required by this Chapter, the provisions of the underlying zone shall apply. (c)The City Council may impose as a part of the Development Agreement any other requirements as are necessary to protect occupants of the development and/or nearby owners and occupants from the impacts associated with traffic, air pollutants, noise, odor, dust, vibration, risk of infection or disease, and similar concerns. Sec. 26.4.6-6. Findings. After a public hearing, the City Council shall approve a proposed residential development and related Development Agreement only after first making all of the following findings: (a)The design, location, size, and operating characteristics of the proposed residential development will be compatible with the existing land uses in the vicinity; (b)The proposed density is consistent with density standards and all applicable policies contained in the General Plan; (c)The site and site plan are physically suitable in terms of design, location, shape, size, and the provision of public and emergency vehicle access, and public services and utilities, including but not limited to fire protection, police protection, potable water, schools, sewerage, solid waste collection and disposal, storm drainage, and wastewater collection, treatment, and disposal; (d)On-site traffic circulation for pedestrians and vehicles is designed into the development to allow residents to move easily through the development and to avoid pedestrian/vehicular conflicts and further, to ensure appropriate access for fire and Article IV. Zones, Permitted Uses, Development Standards, and Site Planning Standards. IV-15 Chapter 26. Comprehensive Zoning Ordinance police response and surveillance equal to or better than what would normally be created by compliance with the Site Planning Standards of Section 26.4.1-8, “Site Planning Standards”; (e)The proposed project provides suitable, usable common and/or private open space that will meet the passive and/or active recreation needs of the resident. Common open space areas and setbacks are provided with landscaping and other improvements suitable for the development proposed; (f)The proposed project provides adequate parking to meet the residents’ needs, to avoid parking impacts on surrounding properties, and to comply with state and federal law; and (g)Refuse/recycling collection areas are located to provide easy access to for all residents and collection vehicles, and to minimize noise impacts on residents. Sec. 26.4.7. Truck and Freight Terminal (T) Overlay Zone. Sec. 26.4.7-1. Purpose and Intent. The purpose of the Truck and Freight Terminal (T) Overlay Zone is to permit Truck Terminals, Freight Terminals, Solid Waste, and Hazardous Waste Facilities at limited and specific locations with such land use controls as will adequately accommodate their specialized operations and will minimize traffic, noise, vibration, dust, or odors that are obnoxious to or interfere with the operation of other uses in the I Zone and the other Overlay Zones. The provisions of this T Overlay Zone are intended to ensure that the City will function safely and efficiently and provide an attractive industrial environment. Sec. 26.4.7-2. Uses Permitted of Right in the T Overlay Zone. Uses permitted of right in the I Zone are permitted of right in the T Overlay Zone. Sec. 26.4.7-3. Uses That May Be Permitted by Conditional Use Permit in the T Overlay Zone. The uses set forth in this Section 26.4.7-3 may be permitted in the T Overlay Zone only with a Conditional Use Permit. (a)All uses permitted in the I Zone with a Conditional Use Permit are also permitted in the T Overlay Zone with a Conditional Use Permit. (b)Hazardous Waste Facilities. (c)Solid Waste Facilities. (d)Fueling stations. (e)Lots encompassing two (2) acres or more of area may be used for a Freight Terminal, Truck Terminal or Transportation Related Use. Sec. 26.4.7-4. Development Standards and Site Planning Standards in the T Overlay Zone. (a)The Development Standards of Section 26.4.1-7, “Development and Performance Standards,” and the Site Planning Standards of Section 26.4.1-8, “Site Planning Article IV. Zones, Permitted Uses, Development Standards, and Site Planning Standards. Chapter 26. Comprehensive Zoning Ordinance IV-16 Standards” shall apply to all newly constructed Buildings, Ancillary Structures, land, and uses in the T Overlay Zone. (b)New uses in existing Buildings in the T Overlay Zone shall be required to comply with the Development Standards of Section 26.4.1-7, “Development and Performance Standards.” (c)The City Council may impose as a part of the Conditional Use Permit any other requirements as are necessary to protect nearby owners and occupants from the traffic, air pollutants, noise, odor, dust, vibration, risk of infection or disease, and similar concerns. Sec. 26.4.8. Emergency Shelter (E) Overlay Zone. Sec. 26.4.8-1. Purpose and Intent. The purpose of the Emergency Shelter (E) Overlay Zone is to comply with Government Code Sections 65582, 65583(a) and 65589.5, which require all California cities to permit emergency (homeless) shelters as a matter of right in at least one zone. The purpose of regulating the siting of emergency shelters is to ensure emergency shelters are developed in a manner which protects the health, safety, and general welfare of nearby residents and businesses while providing for the housing needs of the homeless. Sec. 26.4.8-2. Uses Permitted of Right. Uses permitted of right in the I Zone are permitted of right in the E Overlay Zone, and all such uses shall be subject to the Development Standards of Section 26.4.1-7, “Development and Performance Standards,” and the Site Planning Standards of Section 26.4.1-8, “Site Planning Standards.” Emergency shelters are permitted of right in the E Overlay Zone. Emergency shelters developed within the E Overlay Zone shall be subject to the Development Standards of Section 26.4.8-4, “Development and Site Planning Standards for Emergency Shelters.” Sec. 26.4.8-3. Uses That May Be Permitted by Conditional Use Permit. (a)All uses permitted in the I Zone with a Conditional Use Permit are also permitted in the E Overlay Zone with a Conditional Use Permit and shall be subject to the Development Standards of Section 26.4.1-7, “Development and Performance Standards,” and the Site Planning Standards of Section 26.4.1-8, “Site Planning Standards.” (b)The City Council may impose as a part of the Conditional Use Permit any other requirements as are necessary to protect nearby owners and occupants from the traffic, air pollutants, noise, odor, dust, vibration, risk of infection or disease, and similar concerns. Sec. 26.4.8-4. Development and Site Planning Standards for Emergency Shelters. (a)The emergency shelter shall contain a maximum of ten (10) beds and shall serve no more than ten (10) homeless persons at any one time. (b)Occupancy by an individual or family may not exceed one hundred eighty (180) consecutive days unless the management plan provides for longer residency by those enrolled and regularly participating in a training or rehabilitation program. Article IV. Zones, Permitted Uses, Development Standards, and Site Planning Standards. IV-17 Chapter 26. Comprehensive Zoning Ordinance (c)A minimum distance of three hundred (300) feet shall be maintained from any other Emergency Shelter, as measured from the property line. (d)Adequate external lighting shall be provided for security purposes. The lighting shall be stationary and directed away from adjacent properties and public rights-of-way. The intensity shall comply with standard City performance standards for outdoor lighting. (e)A Security and Safety Plan shall be provided for the review and approval of the Director. The plan may be required to address additional security and safety needs as identified by the Director. The approved Security and Safety Plan shall remain active throughout the life of the facility. The plan shall contain provisions addressing the following topical areas: sleeping areas, loitering control, management of outdoor areas, alcohol and illegal drugs, and current contact information for the operator of the facility during day and nighttime hours. (f)The facility may provide the following services in designated areas separate from sleeping areas: recreation area, counseling center, laundry, kitchen, dining hall, and client storage areas. Article IV. Zones, Permitted Uses, Development Standards, and Site Planning Standards. Chapter 26. Comprehensive Zoning Ordinance IV-18 Article V. Regulations Applicable to the I Zone and Overlay Zones. V-1 Chapter 26. Comprehensive Zoning Ordinance Article V. Regulations Applicable to the I Zone and Overlay Zones. V Sec. 26.5.1. Off-Street Parking and Loading Facilities. Sec. 26.5.1-1. Interpretation. The provisions of this Section 26.5.1, “Off-Street Parking and Loading Facilities,” establish minimum requirements for the promotion of the public health, safety, comfort, convenience, and general welfare, and shall not be deemed or construed to prohibit the City Council, in granting or approving a Conditional Use Permit, Variance, or Development Agreement from requiring additional parking or loading facilities for a particular use. Sec. 26.5.1-2. Consideration of Fractional Remainders. Where calculation of the number of spaces required results in a fractional number, any fraction shall be rounded to the next higher whole number. Sec. 26.5.1-3. Parking in Buildings. Where required parking or Loading Space computations are based on Floor Area, floor space devoted to parking or loading within a Building shall not be included in the Floor Area portion of the computation. Sec. 26.5.1-4. Multiple Uses. In the case of mixed uses in a Building or on a Lot, the total required number of off-street parking and loading spaces and maneuvering capacity shall be the sum of the requirements for the various uses. Sec. 26.5.1-5. No Loss of Minimum Required Space or Maneuvering Capacity. Existing parking, maneuvering, and loading facilities on a Lot or parcel may not be reduced or removed below the required minimum (or below the now existing number of spaces or maneuvering capacity, if the existing number of spaces or maneuvering capacity is below the required minimum) unless substitute spaces or maneuvering capacity are provided. Sec. 26.5.1-6. Parking, Maneuvering, and Loading Development Standards. (a) General. Parking, maneuvering, and loading capacities for any Building shall comply with the minimum standards set forth in this Section 26.5.1, “Off-Street Parking and Loading Facilities,” except that existing parking, maneuvering, and loading capacities are not required to be brought into compliance with these standards until the occurrence of an event described in Table 26.5.3-3, “Right to Continue Nonconforming Uses.” If a use requires a Conditional Use Permit, the Director shall recommend the minimum number of Parking Spaces and the minimum loading and maneuvering requirements for the requested use during the Conditional Use Permit process, based on the information and analysis provided as part of the Conditional Use Permit application process. The Director shall notify the City Council of the recommendation. With the concurrence of the City Council, the Director of Public Works, Water, and Development Services shall utilize the recommended minimum parking and loading and maneuvering requirements as the standard for that and similar uses. Such determination of required number of Parking Spaces and loading and maneuvering requirements shall be recorded as specified in Section 26.6.7, “Interpretations, Minor Exceptions, and Appeals.” Article V. Regulations Applicable to the I Zone and Overlay Zones. Chapter 26. Comprehensive Zoning Ordinance V-2 If a use requires a Minor Conditional Use Permit, the Director shall approve and develop the standard for the minimum number of Parking Spaces and the minimum loading and maneuvering requirements for the requested use during the Minor Conditional Use Permit process, based on the information and analysis provided as part of the Minor Conditional Use Permit application process. Such determination of required number of Parking Spaces and loading and maneuvering requirements shall be recorded as specified in Section 26.6.7, “Interpretations, Minor Exceptions, and Appeals.” (b) Minimum Automobile Parking Requirements. Adequate off-street parking, loading, and maneuvering space shall be provided for each use or development on a Lot, or for each Building on a Lot, to accommodate all automobiles or similar vehicles of the employees, consultants, agents, buyers, vendors, salesmen, visitors, and other persons normally transacting business at such enterprise or Building. Table 26.5.1-6(b) Minimum Number of Required Automobile Parking Spaces sets forth the minimum number of required automobile Parking Spaces. If more than one land use is located on a site, including Ancillary or Incidental Uses, the number of required off-street Parking Spaces shall be equal to the sum of all required parking spaces prescribed for each individual Permitted Use. Table 26.5.1-6(b) Minimum Number of Required Automobile Parking Spaces (1) Use Type Required Spaces Industrial Use, Industrial Gas Manufacturing, and Recycling Facility One (1) space per 1,000 square feet of gross Floor Area Commercial Uses One (1) space per 250 square feet of gross Floor Area Data Centers One (1) space per 1,250 square feet of gross Floor Area Emergency Shelter One (1) space for each five (5) beds plus two (2) additional spaces. Health Clubs (gyms) One (1) space per 200 square feet of gross Floor Area Religious Uses One (1) space for each three (3) fixed seats, or where no fixed seats are provided, one (1) space for every 35 gross square feet of gross Floor Area Residential Uses Parking Determined Pursuant to Development Agreement, but no less than one (1) space for each unit. Article V. Regulations Applicable to the I Zone and Overlay Zones. V-3 Chapter 26. Comprehensive Zoning Ordinance Restaurant (Take out) Eight (8) spaces per 1,000 square feet of gross Floor Area Restaurant (Sit down) One (1) space per 100 square feet of gross Floor Area Retail (less than 25,000 square feet) and multiple tenant Retail One (1) space per 250 square feet of gross Floor Area Retail (25,000 square feet or greater) - Single tenant only One (1) space per 250 square feet for the first 25,000 square feet of gross Floor Area and then one (1) space per each additional 500 square feet of gross Floor Area Studios (dance, etc.) One (1) space per 200 square feet of gross Floor Area Trade Schools One (1) space per 50 square feet of gross Floor Area Truck Terminals and Freight Terminals Parking shall be provided as determined by a parking study prepared for the specific use. Warehouse Use, General One (1) space per 1,000 square feet of gross Floor Area Warehouse Use, Cold Storage One (1) space per 1,000 square feet of gross Floor Area for the first 50,000 square feet, and one (1) space per 5,000 square feet of gross Floor Area above 50,000 square feet Note (1) Through the Conditional Use Permit and Minor Conditional Use Permit processes, the City may require additional parking for a specific use or application. (c) Minimum Truck Loading Requirements. All Buildings and uses, except for Commercial Uses, Retail Uses, Residential Uses, and Emergency Shelters, shall provide adequate off-street Loading Spaces and areas to accommodate trucks being loaded, unloaded, or waiting to be loaded or unloaded in accordance with the following standards. Truck Loading Spaces in excess of the required number may be counted as required Parking Spaces. Table 26.5.1-6(c) Minimum Required Truck Loading Spaces sets forth the minimum truck loading spaces. Article V. Regulations Applicable to the I Zone and Overlay Zones. Chapter 26. Comprehensive Zoning Ordinance V-4 Table 26.5.1-6(c) Minimum Required Truck Loading Spaces Use Type Required Spaces Industrial Use, Warehouse Use, Industrial Gas Manufacturing One (1) space per 10,000 square feet of gross Floor Area Cold Storage Warehouses One (1) space per 7,500 square feet of gross floor area Data Centers One (1) space per 50,000 square feet of gross floor area Commercial Use and Retail Use Loading shall be provided as determined by a parking study prepared for the specific use. (d) Minimum Truck Parking Requirements. All Buildings and uses, except for Commercial Uses, Retail Uses, Residential Uses, and Emergency Shelters, shall provide adequate Parking Spaces for all trucks, regardless of size. Table 26.5.1-6(d) Minimum Required Truck Parking Spaces sets forth the minimum number of required truck Parking Spaces. Table 26.5.1-6(d) Minimum Required Truck Parking Spaces Use Type Required Spaces Industrial Use, Cold Storage Warehouses, Warehouse Use, Industrial Gas Manufacturing One (1) space per 25,000 square feet of gross Floor Area for the first 100,000 square feet and one (1) space per 100,000 square feet of gross Floor Area above 100,000 square feet (e)Location. Required parking facilities may be located on the Lot as the use or Occupancy for which the parking is being provided or may be provided on a separate Lot. If provided on a separate Lot, a covenant shall be recorded restricting all or a portion of the use of the separate Lot to parking use for the benefit of the use requiring the parking, and evidence shall be filed with the City of Vernon assuring the required number of spaces on such parcel have been set aside and will be maintained for parking purposes in connection with the particular use or Occupancy requiring the parking so long as such use or Occupancy exists. The main entrance of the parking facility located on a separate Lot shall be within fifteen hundred (1,500) feet, measured along the Street from the property line of the Lot on which the parking is located to the front door of the Building in which the principal use of the Lot is conducted. (f)Parking Requirement for Spaces for the Disabled. The determination of the required number of Parking Spaces for use by the disabled shall be based on the greater of: 1) the minimum number of required automobile Parking Spaces, as set forth in Table 26.5.1-6(b) Minimum Number of Required Automobile Parking Spaces, or 2) Article V. Regulations Applicable to the I Zone and Overlay Zones. V-5 Chapter 26. Comprehensive Zoning Ordinance the actual number of Parking Spaces provided (including both on the Lot and Parking Spaces located off the Lot that are provided for the business). All Parking Spaces for the disabled shall be located on the same Lot as the use or Occupancy for which the parking is provided, and the number of spaces required and the dimensions thereof shall be provided as required by State law. (g)Size. The minimum size of all Parking and Loading Spaces shall be as set forth in Table 26.5.1-6(g) Parking and Loading Space Minimum Dimensions. Any automobile parking stall adjoining a Building or Ancillary Structure shall be provided with two (2) additional feet of width. Table 26.5.1-6(g) Parking and Loading Space Minimum Dimensions (h) Width Length Minimum Vertical Clearance Automobile Parking Space 8.5 ft. 19 ft. 7 ft. Truck Parking Space 10 ft. 75 ft. 15 ft. Truck Loading Space 10 ft. 75 ft. 15 ft. For any stand-alone parking or truck Loading Space (not adjacent to another space) 15 ft. 75 ft. 15 ft. Article V. Regulations Applicable to the I Zone and Overlay Zones. Chapter 26. Comprehensive Zoning Ordinance V-6 (i)Truck Maneuvering Space. Unobstructed truck maneuvering space shall be fifty (50) feet, as illustrated by Diagram 26.5.1-6(h) Truck Maneuvering Space. DIAGRAM 26.5.1-6(h) (j)Loading Equipment. Loading equipment may extend into the fifteen (15) foot vertical clearance area described in Section 26.5.1-6(h), “Truck Maneuvering Space,” above when required by specialized loading operations, if the Director determines such intrusion will not be contrary to the intent of this Section and approves such intrusion. (k)Parking Lot Dimensions. Minimum dimensions for required automobile parking shall be as indicated in Table 26.5.1-6(j) Parking Lot Dimensions. Parallel parking stalls located adjacent to a maneuvering or access aisle shall have minimum dimensions of 8.5 feet wide by 25 feet long. Table 26.5.1-6(j) Parking Lot Dimensions Angle (Degrees) Stall Width (Measured Perpendicularly) Aisle Width – One Way Aisle Width – Two-Way 45 20 ft. 15 ft. 20 ft. 60 21 ft. 21 ft. 21 ft. 90 19 ft. 27 ft. 27 ft. (l)Access. Easily accessible and adequate ingress and egress shall be provided to all parking and loading facilities. Sufficient driveways, maneuvering, and turn-around areas shall be provided on the Lot to allow for safe and unobstructed front entry onto Article V. Regulations Applicable to the I Zone and Overlay Zones. V-7 Chapter 26. Comprehensive Zoning Ordinance the Lot. All vehicles, including trucks, using the parking or loading facilities shall enter or leave the Street in a front forward manner without backing onto the Street or backing into the Lot. A minimum of fifty (50) feet of unobstructed maneuvering space shall be maintained for all required truck parking and Loading Spaces, as shown in Diagram 26.5.1-6(h) Truck Maneuvering Space. No maneuvering of vehicles from a parking or loading stall shall occur within twenty (20) feet of a driveway opening, as measured perpendicular to the driveway width, as shown in diagram 26.5.1-6(k) Narrowing of Drive Aisle. An aisle shall not be narrowed at a rate greater than 2 to 1 to achieve a minimum width as shown in Diagram 26.5.1-6(k) Narrowing of Drive Aisle. Minimum required aisle widths shall be as indicated in Table 26.5.1-6(k) Parking Aisle Dimensions. DIAGRAM 26.5.1-6(k) Table 26.5.1-6(k) Parking Aisle Dimensions Width Height One-way aisle 15 ft. 15 ft. Two-way aisle 20 ft. 15 ft. (m)Curb Cuts. No curb cut for a driveway or aisle or any portion providing vehicular access to the Lot shall be permitted within any portion of any curb return, nor within seventy-five (75) feet of the point of tangency of any curb return for a driveway used Article V. Regulations Applicable to the I Zone and Overlay Zones. Chapter 26. Comprehensive Zoning Ordinance V-8 by trucks, nor within forty-five (45) feet of the point of tangency of any curb return for a driveway used exclusively by automobiles, as shown in Diagram 26.5.1-6(l) Curb Cut Location. DIAGRAM 26.5.1-6(l) (n)Driveway Entrance. The minimum driveway entrance width for truck access shall be forty (40) feet, and the minimum driveway entrance width for automobile access shall be twenty-five (25) feet. All driveways shall be constructed in accordance with City standards. (o)Markings. All required parking and Loading Spaces and facilities shall be clearly and adequately marked with permanent durable and easily distinguishable materials. All one-way drives, entrances, and exits shall be clearly and permanently marked. Such signs and markings shall be maintained and shall be visible to drivers of vehicles using the parking facility. (p)Paving. All parking and loading facilities shall be paved with asphalt or concrete and shall provide for adequate drainage. Drainage to the Street shall be treated in compliance with the City’s discharge and treatment requirements prior to being released to the Street or storm drain system. (q)Maintenance. All parking and loading areas shall be kept clean and free of debris, dust, mud, and trash. Parking areas shall be used only for the purpose of parking vehicles. Where Landscaping is provided within or along any parking area, such areas shall be maintained and provided with permanent underground, automated irrigation Article V. Regulations Applicable to the I Zone and Overlay Zones. V-9 Chapter 26. Comprehensive Zoning Ordinance systems. Striping, marking, direction signs, lighting, screening and all other improvements required by this Section shall be adequately maintained. (r)Reduction in Required Parking Spaces. The required number of off-street Parking Spaces may be reduced by Outdoor Storage and Activities if a parking demand study, prepared by a California-licensed traffic engineer or other qualified professional, is completed specific to the project site and the Permitted Use, and further provided that the study finds that the project site has excess Parking Spaces beyond the Permitted Use’s need; such study must be approved by the Director. Where required off-street parking is reduced to allow for Outdoor Storage and Activities, Outdoor Storage and Activities shall only occupy surplus off-street parking in the amount indicated by the parking demand study, and only so long as the actual parking need for the Permitted Use as identified in the parking study continues to be met. No Buildings or Structures shall be constructed in the approved Outdoor Storage and Activities areas that are replacing required off-street Parking Spaces. Any approved parking reduction shall apply only to the specific Permitted Use located on the property and analyzed in the parking demand study. Any subsequent or new use or tenant on the subject property shall not be permitted to utilize the area dedicated to Outdoor Storage and Activities unless a new and project-specific parking demand study is prepared as stipulated in this Section 26.5.1-6(q), “Reduction in Required Parking Spaces,” and approved by the Director. Sec. 26.5.2. Street Dedication and Improvements. In connection with the issuance of a building or other permit, Conditional Use Permit, Minor Conditional Use Permit, Variance, or Development Agreement, the Director is authorized to require that the owner of a Lot or parcel of land that adjoins a Street dedicate a portion of the land for a Right-of-way in accordance with the planned future ultimate width of a street as shown on the Master Plan of Streets, and make or pay for related street improvements, or both. Sec. 26.5.3. Legal Nonconforming Status. Within the I Zone and Overlay Zones established by this Chapter, uses, Buildings, Ancillary Structures, and Lots may exist that do not comply with the requirements of this Chapter. Such non- compliance may include uses that are not permitted or are not permitted in a particular location, or properties that fail to comply with Development Standards or Site Planning Standards. This Section 26.5.3 permits such Legal Nonconforming Status to continue only in conformity with the terms set forth in this Section 26.5.3, “Legal Nonconforming Status,” and in Table 26.5.3-3, “Right to Continue Nonconforming Uses and Buildings”; provided, however, that nothing set forth in this Section 26.5.3, “Legal Nonconforming Status,” or in Table 26.5.3-3, “Right to Continue Nonconforming Uses and Buildings,” permits the continued violation of any Development Standard described in Section 26.4.1- 7(a) or the continued violation of any Development Standard described in Section 26.4.1-7(b) following a Change of Use. Nonconformity with Section 26.4.1-7(a) and 26.4.1-7(b) must be corrected or cease as set forth in those Sections. Other legal Nonconforming Uses and Legal Nonconforming Buildings or Standards are permitted to remain, unless and until the occurrence of one of the events set forth in Table 26.5.3-3, “Right to Continue Nonconforming Uses and Buildings,” or the expiration of the “Legal Nonconforming Building and Use” as set forth in Section 26.5.3-2. In the case of an event described in Table 26.5.3-3, “Right to Continue Nonconforming Uses and Buildings,” the Article V. Regulations Applicable to the I Zone and Overlay Zones. Chapter 26. Comprehensive Zoning Ordinance V-10 nonconforming status must comply with the requirements set forth in Table 26.5.3-3, “Right to Continue Nonconforming Uses and Buildings.” The existence of Legal Nonconforming Buildings or Standards or the existence of a Legal Nonconforming Use shall not be used as a basis or justification for adding other structures or uses prohibited elsewhere in the same Zone or Overlay Zone. Sec. 26.5.3-1. Restrictions on Nonconforming Buildings and Uses. (a)There shall be no increase in the Floor Area or square footage used for Legal Nonconforming Building or Use, except as required by a governmental agency to reduce the environmental impacts caused by the use. There shall be no increase in capacity of the use as a result of the exception above. (b)An existing Building or a portion of an existing Building containing a conforming use at the effective date of this Ordinance cannot be converted to a nonconforming use. (c)A nonconforming use shall not be converted to another nonconforming use. (d)There shall be no decrease in the parking, loading, or maneuvering capacities as they exist as of the date of this Ordinance if such decrease would either make conforming capacities non-conforming or would decrease capacities of an already non-conforming Lot, unless a parking reduction is approved pursuant to Section 26.5.1-6(q), “Reduction in Required Parking Spaces.” Sec. 26.5.3-2. Expiration of Legal Nonconforming Building and Use. (a)Compliance with the provisions set forth in Table 26.5.3-3, “Right to Continue Nonconforming Uses and Buildings,” is required if more than twenty-five percent (25%) of the Floor Area of a nonconforming Building is vacant for a continuous period of at two (2) years or more. (b)A Building or portion of a Building shall be considered vacant for purposes of this Section when the Building or portion thereof is not legally occupied and used for its Permitted Use. For these purposes, legally occupied means that the owner or occupant possesses all necessary certificates and permits from the City, including, without limitation, a Certificate of Occupancy and business license, and there is an ongoing physical use and Occupancy for the intended purpose. (c)The running of the two (2) year time limit shall not be tolled (suspended) except by the Director under the circumstances described in sections (1) through (5) below, and only if a delay in re-occupying a Building results from the following circumstances: (i) the Building is undergoing repairs or renovation, whether voluntary or as a result of Force Majeure; (ii) the owner or occupant is investigating or testing hazardous materials, or developing a remediation plan, or remediating or removing any hazardous material (as defined in federal and state laws and regulations); or (iii) the owner is denied possession of or access to the Building by an occupant or former occupant (including as a result of a court proceeding or order). The Director will not toll the two year time limit, except if one of the circumstances described in clauses (i), (ii), and (iii) of this Section is applicable, and under the following additional circumstances: Article V. Regulations Applicable to the I Zone and Overlay Zones. V-11 Chapter 26. Comprehensive Zoning Ordinance (1)Not later than sixty (60) days prior to the expiration of the two year period of vacancy, the property owner or his authorized representative must apply to the Director for an extension of the two year time limit. (2)The application shall be made on a form provided by the Director and shall contain such information as the Director deems necessary to render a determination. (3)The Director shall determine the amount of time reasonably required to complete the work, taking into account the reason for the delay, the size of the project, and the amount of time typically required for completion of similar projects. (4)The construction, renovation, or investigation and remediation must be undertaken in a continuous and diligent manner, without delays or work stoppages. (5)Upon completion of the work, the time so determined by the Director shall be subtracted from the calculation of the period of time a Building has been determined to have been vacant under paragraph (a) of this Section. (d)If an owner disputes the determination of the Director that at least 25% of the Floor Area of a nonconforming Building has been vacant for a continuous period of at least two (2) years, the owner shall have the right to appeal such decision in accordance with Section 26.6.7-5, “Appeals.” (e)Outdoor Activities and Storage that do not comply with the terms of Section 26.4.1- 7(a)(3)(v) constitute a legally nonconforming usage, and may be continued to the same degree as in existence as of the effective date of this Ordinance until January 1, 2020, but may not be increased during that period. After January 1, 2020, all Outdoor Storage and Activities (excluding operational equipment used in the business located on the Lot) whose location reduces the parking, loading, or maneuvering areas on a Lot to a number below that required pursuant to this Chapter must be removed in order to increase to the extent possible the available parking, loading, and maneuvering areas on a Lot. Alternatively, a parking waiver reduction may be requested pursuant to Section 26.5.1-6(p), “Reduction in Required Parking Spaces.” Article V. Regulations Applicable to the I Zone and Overlay Zones. Chapter 26. Comprehensive Zoning Ordinance V-12 Table 26.5.3-3 Right to Continue Nonconforming Uses and Buildings Event That Triggers Compliance Required Compliance Conformity with Use Requirement s Conformity with Development Standards and Site Planning Standards (Including Parking, Access, and Maneuvering) Conformity with the City’s Building Code and the California Building Standards Commission Over 25% of the Building is vacant for more than Two Years [subject to tolling permitted in Section 26.5.3-2(c)]. Uses within the portion of the Building that was vacant for over two years must be Permitted Uses in accordance with this Chapter. Prior to the use of the portion of the Building that was vacant for over two years, the entire Lot on which the Building is located must comply with all Development Standards and Site Planning Standards in accordance with this Chapter. Prior to the use of the portion of the Building that was vacant for over two years, the proposed use must comply with the change of use requirements of the Existing Structures Chapter of the City’s current Building Code and relevant sections of the California Building Standards Commission. Increase in the Floor Area of a Building per Section 26.5.3-1(a) that does not constitute New Construction or a Major Alteration or Repair. All uses on the Lot must be Permitted Uses, Conditionally Permitted Uses, or Temporary Permitted Uses in accordance with this Chapter. The Lot must comply with all Development Standards and Site Planning Standards in accordance with this Chapter, except that the Lot does not have to comply with the Building Setback requirements in Section 26.4.1-8(c), “Building Setback,” so long as the increase in Floor Area does not encroach into the Building Setback area. New construction must comply with the City’s current Building Code and relevant sections of the California Building Standards Commission. . Existing construction that is unreinforced masonry must comply with Article IX Existing Building Code of Chapter 24, “Building and Construction,” of the Code (concerning seismic requirements), and relevant sections of the California Building Standards Commission. IF THE ABOVE EVENT OCCURS, IT TAKES PRECEDENCE OVER ANY OTHER EVENT, AND THE NONCONFORMITY MUST CONFORM AS SET FORTH ABOVE. IF ONE OF THE FOLLOWING EVENTS OCCURS IN THE ABSENCE OF THE ABOVE DESCRIBED EVENT, THE NONCONFORMITY SHALL COMPLY WITH THE FOLLOWING PROVISIONS: Article V. Regulations Applicable to the I Zone and Overlay Zones. V-13 Chapter 26. Comprehensive Zoning Ordinance Table 26.5.3-3 Right to Continue Nonconforming Uses and Buildings Event That Triggers Compliance Required Compliance Conformity with Use Requirement s Conformity with Development Standards and Site Planning Standards (Including Parking, Access, and Maneuvering) Conformity with the City’s Building Code and the California Building Standards Commission Change of Use to a category that has greater parking, maneuvering, or loading requirement Not applicable The parking, maneuvering, and loading capacities on the Lot on which the use has changed must comply with all of the requirements of Section 26.5.1, “Off-Street Parking and Loading Facilities.” Not applicable Minor Alteration or Repair Uses permitted on the Lot on the date of the Minor Repair may continue. Not required to bring the Lot into compliance with the Development Standards or Site Planning Standards of this Ordinance New construction must comply with the City’s current Building Code and relevant section of the California Building Standards Commission. Existing construction that is unreinforced masonry must comply with Article IX Existing Building Code of Chapter 24, “Building and Construction,” of the Code (concerning seismic requirements) and relevant sections of the California Building Standards Commission New Construction or Major Alteration or Repair that is Voluntary All uses on the Lot must be Permitted Uses, Conditionally Permitted Uses, or Temporary Permitted Uses, in accordance with this Chapter. The Lot must comply with all Development Standards and Site Planning Standards in accordance with this Chapter, except that the Lot does not have to comply with the Building Setback requirements in Section 26.4.1- 8(c),“Building Setback,” so long as the New Construction does not encroach into the Building Setback area. Entire Building being constructed or altered or repaired must comply with the City’s current Building Code and relevant sections of the California Building Standards Commission Article V. Regulations Applicable to the I Zone and Overlay Zones. Chapter 26. Comprehensive Zoning Ordinance V-14 Table 26.5.3-3 Right to Continue Nonconforming Uses and Buildings Event That Triggers Compliance Required Compliance Conformity with Use Requirement s Conformity with Development Standards and Site Planning Standards (Including Parking, Access, and Maneuvering) Conformity with the City’s Building Code and the California Building Standards Commission Major Alteration or Repair that is due to Force Majeure Uses permitted on the Lot on the date of the Force Majeure Event may continue If improvements have not commenced within one (1) year of the force majeure event, the Lot must comply with all Development Standards and Site Planning Standards in accordance with this Chapter, or, if none exist for such use, then as required by a Conditional Use Permit. Further, if construction commences within one (1) year of the force majeure event, then the Building may be constructed as it existed prior to the event, except that no portion of the Building shall be constructed within any Street right-of- way as shown on the Master Plan of City Streets. Entire Building being altered or repaired must comply with the City’s current Building Code and relevant sections of the California Building Standards Commission. Article VI. Special Regulations and Procedures. VI-1 Chapter 26. Comprehensive Zoning Ordinance Article VI. Special Regulations and Procedures. VI Sec. 26.6.1. Purpose. To ensure the achievement of the goals and purposes of this Chapter without creating undue hardships, and to protect the health, safety, and public welfare, the following regulations and procedures are established for Variances, Conditional Use Permits, Minor Conditional Use Permits, Temporary Use Permits, zoning ordinance text and map amendments, interpretations and minor exceptions, Development Agreements, and Reasonable Accommodation. Sec. 26.6.2. Variances. Sec. 26.6.2-1. Justifications for Variances and Limitations on Variances. (a)Special Circumstances. Variances from the terms of this Chapter shall be granted only when, because of special circumstances applicable to a Lot, including size, shape, topography, location, surroundings, or other conditions, strict enforcement of the Development Standards or Site Planning Standards deprives such Lot of privileges enjoyed by other property in the vicinity and under the identical zoning classification. Variances are not terminated automatically upon transfer of the Lot for which they have been granted, but are subject to expiration as set forth in Section 26.6.2-8, “Time Requirements for Use of Variance,” and revocation or modification as set forth in Section 26.6.2-9, “Revocation of Variance.” If the granting or denial of a Variance is subject to CEQA, the time periods for any notice, response, or action shall comply with the time frames established by CEQA, notwithstanding any time periods set forth in this Section 26.6.2, “Variances.” (b)Conditions. Any Variance granted shall be subject to such conditions that will ensure that the authorized exception does not constitute a grant of special privileges inconsistent with the limitations imposed on other properties in the same Zone or Overlay Zone. The City Council may impose conditions on the Variance to address any pertinent factors affecting the Lot or the establishment, operation, or maintenance of any requested improvement, including, but not limited to the requirement that the applicant comply with any one or more of the following conditions: (1)Installation of buffer areas, fences, or walls; (2)Installation of parking facilities, and surfacing of parking areas and driveways; (3)Dedication of a portion of the land for a Right-of-way; (4)Making or paying for related street improvements; and (5)Implementing or using the Variance within a specified period of time. (c)Required Permitted Use. A Variance shall not be granted for a Building in which the use is not a Permitted Use. Article VI. Special Regulations and Procedures. Chapter 26. Comprehensive Zoning Ordinance VI-2 Sec. 26.6.2-2. Application and Fee. An application for a Variance shall be made by the property owner or authorized agent to the Department of Public Works, Water, and Development Services, on a form provided for that purpose by the City, and shall be accompanied by a filing fee in an amount established by resolution of the City Council. The City may retain, at the applicant’s expense, consultants to study the impacts of the proposed operation on the surrounding properties. An application for a Variance shall consist of a completed Variance Form and the following attachments: (a)A plot plan which shall show, as may be applicable to permit informed consideration of the request, the surrounding land uses; the location and dimensions of all Buildings; the location and dimensions of all off-street parking, loading, and storage facilities; the location and width of ingress and egress points to the Lot; and the location and dimensions and turning radii of all parking and loading areas. (b)A floor plan, if applicable, of the building or Buildings showing interior features affected by the requested Variance. Sec. 26.6.2-3. Notice of Public Hearing. Following presentation of a completed application to the Department of Public Works, Water, and Development Services, the City Clerk shall set the matter for public hearing to be held not less than ten (10) days or more than sixty (60) days from the date of notice. The City Clerk shall give notice thereof in the manner provided in paragraph (a) and (b). The notice shall set forth the date, time, and place of the public hearing; the identity of the hearing body or officer; a general explanation of the matter to be considered; and a general description, in text or by diagram, of the location of the Lot that is the subject of the hearing. (a)By mailing notice, containing the same information as the published or posted notice, not less than ten (10) days prior to the date of the hearing to: (1)The owners of all property within a radius of three hundred (300) feet from the Lot for which a Variance is requested, using for this purpose the last known names and addresses of such owners as are shown on the last equalized assessment roll of Los Angeles County; (2)The owner of the subject Lot or the owner’s duly authorized agent; (3)Any Person who has filed a written request for such notice with the City Clerk (in which case the City may charge a fee that is reasonably related to the costs of providing this service and may require each request to be annually renewed); (4)The project applicant; and (5)Each local agency expected to provide water, sewage, streets, schools, or other essential facilities or services to the Lot, if the ability to provide the facilities or services may be significantly affected; and (b)By publishing a notice in a newspaper designated by the City Council for that purpose. Said newspaper shall be a local newspaper if there be one; otherwise, a newspaper of general circulation covering the City of Vernon shall be designated. The notice shall be published one time at least ten (10) days prior to the date of the hearing; or by posting a notice in three of the most public places in the City of Vernon, to wit: the Article VI. Special Regulations and Procedures. VI-3 Chapter 26. Comprehensive Zoning Ordinance northwest corner of 38th Street and Santa Fe Avenue; the northeast corner of Leonis Boulevard and Pacific Boulevard; and on the bulletin board outside of the lobby of the City Hall of said City, located at 4305 Santa Fe Avenue, all in the City of Vernon, County of Los Angeles, State of California. Said notice shall be posted not less than ten (10) days before the date set for the hearing. Sec. 26.6.2-4. Public Hearing, Action of the City Council. If, from the facts presented at the public hearing or by an investigation at the instigation of the City Council, the City Council makes the findings required in Section 26.6.2-5, “Finding and Decisions by Resolution,” herein and finds that such Variance or modification thereof should be granted, the City Council may grant the requested Variance in whole, or in part, and upon such terms and conditions as the City Council may deem proper to preserve the public health, safety, convenience, and welfare and the general intent and purpose of this Chapter. The City Council shall make its decision on said application within thirty (30) days after the conclusion of any hearing held thereon, unless a waiver of this time requirement is provided by the applicant. Sec. 26.6.2-5. Variance Findings and Decision by Resolution. The City Council shall announce its findings and decision by written resolution. The resolution shall recite, among other things, the facts and reasons which, in the opinion of the City Council, make the granting or denial of the Variance necessary to carry out the provisions and general purpose of this Chapter, and shall order that the Variance be granted or denied, with such conditions as are found necessary to protect the public health, safety, and general welfare, and ensure compliance with the provisions of this Chapter. The Variance shall not be granted unless all of the following findings have been made: (a)There are special circumstances applicable to the Lot such as its size, shape, topography, location or surroundings that do not apply generally to other properties in the same Zone and any relevant Overlay Zone. (b)Because of the special circumstances applicable to the Lot, the strict application of the applicable Development Standards or Site Planning Standards would deprive the Lost of privileges enjoyed by others. (c)The granting of the Variance will not constitute a grant of special privilege inconsistent with the limitations on other properties in the same Zone any relevant Overlay Zone. (d)The project is consistent with the General Plan and complies with other applicable provisions of this Chapter. (e)The Variance will not be materially detrimental to the public health, safety, or welfare, or to the interests of residents and property owners nearby the Lot. (f)The Variance approval places suitable conditions on the Lot to protect nearby properties. (g)The use is permitted or conditionally permitted in the Zone and any relevant Overlay Zone. (h)For a Variance approving a Floor Area Ratio greater than 2:1, the following additional findings shall be required: Article VI. Special Regulations and Procedures. Chapter 26. Comprehensive Zoning Ordinance VI-4 (1)The strict application of the ratio to industrial facilities with extensive conveyors, silos, towers, tanks, and related features makes the floor area limitation inappropriate; and (2)The proposed Buildings or Ancillary Structures will not adversely affect the ability of the City to provide public services and utilities to the Lot; and (3)Surrounding Streets and major Streets providing access to the Lot are adequate to accommodate the intensity of development proposed as established by traffic studies or other studies required by the City. Sec. 26.6.2-6. Notice of Decision. Not later than ten (10) business days following the rendering of a decision ordering that a Variance be granted or denied, a letter shall be mailed to the applicant at the address shown on the application filed with the City Council stating the decision of the City Council. If a resolution of the City Council orders that the Variance be granted, it shall also recite such conditions and limitations as the City Council may impose. The resolution of the City Council announcing its findings and determination after the hearing on an application for a Variance shall become a permanent record in the files of the City Clerk. Sec. 26.6.2-7. Effective Date of Order Granting or Denying a Variance. The order of the City Council in granting or denying a Variance shall become final and effective on the date of the adoption of the resolution. Sec. 26.6.2-8. Time Requirements for Use of Variance. Any Variance approved by the City Council shall expire and become null and void if: (a)There is no evidence of substantial use of the rights and privileges granted by the Variance within one (1) year from the date on which the Variance was granted; or (b)The use for which the Variance was granted has ceased to exist or has been suspended for at least one hundred twenty (120) continuous calendar days. If an application for an extension of the above time requirements is filed prior to the expiration of the applicable time requirement, the City Council may grant one extension of time, not to exceed one year from the time limit specified, without a public hearing. Any additional request for an extension of the time limit shall be treated as a new application for a Variance. Sec. 26.6.2-9. Revocation of Variance. (a)Notice of Public Hearing. Following receipt of a recommendation from the Director that the Variance be revoked, the City Clerk shall set the matter for public hearing to be held not less than ten (10) days nor more than sixty (60) days from the date of notice. The City Clerk shall give notice thereof in the manner provided in Section 26.6.2-3, “Conditional Use Permit.” The City Council may by resolution revoke any Variance based upon the determination that the improvement authorized by the Variance has become detrimental to the public health, safety, or general welfare, Article VI. Special Regulations and Procedures. VI-5 Chapter 26. Comprehensive Zoning Ordinance or the manner of operation constitutes or is creating a nuisance, based on any one of the following findings: (1)The circumstances under which the Variance was granted have been changed by the applicant to the extent that one or more of the findings contained in the original Variance can no longer be made in a positive manner, and the public health, safety, and general welfare require the revocation or modification; (2)The use or business for which a parking or maneuvering Variance was granted has been changed to the extent that one or more of the findings contained in the original Variance can no longer be made in a positive manner, and the public health, safety, and general welfare require the revocation or modification; (3)The Variance was issued, in whole or in part, on the basis of a misrepresentation or omission of a material statement(s) in the application or in the applicant's testimony presented during the public hearing for the Variance; (4)One or more of the conditions of the Variance have not been substantially fulfilled or have been violated; or (5)The improvement authorized by the Variance is in violation of any code, law, ordinance, regulation, or statute. (b)Findings. The City Council shall render written findings setting forth reasons for revoking or modifying the Variance. (c)Notification. If the Variance is modified or revoked, notification of the City Council action shall be mailed to the owner of the subject Lot or the owner’s by the City Clerk and shall include a copy of the City Council resolution specifying the reasons for the revocation or modification of the Variance. Sec. 26.6.2-10. Previously Granted Variance. Any Variance granted pursuant to any zoning ordinance enacted prior to the effective date of this Ordinance shall be construed to be a Variance under this Chapter subject to all conditions imposed thereunder. Such Variance may, however, expire, as provided in Section 26.6.2-8, “Development Agreement,” or be modified or revoked as provided in Section 26.6.2-9 Reasonable Accommodations. Sec. 26.6.3. Conditional Use Permit. The City Council shall have the authority, subject to the provisions of this Chapter, to grant a Conditional Use Permit whenever it finds the granting of a Conditional Use Permit is consistent with the requirements, intent, and purpose of this Chapter. The purpose of a Conditional Use Permit is to allow proper integration of uses into the community which may only be suitable in specific locations or designed and constructed in a particular manner or under certain conditions. Conditional Use Permits are not automatically terminated upon transfer of the Lot for which they have been granted, but are subject to expiration as set forth in Section 26.6.3-7, “Time Requirements for Use of Article VI. Special Regulations and Procedures. Chapter 26. Comprehensive Zoning Ordinance VI-6 Conditional Use Permit” and modification or revocation as set forth in Section 26.6.3-9, “Revocation or Substantial Modification of Conditional Use Permit,” and Section 26.6.3-10, “Conditional Use Permit – Minor Modification.” If the granting or denial of a Conditional Use Permit is subject to CEQA, and the time periods for any notice, response, or action set forth in Section 26.6.3, “Conditional Use Permit,” are inconsistent with the time periods required by CEQA, then the time periods shall be those necessary to comply with CEQA. Sec. 26.6.3-1. Application and Fee. Application for a Conditional Use Permit shall be made by the property owner or authorized agent to the Department of Public Works, Water, and Development Services, on a form provided for that purpose by the City, and shall be accompanied by a filing fee in an amount established by resolution of the City Council. The City may retain, at the applicant’s expense, consultants to study the impacts of the proposed operation on the surrounding properties. Application for a Conditional Use Permit shall consist of a completed Conditional Use Permit Form and the following attachments: (a)A plot plan which shall show the surrounding land uses; the location and dimensions of all Buildings and structures; and the location and dimensions of all off-street parking, loading, and storage facilities. The plot plan shall show areas for proposed Outdoor Storage and Activities, including areas proposed for vehicle washing or maintenance and repair; equipment; outdoor storage; the location and height of all fences, walls, screens, or landscaped areas in relation to the operation of the proposed use; the location and width of ingress and egress points to the Lot; the location and dimensions and turning radii of all parking and loading areas; and proposed truck routes through the City. (b)A floor plan showing: (1)The proposed location for all interior walls and all major equipment; and (2)The areas proposed for storage, use, or processing of explosive, toxic, infectious, or hazardous materials (as defined in federal and state laws and regulations), and the facilities and equipment to protect and contain or suppress accidents or fires involving said materials. (c)An operations plan describing in detail each function of the proposed use, the hours of operation, and any impacts to adjoining properties. (d)A traffic study showing the maximum number of vehicles traveling daily to and from the Lot, the approximate times vehicles will enter and exit the Lot, the number of Parking Spaces that will be required, the available maneuvering space, and the normal routes the vehicles would be expected to take to and from the Lot. The Director may request additional information and studies concerning impacts on the level of service of Streets that may be caused by traffic to and from the Lot. (e)An environmental checklist describing potential impacts to the environment and neighboring properties. Article VI. Special Regulations and Procedures. VI-7 Chapter 26. Comprehensive Zoning Ordinance Sec. 26.6.3-2. Notice of Public Hearing. Following presentation of a completed application to the Department of Public Works, Water, and Development Services, the City Clerk shall set the matter for public hearing in not less than ten (10) days nor more than sixty (60) days, and shall give notice of the time and place of the hearing and the information concerning the subject matter and purpose of the meeting in the manner described in Section 26.6.2-3, “Notice of Public Hearing.” Sec. 26.6.3-3. Public Hearing, Action of the City Council. If, from the facts presented at the public hearing or by an investigation at the instigation of the City Council, the City Council makes the findings required in Section 26.6.3-4, “Findings and Decisions by Resolution,” and finds that such Conditional Use Permit or modification thereof should be granted, the City Council may grant the requested Conditional Use Permit in whole, or in part, and upon such terms and conditions as the City Council may deem proper to preserve the public health, safety, convenience, and general welfare, and the general intent and purpose of this Chapter. The City Council shall make its findings and determinations upon said application within thirty (30) days after the conclusion of any hearing held thereon, unless a waiver of this time requirement is provided by the applicant. Sec. 26.6.3-4. Findings and Decision by Resolution. The City Council shall announce its findings and decision by written resolution. The resolution shall recite, among other things, the facts and reasons which, in the opinion of the City Council, make the granting or denial of the Conditional Use Permit necessary to carry out the provisions and general purpose of this Chapter, and shall order that the Conditional Use Permit be granted or denied. The Conditional Use Permit shall not be granted unless all of the following findings have been made: (a)The Lot for the proposed use is adequate in size, shape and topography, including any required drainage and landscaping; (b)The proposed use will not have a material adverse effect on the public; (c)The proposed use is compatible with the existing authorized uses of surrounding and adjacent properties; (d)The Lot has adequate off-street parking and loading facilities, and vehicle maneuverability for the proposed use; (e)The location, operation and design for the proposed use is consistent with the General Plan, any applicable specific plan and the zoning regulations of the City; (f)The use is consistent with all applicable federal, state, and local laws, rules and regulations; (g)The proposed use have a significant adverse impact on the general welfare as a result of noise, increased traffic, interference with the flow of traffic, or dust; and (h)The conditions applied to the permit are necessary to protect the public health, safety, and general welfare. Sec. 26.6.3-5. Notice of Decision. Not later than ten (10) business days following the rendering of a decision ordering that a Conditional Use Permit be granted or denied, a letter shall be mailed to the Article VI. Special Regulations and Procedures. Chapter 26. Comprehensive Zoning Ordinance VI-8 applicant at the address shown on the application filed with the City stating the decision of the City Council. Sec. 26.6.3-6. Effective Date of Order Granting or Denying a Conditional Use Permit. The order of the City Council in granting or denying a Conditional Use Permit shall become final and effective on the date of the adoption of the resolution. Sec. 26.6.3-7. Time Requirements for Use of Conditional Use Permit. Any Conditional Use Permit approved by the City Council shall expire and become null and void if: (a)There is no evidence of substantial use of the rights and privileges granted by the Conditional Use Permit within one (1) year from the date on which the Conditional Use Permit was granted; or (b)The use for which the Conditional Use Permit was granted has ceased to exist or has been suspended for at least three hundred sixty-five (365) continuous calendar days. If an application for an extension of the above time requirements is filed prior to the expiration of the applicable time requirement, the City Council may grant one extension of time, not to exceed one year from the time limit specified, without a public hearing. Any additional request for an extension of the time limit shall be treated as a new application for a Conditional Use Permit. Sec. 26.6.3-8. General Conditions. The City Council shall impose conditions on the Conditional Use Permit to protect the public health, safety, and general welfare. Such conditions may, without limitation, include: (a)Regulation of use; (b)Special yards, spaces, and buffers; (c)Fences and walls; (d)Surfacing of parking areas subject to City specifications; (e)Dedication of a portion of the land for a Right-of-way; (f)Making or paying for related street improvements; (g)Regulation of points of vehicular ingress and egress; (h)Regulation of signs; (i)Requiring Landscaping; (j)Outdoor Storage and Activities limitations or requirements; (k)Requiring maintenance of the Landscaping and the grounds; (l)Requiring adequate parking and loading spaces; Article VI. Special Regulations and Procedures. VI-9 Chapter 26. Comprehensive Zoning Ordinance (m)Regulation of noise, vibration, odors, and similar concerns; (n)Regulation of time for certain activities; (o)Regulation time period within which the proposed use shall be implemented or used; (p)Duration of use; and (q)Such other conditions as will make possible the development of the project in an orderly and efficient manner in conformity with the intent and purposes set forth in this Chapter. Sec. 26.6.3-9. Revocation or Amendment of Conditional Use Permit. (a)Revocation or Amendment of Conditional Use Permit. Following receipt of a recommendation from the Director that the Conditional Use Permit be revoked or amended, the City Clerk shall set the matter for public hearing to be held in not less than ten (10) days or more than sixty (60) days from the date of notice, and shall give notice thereof in the manner provided in Section 26.6.2-3, “Notice of Public Hearing.” The City Council may by resolution revoke any Conditional Use Permit (or, if a revocation is not justified, the City Council may, instead, amend the Conditional Use Permit) based upon the determination that the use authorized by the Conditional Use Permit has become detrimental to the public health, safety, or general welfare, or the manner of operation constitutes or is creating a nuisance, based on any one of the following findings: (1)The circumstances under which the Conditional Use Permit was granted have been changed by the applicant to the extent that one or more of the findings contained in the original Conditional Use Permit can no longer be made in a positive manner, and the public health, safety, and general welfare require the revocation or modification; (2)The Conditional Use Permit was issued, in whole or in part, on the basis of a misrepresentation or omission of a material statement(s) in the application or in the applicant's testimony presented during the public hearing for the Conditional Use Permit; (3)One or more of the conditions of the Conditional Use Permit are both feasible and have been intentionally unfulfilled or violated; or (4)The use authorized by the Conditional Use Permit is in violation of any code, law, ordinance, regulation, or statute. (b)Findings. The City Council shall render written findings setting forth reasons for revoking or modifying the Conditional Use Permit. (c)Notification. If the Conditional Use Permit is revoked or modified, notification of the City Council action shall be mailed to the owner of the subject Lot by the City Article VI. Special Regulations and Procedures. Chapter 26. Comprehensive Zoning Ordinance VI-10 Clerk and shall include a copy of the City Council resolution specifying the reasons for revoking or modifying the Conditional Use Permit. Sec. 26.6.3-10. Conditional Use Permit – Minor Modification. Whenever a practical difficulty occurs or unforeseen circumstances arise during the course of exercising a Conditional Use Permit issued in accordance with the provisions of this Chapter, and which may necessitate a minor modification of such Conditional Use Permit, a Conditional Use Permit-Minor Modification may be issued for such modification in accordance with the following provisions. (a)Application and Fee. Any owner of property for which a Conditional Use Permit has been issued and is currently in effect, and who is desirous of a minor modification thereof, may file with the Director an application for approval of a Conditional Use Permit-Minor Modification, accompanied by a filing fee in an amount established by a resolution of the City Council. The application shall set forth and include any information as the Director may require. (b)Qualifications for Filing. Any application filed for a minor modification that also complies with the requirements and findings as set forth in Section 26.6.3-4, “Findings and Decision by Resolution,” of this Chapter, but which only involves a minor modification in the site development plan, arrangement of facilities, or activities at the site adequate to accommodate the operation of the use of land operating under a valid Conditional Use Permit, or any of the conditions of permit issuance, and determination thereof has been made at the discretion of the Director, may qualify for a Conditional Use Permit-Minor Modification. (c)Determination, Action of the Director. The Director shall have the authority, subject to the provisions of this Chapter, to approve a Conditional Use Permit-Minor Modification without a public hearing; provided, however, that such modification is in fact minor in scope and nature and only involves minor adjustments to retain the integrity of the Conditional Use Permit. The Director shall not approve such minor modification when a Conditional Use Permit has not been issued or is not in effect. A minor modification shall not be issued if it involves the waiver or deletion of any condition of a Conditional Use Permit unless the condition is found to be infeasible or unenforceable due to physical, technological, or practical constraints, as determined by the Director. The Director shall process such application for Conditional Use Permit-Minor Modification in the following manner: (1)Investigations. The Director, upon receipt and acceptance of an application, shall make and cause to be made such investigations of the facts bearing upon the application what will assure appropriate disposition thereof. (2)Findings. The Director, upon conducting an inspection of the property involved, upon examination and review of the application and investigations, and upon ascertaining all other pertinent facts relative thereto, shall determine whether or not the requirements for qualification have been shown, as hereinabove set forth in Section 26.6.3-4, “Findings and Decision by Resolution,” and the application therefore qualifies for a Conditional Use Permit-Minor Modification. The Director shall not grant a modification unless Article VI. Special Regulations and Procedures. VI-11 Chapter 26. Comprehensive Zoning Ordinance all of the findings pursuant to Section 26.6.3-4, “Findings and Decision by Resolution,” can be made. (3)Option to Refer to City Council. The Director may elect to refer the application, with or without a recommendation, to the City Council for decision. Upon referral to City Council, all procedures associated with hearing, action, noticing, findings, and decision shall comply with Section 26.6.3, “Revocation or Substantial Modification of Conditional Use Permit.” (4)Notice of Decision. Not later than ten (10) business days following the rendering of a decision ordering that a minor modification be granted or denied, a letter shall be mailed to the applicant at the address shown on the application filed with the City stating the decision of the Director. (5)Effective Date of Order Granting or Denying a Minor Modification. The order of the Director in granting or denying a Minor Modification to a Conditional Use Permit shall become final and effective on the date of the signing of the notice of decision. (6)Appeals. Following the City Clerk’s receipt of a written appeal contesting any action or decision of the Director that has been submitted to the City Clerk within thirty (30) days after the date such action or decision was taken by the Director, the City Clerk shall set the appeal for a public hearing. The public hearing shall be held not less than ten (10) days nor more than sixty (60) days from the City Clerk’s receipt of the appeal. The City Clerk shall give notice of the time and place of the hearing and the purpose thereof in the manner described in Section 26.6.3-3, “Notice of Public Hearing.” The appellant may appear in person before the City Council or be represented by an attorney, and may introduce evidence to support the claim. The appellant shall cause to be made at his or her own expense any investigation or research required by the City to substantiate the appellant’s claim. Sec. 26.6.3-11. Recommend Substantial Modification. If the Director denies a Minor Modification to a Conditional Use Permit or deems the request to be a Substantial Modification to a Conditional Use Permit, then the original Conditional Use Permit still applies and the applicant can apply for a Substantial Modification of a Conditional Use Permit. A Substantial Modification of a conditional use permit shall follow all procedures associated with hearing, action, noticing, findings, and decision in compliance with Section 26.6.3, “Conditional Use Permit,” as if it were a new application. Sec. 26.6.3-12. Existing Uses. Uses existing on the effective date of this Ordinance that were legally permitted prior to the effective date of this Ordinance may continue as Legal Nonconforming Uses subject to the terms of Section 26.5.3, “Legal Nonconforming Status.” Sec. 26.6.3-13. Previously Granted Conditional Use Permit. Any Conditional Use Permit granted pursuant to any zoning ordinance enacted prior to the effective date of this Ordinance shall be construed to be a Conditional Use Permit under this Ordinance subject to all conditions imposed in such Conditional Use Permit, subject to the terms of Section 26.5.3, “Legal Nonconforming Status.” Such Conditional Use Permit may, however, expire as provided in Section 26.6.3-7, “Time Article VI. Special Regulations and Procedures. Chapter 26. Comprehensive Zoning Ordinance VI-12 Requirements for Use of Conditional Use Permit,” or be revoked or modified as provided in Section 26.6.3-9, “Revocation or Substantial Modification of Conditional Use Permit,” and/or Section 26.6.3- 10, “Conditional Use Permit.” Sec. 26.6.4. Minor Conditional Use Permit. Sec. 26.6.4-1. Authority and Purpose. The Director shall have the authority, subject to the provisions of the Chapter, to grant a Minor Conditional Use Permit whenever the Director finds the granting of a Minor Conditional Use Permit is consistent with the requirements, intent, and purpose of this Chapter. The purpose of a Minor Conditional Use Permit is to allow proper integration of uses into the community which may only be suitable in specific locations or designed and constructed in a particular manner or under certain conditions, but are of a scale that would be less impactful than those that may be permitted with a Conditional Use Permit. Minor Conditional Use Permits are not automatically terminated upon transfer of the Lot for which they have been granted, but are subject to expiration as set forth in Section 26.6.4-9, “Time Requirements for Use of Minor Conditional Use Permit,” and modification or revocation as set forth in Section 26.6.4-12, “Modification of Minor Conditional Use Permit,” and 26.6.4-13, “Revocation of Minor Conditional Use Permit.” If the granting or denial of a Minor Conditional Use Permit is subject to CEQA, the time periods for any notice, response, or action shall comply with the time frames established by CEQA, notwithstanding any time periods set forth in this Section 26.6.4, “Minor Conditional Use Permit.” Sec. 26.6.4-2. Minor Conditional Use Permit - Application and Fee. Application for a Minor Conditional Use Permit shall be made by the property owner or authorized agent to the Department of Public Works, Water, and Development Services, on a form provided for that purpose by the City, and shall be accompanied by a filing fee in an amount established by resolution of the City Council. The City may retain, at the applicant’s expense, consultants to study the impacts of the proposed operation on the surrounding properties. Application for a Minor Conditional Use Permit shall consist of a completed Minor Conditional Use Permit Form and the following attachments: (a)A plot plan which shall show the surrounding land uses; the location and dimensions of all Buildings and structures; and the location and dimensions of all off-street parking, loading, and storage facilities. The plot plan shall show areas for proposed Outdoor Storage and Activities, including areas proposed for vehicle washing or maintenance and repair; equipment; outdoor storage, if allowed; the location and height of all fences, walls, screens, or landscaped areas in relation to the operation of the proposed use(s); the location and width of ingress and egress points to the Lot; and the location and dimensions and turning radii of all parking and loading areas. (b)A floor plan showing: (1)The proposed location for all interior walls and all major equipment; and (2)The areas proposed for storage, use, or processing of explosive, toxic, infectious, or hazardous materials (as defined in federal and state laws and regulations), and the facilities and equipment to protect and contain or suppress accidents or fires involving said materials. Article VI. Special Regulations and Procedures. VI-13 Chapter 26. Comprehensive Zoning Ordinance (c)An operations plan describing in detail each function of the proposed use(s), the hours of operation, and any impacts to adjoining properties. (d)A traffic study, if required by the Director, showing the maximum number of vehicles traveling daily to and from the Lot, the approximate times vehicles will enter and exit the Lot, the number of Parking Spaces that will be required, the available maneuvering space, and the normal routes the vehicles would be expected to take to and from the Lot. The Director may request additional information and studies concerning impacts on the level of service of Streets that may be caused by traffic to and from the Lot. (e)An environmental checklist describing potential impacts to the environment and neighboring properties. Sec. 26.6.4-3. Minor Conditional Use Permit - Public Notice. Following presentation of a completed application to the Department of Public Works, Water, and Development Services, the City Clerk shall give notice that a Minor Conditional Use Permit is to be considered. Such notice shall be mailed to all property owners within a three hundred (300) foot radius of the property where the Minor Conditional Use Permit is proposed. The notification shall provide a general explanation of the matter to be considered and a general description, in text or by diagram, of the location of the Lot that is the subject of the decision, and shall provide a comment period of not less than fourteen (14) calendar days. Sec. 26.6.4-4. Minor Conditional Use Permit - Determination, Action of the Director If, from the facts presented via public comments and by an investigation at the instigation of the Director, the Director makes the findings required in Section 26.6.4-6, “Finding and Decisions,” and finds that such Minor Conditional Use Permit or modification thereof should be granted, the Director may grant the requested Minor Conditional Use Permit in whole, or in part, and upon such terms and conditions as the Director may deem proper to preserve the public health, safety, convenience, and general welfare, and the general intent and purpose of this Chapter. The Director shall make his findings and determinations upon said application within thirty (30) days after the application for the Minor Conditional Use Permit is deemed complete and CEQA review has been completed, unless a waiver of this time requirement is provided by the applicant. Sec. 26.6.4-5. Minor Conditional Use Permit - Option to Refer to City Council. The Director may elect to refer the application, with or without a recommendation, to the City Council for decision. Upon referral to City Council, all procedures associated with hearing, action, noticing, findings, and decision shall comply with Section 26.6.3, “Conditional Use Permit.” Sec. 26.6.4-6. Minor Conditional Use Permit - Findings and Decision. Upon consideration of any comments received, the Director (or the Council on a referral) may approve, conditionally approve, or deny the proposed Minor Conditional Use Permit. The Minor Conditional Use Permit shall not be granted unless all of the following findings have been made: (a)The Lot is adequate in size, shape and topography for the proposed use; (b)The proposed use will not have a material adverse effect on the public; (c)The proposed use is compatible with the existing authorized uses of surrounding and adjacent properties; Article VI. Special Regulations and Procedures. Chapter 26. Comprehensive Zoning Ordinance VI-14 (d)The Lot has adequate off-street parking, loading facilities, and vehicle maneuverability for the proposed use; (e)The use, as to location, operation and design, is consistent with the General Plan, any applicable specific plan, and the zoning regulations of the City of Vernon, including the City’s policy considerations as to acceptable uses in the City; (f)The use is consistent with all applicable County, State, and federal laws, rules and regulations; (g)The proposed use will not adversely affect the general welfare as a result of noise, increased traffic, interference with the flow of traffic, dust, or other undesirable characteristics; and (h)The conditions stated in the decision are deemed necessary to protect the public health, safety, and general welfare. Sec. 26.6.4-7. Notice of Decision. Not later than ten (10) business days following the rendering of a decision ordering that a Minor Conditional Use Permit be granted or denied, a letter shall be mailed to the applicant at the address shown on the application filed with the City stating the decision of the Director. Sec. 26.6.4-8. Effective Date of Order Granting or Denying a Minor Conditional Use Permit. The order of the Director in granting or denying a Minor Conditional Use Permit shall become final and effective on the date of the signing of the notice of decision. Sec. 26.6.4-9. Time Requirements for Use of Minor Conditional Use Permit. Any Minor Conditional Use Permit approved by the Director shall expire and become null and void if: (a)There is not evidence of substantial use of the rights and privileges granted by the Minor Conditional Use Permit within one (1) year from the date on which the Minor Conditional Use Permit was granted; or (b)The use for which the Minor Conditional Use Permit was granted has ceased to exist or has been suspended for at least one (1) year. If an application for an extension of the above time requirements is filed prior to the expiration of the applicable time requirement, the Director may grant one extension of time, not to exceed one year from the time limit specified. Any additional request for an extension of the time limit shall be treated as a new application for a Minor Conditional Use Permit. Sec. 26.6.4-10. General Conditions. The Director shall impose conditions on the Minor Conditional Use Permit to protect the public health, safety, and general welfare. Such conditions may, without limitation, include: (a)Regulation of use; (b)Special yards, spaces, and buffers; Article VI. Special Regulations and Procedures. VI-15 Chapter 26. Comprehensive Zoning Ordinance (c)Fences and walls; (d)Surfacing of parking areas subject to City specifications; (e)Dedication of a portion of the land for a Right-of-way; (f)Making or paying for related street improvements; (g)Regulation of points of vehicular ingress and egress; (h)Regulation of signs; (i)Requiring Landscaping; (j)Outdoor Storage and Activities limitations or requirements; (k)Requiring maintenance of the Landscaping and the grounds; (l)Requiring adequate parking and loading spaces; (m)Regulation of noise, vibration, odors, and similar concerns; (n)Regulation of time for certain activities; (o)Regulation time period within which the proposed use shall be implemented or used; (p)Duration of use; and (q)Such other conditions as will make possible the development of the project in an orderly and efficient manner in conformity with the intent and purposes set forth in this Chapter. Sec. 26.6.4-11. Appeals. Following the City Clerk’s receipt of a written appeal contesting any action or decision of the Director that has been submitted to the City Clerk within thirty (30) days after the date such action or decision was taken by the Director, the City Clerk shall set the appeal for a public hearing. The public hearing shall be held not less than ten (10) days nor more than sixty (60) days from the City Clerk’s receipt of the appeal. The City Clerk shall give notice of the time and place of the hearing and the purpose thereof in the manner described in Section 26.6.2-3, “Notice of Public Hearing.” The appellant may appear in person before the City Council or be represented by an attorney, and may introduce evidence to support the claim. The appellant shall cause to be made at his or her own expense any investigation or research required by the City to substantiate the appellant’s claim. Sec. 26.6.4-12. Modification of Minor Conditional Use Permit. The Director shall have the authority to, upon a filed request of the grantee of the Minor Conditional Use Permit, consider modifications to an approved Minor Conditional Use Permit. The Director shall approve, deny, or approve with additional conditions an application for modification of a Minor Conditional Use Permit based on the following written findings: Article VI. Special Regulations and Procedures. Chapter 26. Comprehensive Zoning Ordinance VI-16 (1)The modification is in compliance with all applicable requirements of the Zoning Ordinance; (2)The modification will achieve the same or improved relief from the impact or impacts the original condition(s) was designed to achieve; (3)The modification will not result in any foreseeable new environmental impacts; and (4)The modification complies with all applicable City, County, state, and federal laws and regulations. Sec. 26.6.4-13. Revocation or Amendment of a Minor Conditional Use Permit. (a)Revocation or Amendment of a Minor Conditional Use Permit. Following receipt of a recommendation from the Director that a Minor Conditional Use Permit be revoked, the City Clerk shall set the matter for public hearing to be held in not less than ten (10) days or more than sixty (60) days from the date of notice, and shall give notice thereof in the manner provided in Section 26.6.2-3, “Notice of Public Hearing.” The City Council may by resolution revoke any Minor Conditional Use Permit (or, if a revocation is not justified, the City Council may, instead, amend the Minor Conditional Use Permit) based upon the determination that the use authorized by the Minor Conditional Use Permit has become detrimental to the public health, safety, or general welfare, or the manner of operation constitutes or is creating a nuisance, based on any one of the following findings: (1)The circumstances under which the Minor Conditional Use Permit was granted have been changed by the applicant to the extent that one or more of the findings contained in the original Minor Conditional Use Permit can no longer be made in a positive manner, and the public health, safety, and general welfare require the revocation or modification; (2)The Minor Conditional Use Permit was issued, in whole or in part, on the basis of a misrepresentation or omission of a material statement(s) in the application or in the applicant's testimony presented during the public hearing for the Minor Conditional Use Permit; (3)One or more of the conditions of the Minor Conditional Use Permit are both feasible and have been intentionally unfulfilled or violated; or (4)The use authorized by the Minor Conditional Use Permit is in violation of any code, law, ordinance, regulation, or statute. (b)Findings. The City Council shall render written findings setting forth reasons for revoking or modifying the Minor Conditional Use Permit. (c)Notification. If the Minor Conditional Use Permit is revoked or modified by the City Council, notification of the City Council action shall be mailed to the owner of the Article VI. Special Regulations and Procedures. VI-17 Chapter 26. Comprehensive Zoning Ordinance subject Lot by the City Clerk and shall include a copy of the City Council resolution specifying the reasons for revoking or modifying the Minor Conditional Use Permit. Sec. 26.6.5. Temporary Use Permits. Sec. 26.6.5-1. Authority and Purpose. This section is intended to grant the Director and the City Council the authority, subject to the provisions of this Chapter, to temporarily authorize upon property not owned or controlled by the city, short-term, activities that are not already authorized upon that property, and which short-term activities would be compatible with adjacent and surrounding uses when conducted in compliance with this Chapter. Sec. 26.6.5-2. Application and Fee. Application for a Temporary Use Permit shall be made by the property owner or authorized agent to the Department of Public Works, Water, and Development Services, on a form provided for that purpose by the City, and shall be accompanied by a filing fee in an amount established by resolution of the City Council. The application shall also be reviewed by the Police, Fire and Health Departments to ensure the operation of the Temporary Use plans and maintains adequate traffic control, security, safety provisions and any other applicable requirements. Sec. 26.6.5-3. Applicability. The provisions established in this Section, “Temporary Use Permits.” shall only apply to proposed temporary activities on property not owned or controlled by the City (“Non-City Property”). Proposed temporary used by non-City parties of City owned or controlled property (“City Property”) may be authorized via issuance of a special events permit. For proposed temporary land uses on Non-City property, the following two categories of temporary land uses identify the level of permit required, if any, based on the proposed duration, size, and type of use: (a)Exempt Temporary Uses. The following minor and limited duration temporary uses are exempt from the requirement for a Temporary Use Permit. Uses that do not fall within the categories defined in this Subsection shall comply with Section 26.6.5-3(b), “Allowed Temporary Uses and Major Events” or shall not be permitted. (1)Construction Sites – On-Site. On-site contractors' construction/storage uses, in conjunction with an approved construction project on the same parcel. The construction and/or storage use shall be removed immediately upon completion of the construction project, or the expiration of the companion Building Permit, authorizing the construction project, whichever first occurs. (2)Emergency Facilities. Emergency public health and safety needs/land use activities, as determined by the Director. (3)First Amendment Protected Activity. Any spontaneous activity or event determined to have clearly identified First Amendment protections, whereby the time provisions established in this Section for acquiring a Temporary Use Permit would, in the opinion of the Director, unreasonably interfere with the ability of the activity or event to occur. (4)Special Event Permitted Activities –Uses that are permitted in accordance with Section 26.6.5-11. Article VI. Special Regulations and Procedures. Chapter 26. Comprehensive Zoning Ordinance VI-18 (b)Allowed Temporary Uses and Major Events. Non-exempt temporary uses, including special events, shall be subject to the issuance of a Temporary Use Permit, and only when conducted in compliance with Section 26.6.5-9, “General Conditions,” below. (1)Contractors’ Construction Sites – Off-Site. The temporary use of a site for an off-site contractor’s construction, staging, or storage area(s) for a construction project within the City. The permit may be effective for up to 180 days and extended in 180-day increments, with Director approval, or the expiration of the companion Building Permit, authorizing the construction project, whichever first occurs. (2)Major Events. Amusement rides, arts and crafts exhibits, auctions, carnivals, circuses, concerts, fairs, farmer’s markets, festivals, food markets/events, outdoor entertainment/sporting events, and rodeos limited to s nine (9) consecutive days or fewer, or three (3) two(2)-day weekends, within a twelve (12)-month period. If an annual plan is submitted to and approved by the Director, the frequency and duration of these special events may be extended. (3)Outdoor display or sale events conducted by a business holding a valid Business License, issued in compliance with Municipal Code Section 5.1, “Definitions,” et seq., and a retail sellers permit issued by the State of California for product not normally stored or produced on site may be allowed a maximum of six (6) outdoor sale events (excluding City-sponsored activities). For purposes of this Subsection, an outdoor sale event shall be no longer than seven (7) consecutive days in duration. If an annual plan is submitted to and approved by the Director, the frequency and duration of these outdoor display and sale events may be extended. (4)Seasonal sales (for example, Halloween pumpkin sales and Christmas tree sale lots), issued in compliance with Municipal Code Section 5.3 License required; application for license, and limited to thirty (30) consecutive days or less. (5)Other Similar Temporary Uses. Similar temporary uses that, in the opinion of the Director, are compatible with the subject zone and surrounding land uses. Sec. 26.6.5-4. Determination, Action of the Director. A public hearing shall not be required for the Director’s decision on a Temporary Use Permit application. However, the Director shall have the authority to require noticing of surrounding property owners and tenants if, in the Director’s opinion, the proposed Temporary Use has the potential to create adverse impacts on surrounding properties and uses. If, from the facts presented via comments or by an investigation at the instigation of the Director, the Director makes the findings required in Section 26.6.5-6, “Findings and Decisions,” and finds that such Temporary Use Permit or modification thereof should be granted, the Director may grant the requested Temporary Use Permit in whole, or in part, and upon such terms and conditions as the Article VI. Special Regulations and Procedures. VI-19 Chapter 26. Comprehensive Zoning Ordinance Director may deem proper to preserve the public health, safety, convenience, and general welfare, and the general intent and purpose of this Chapter. The Director shall make findings and determinations upon said application within thirty (30) days after the application for the Temporary Use Permit is deemed complete, unless a waiver of this time requirement is provided by the applicant. Sec. 26.6.5-5. Option to Refer to City Council. The Director may elect to refer the application, with or without a recommendation, to the City Council for decision. Upon referral to City Council, all procedures associated with hearing, action, and noticing shall comply with Section 26.6.3, “Conditional Use Permit.” Sec. 26.6.5-6. Findings and Decision. The Director (or the Council on a referral) may approve, conditionally approve, or deny a Temporary Use Permit application. The Temporary Use Permit shall not be granted unless all of the following findings have been made: (a)The operation of the requested temporary use at the location proposed and within the time period specified will not endanger, jeopardize, or otherwise constitute a menace to the public convenience, health, safety, or general welfare; (b)The operation of the requested temporary use will not be detrimental to adjoining properties through the creation of excessive dust, light, noise, odor, or other objectionable characteristics; (c)The proposed parcel is adequate in size and shape to accommodate the temporary use without detriment to the enjoyment of other properties located adjacent to and in the vicinity of the subject parcel; (d)The proposed use and authorized operators will comply with all applicable laws, including fire and life safety requirements and maximum occupancy requirements. (e)The proposed parcel is adequately served by streets or highways having sufficient width and improvements to accommodate the kind and quantity of traffic that the temporary use will or could reasonably be expected to generate; (f)Adequate temporary parking to accommodate vehicular traffic to be generated by the use will be available either on-site, on-street or at alternate locations acceptable to the Director; and (g)The applicant agrees in writing to comply with any and all of the conditions imposed by the review authority in the approval of the Temporary Use Permit. Sec. 26.6.5-7. Notice of Decision. Not later than ten (10) business days following the rendering of a decision ordering that a Temporary Use Permit be granted or denied, a letter shall be mailed to the applicant at the address shown on the application filed with the City stating the decision of the Director. Sec. 26.6.5-8. Effective Date of Order Granting or Denying a Temporary Use Permit. The order of the Director to grant or deny a Temporary Use Permit shall become final and effective on the date of the signing of the notice of decision. Article VI. Special Regulations and Procedures. Chapter 26. Comprehensive Zoning Ordinance VI-20 Sec. 26.6.5-9. General Conditions. In approving a Temporary Use Permit application, the Director (or the Council on a referral) may impose conditions that are deemed reasonable and necessary to ensure that the permit would be in full compliance with the findings required by Section 26.6.5-6, “Findings and Decisions,” above. Such conditions may, without limitation, include: (a)Fixed period of time; (b)Operating hours and days; (c)Temporary pedestrian and vehicular circulation; (d)Regulation of nuisance factors; (e)Regulation of temporary structures; (f)Litter, sanitary, and medical facilities; (g)Waste collection, recycling, and/or disposal; (h)Police/security and safety measures; (i)Signs; (j)Performance bond or other security; (k)Limitations on alcoholic beverage sales; (l)Compliance with applicable provisions; and (m)Such other conditions as will make possible the temporary use in an orderly and efficient manner in conformity with the intent and purposes set forth in this Chapter. Sec. 26.6.5-10. Condition of Site Following Temporary Use. Each site occupied by a temporary use shall be cleaned of debris, litter, or any other evidence of the temporary use upon completion or removal of the use, and shall continue to be used in compliance with this Zoning Ordinance. Sec. 26.6.5-11. Special Event Permit. Temporary uses that are considered minor in nature by virtue of having minimal impact to surrounding properties may be issued a Special Event Permit by the Vernon Fire Department. Such events meeting these qualifications may include but are not limited to indoor or outdoor sales event of product normally stored or produced onsite, outdoor or indoor meeting, ground breaking ceremony, holiday or special occasion party, or similar event. Such events generally are of a duration no longer than two days. If, in the opinion of the Fire Chief, the Fire Chief determines the event is beyond the scope of a Special Event Permit, the application shall be denied and instead the applicant shall be required to apply for a Temporary Use Permit. In approving a Special Event Permit application, the Fire Chief may impose conditions that are deemed reasonable and necessary to ensure that the permit would be in full compliance with the findings required of a Temporary Use Permit by Section 26.6.5-6, “Findings and Decisions,” above. Such conditions may, without limitation, include: Article VI. Special Regulations and Procedures. VI-21 Chapter 26. Comprehensive Zoning Ordinance (a)Fixed period of time; (b)Operating hours and days; (c)Temporary pedestrian and vehicular circulation; (d)Regulation of nuisance factors; (e)Regulation of temporary structures; (f)Litter, sanitary, and medical facilities; (g)Waste collection, recycling, and/or disposal; (h)Police/security and safety measures; (i)Signs; (j)Performance bond or other security; (k)Limitations on alcoholic beverage sales; (l)Compliance with applicable provisions; and Sec. 26.6.5-12. Such other conditions as will make possible the temporary use in an orderly and efficient manner in conformity with the intent and purposes set forth in this Chapter Sec. 26.6.6. Zoning Ordinance or Text Amendment. Sec. 26.6.6-1. Purpose. Whenever public necessity, convenience and general welfare require, the boundaries of the Zone and the Overlay Zones established by this Chapter, the classification of property uses therein, or other provisions of this Chapter may be amended as follows: (a)By amending the Zoning Map, or (b)By revising the text of the Ordinance. Sec. 26.6.6-2. Amendments. Amendments of this Chapter and the Zoning Map which is a part hereof, may be adopted as follows: (a)An Amendment may be initiated by the verified application of the owner or owners of property which is proposed to be changed or reclassified, whenever an Amendment, supplement to, or change in the regulations prescribed for the property is desired; or (b)The City Council may introduce and adopt an ordinance as provided in the City charter. Sec. 26.6.6-3. Notice of Public Hearing. Within sixty (60) days after (a) receipt of a completed application by the owner or owners of property or (b) introduction of an ordinance by the City Council, as the case may be, the City Clerk shall set the matter for public hearing to be held not less Article VI. Special Regulations and Procedures. Chapter 26. Comprehensive Zoning Ordinance VI-22 than ten (10) days and not more than sixty (60) days from the date of notice of the public hearing, with such notice being given in the manner provided in Government Code Section 65091. If the granting or denial of an Amendment is subject to CEQA, the time periods for any notice, response, or action shall comply with the time frames established by CEQA, notwithstanding any time periods set forth in this Section 26.6.3, “Notice of Public Hearing.” Sec. 26.6.6-4. City Council to Announce Decision After the Public Hearing. The City Council shall announce its decision and if the Amendment is approved, shall adopt an ordinance incorporating the decision. The ordinance shall recite the facts and reasons which, in the opinion of the City Council, make the approval of the application for the Amendment necessary to carry out the general purpose of this Chapter. Sec. 26.6.6-5. Notice of Ordinance. At the time the ordinance becomes effective, one copy of such ordinance shall be forwarded to the applicant at the address shown upon the application. Sec. 26.6.6-6. Zoning Map Modification. If the Amendment involves an amendment to the Zoning Map, the Department of Public Works, Water, and Development Services, immediately following the effective date of the ordinance, shall cause the Zoning Map to be so modified. Copies of the modified Zoning Map shall be available to the public on request. Sec. 26.6.7. Interpretations, Minor Exceptions, and Appeals. Sec. 26.6.7-1. Interpretations. The Director shall have the power to interpret the provisions of the Zoning Ordinance when any ambiguity or lack of clarity exists and to make determinations as to whether a proposed use is substantially similar to a Permitted Use and is therefore permitted of right or through obtaining a Conditional Use Permit or Minor Conditional Use Permit, or whether a proposed use is a First Amendment Protected Use and is therefore permitted as such, pursuant to this Chapter. Sec. 26.6.7-2. Record of Interpretations. The Director shall keep a written record of interpretations made on file in the Department of Public Works, Water, and Development Services. Such record shall briefly describe the interpretation made and the date of the interpretation. The record shall be available for public review during the normal business hours of the Department of Public Works, Water, and Development Services. Sec. 26.6.7-3. Exceptions. The Director shall have the authority to make minor exceptions or adjustments to the standards contained in this Ordinance. The Exception shall not be granted unless such exceptions are necessary to ensure an equitable and reasonable application of the Chapter. Exceptions shall not result in the reduction of any standard by an amount greater than ten percent (10%). Any deviation from a standard which exceeds ten percent (10%) shall be made only in accord with Section 26.6.2, “Variances,” of this Chapter. Sec. 26.6.7-4. Record of Exceptions. Any exception made by the Director in accord with the provisions of this Section shall be duly recorded in concise language and with accompanying drawings as required. The record shall be filed in the Department of Public Works, Water, and Development Services by property location using a street address or other reasonable system to permit reference to the exception made at any future date. Article VI. Special Regulations and Procedures. VI-23 Chapter 26. Comprehensive Zoning Ordinance Sec. 26.6.7-5. Appeals. Following the City Clerk’s receipt of a written appeal contesting any action or decision of the Director that has been submitted to the City Clerk within thirty (30) days after the date such action or decision was taken by the Director, the City Clerk shall set the appeal for a public hearing. The public hearing shall be held not less than ten (10) days nor more than sixty (60) days from the City Clerk’s receipt of the appeal. The City Clerk shall give notice of the time and place of the hearing and the purpose thereof in the manner described in Section 26.6.2-3, “Notice of Public Hearing.” The appellant may appear in person before the City Council or be represented by an attorney, and may introduce evidence to support the claim. The appellant shall cause to be made at his or her own expense any investigation or research required by the City to substantiate the appellant’s claim. Sec. 26.6.8. Development Agreement. Sec. 26.6.8-1. Applicability. Development Agreements are authorized by California Government Code Section 65864 as a means of providing both the city and property owners with assurances that development projects can be completed under the terms, conditions, and regulations in effect at the time that authority is granted to proceed with a project. Sec. 26.6.8-2. Contents of Agreement. A Development Agreement shall specify the duration of the agreement. The Development Agreement shall specify the permitted uses of the property, the density or intensity of use, the maximum height and size of proposed Buildings, and provisions for reservation or dedication of land for public purposes, if any reservation or dedication is required by the City of Vernon. The Development Agreement may include conditions, terms, restrictions, and requirements for subsequent discretionary actions, provided that such conditions, terms, restrictions, and requirements for subsequent discretionary action shall not prevent development of the land for the uses and to the density or intensity of development set forth in the Agreement. The Development Agreement may provide that construction be commenced within a specified time, that the project be completed within a specified time, and/or may provide for construction to be accomplished in phases. The Development Agreement may contain such other provisions as may be considered necessary or proper by the City Council to further legitimate City interest or to protect the public health, safety, and welfare so long as such terms are not inconsistent with the provisions of State law relating to Development Agreements, nor inconsistent with the ordinances, policies, plans, or resolutions of the City of Vernon. Sec. 26.6.8-3. Findings. In acting to grant a Development Agreement, the City Council shall make the following findings with regard to the proposed Development Agreement: (a)The Development Agreement is consistent with the General Plan objectives, policies, land uses, and implementation programs and any other adopted plans or policies applicable to the agreement. (b)The Development Agreement is compatible with the uses authorized in, and the regulations prescribed for, the land use district in which the real property is located. (c)The Development Agreement will promote the public convenience, health, interest, safety, and general welfare of the City and will not be detrimental to or cause adverse effects to adjacent property owners, residents, or the general public; Article VI. Special Regulations and Procedures. Chapter 26. Comprehensive Zoning Ordinance VI-24 (d)The associated project will further important citywide goals and policies that have been officially recognized by the Council; and (e)The Development Agreement is consistent with the provisions of California Government Code Sections 65864 through 65869.5. Sec. 26.6.8-4. Denial of Development Agreement. The City Council, in its sole discretion, may decide not to enter into the Development Agreement on the grounds that, in its opinion, the proposed Agreement is not in the best interest of the public. Sec. 26.6.8-5. Public Hearings and Adoption.A public hearing shall be held on the proposed Development Agreement by the City Council. Notice of the public hearings specified in this Chapter shall be given in the form of a notice of intention to consider approval of a Development Agreement in compliance with Government Code Section 65867 and in the manner described in Section 26.6.2- 3, “Notice of Public Hearing.” Development Agreements shall be adopted by ordinance of the City Council, which constitutes final action and approval of the agreement. After the effective date of the ordinance approving the Development Agreement, the City may enter into the agreement. Sec. 26.6.8-6. Recordation. A Development Agreement shall be recorded in the County Recorder’s Office no later than ten (10) days after it is executed and a confirming copy of the recorded document shall be sent to the City. Sec. 26.6.8-7. Amendment and Cancellation of Development Agreements. Unless otherwise provided in a Development Agreement, either party may propose an amendment to or cancellation, in whole or in part, of a Development Agreement previously entered into. The procedure for proposing and adoption of an amendment to or cancellation, in whole or in part, of a Development Agreement shall be the same as the procedure for entering into an Agreement in the first instance, including but not limited to the notice of and the public hearings as specified in this Chapter. In the event that a Development Agreement is canceled or terminated, all rights of the private party under the Development Agreement shall terminate. Except as otherwise provided in the Development Agreement, the City may, at its sole discretion, retain any and all benefits, including reservation or dedications of land, improvements constructed, and payments of fees, received by the City. Sec. 26.6.8-8. Review of Development Agreement. Every Development Agreement approved and executed in compliance with this Chapter shall be subject to City review, as specified in the Development Agreement, during the full term of the agreement, but in no case less than every twelve (12) months from the date of execution of the Agreement. The time for review may be amended either by agreement between the parties or by initiation of the City Council. Sec. 26.6.9. Reasonable Accommodation. Sec. 26.6.9-1. Applicability. A request for Reasonable Accommodation may be made by any person with a disability, or their representative, when the application of a zoning, land use or building regulation, policy or practice acts as a barrier to equal housing opportunities. If a Reasonable Accommodation request is approved, the request shall be granted to an individual and shall not run with the land unless the Director determines that: (a)The modification is physically integrated into the residential structure and cannot easily be removed or altered to comply with applicable codes; or Article VI. Special Regulations and Procedures. VI-25 Chapter 26. Comprehensive Zoning Ordinance (b)The accommodation is to be used by another disabled person. Sec. 26.6.9-2. Proceedings. A request for Reasonable Accommodation shall state the basis of the request including, but not limited to, a modification or exception to the regulations, standards and practices for the development and use of housing or housing-related facilities that would eliminate regulatory barriers and provide a disabled person equal opportunity to housing of his or her choice.ȱ The Director may request additional information necessary for making a determination on the request for Reasonable Accommodation that complies with the fair housing law protections and the privacy rights of the disabled person to use the specified housing. Sec. 26.6.9-3. Findings. The following findings must be analyzed, made, and adopted before any action is taken to approve or deny a request for Reasonable Accommodation: (a)The housing that is subject to the request will be used by an individual with a disability, as defined under Federal Fair Housing Amendments Act of 1988 and California's Fair Employment and Housing Act; (b)The request for Reasonable Accommodation is necessary to make specific housing available to an individual with a disability; (c)The requested Reasonable Accommodation would not impose an undue financial or administrative burden on the City; (d)The requested Reasonable Accommodation would not require a fundamental alteration in the nature of a City program or law, including, but not limited to, land use and zoning; and (e)There are no other alternative Reasonable Accommodations that may provide an equivalent level of benefit at a similar cost while providing greater consistency with the City’s laws and regulations. Sec. 26.6.9-4. Record of Reasonable Accommodation. The authorized signature of the Director or the City Council if the request was appealed, on a designated form, or a stamp approval on a set of plans, shall signify approval of a Reasonable Accommodation request. Sec. 26.6.10. Density Bonuses. Sec. 26.6.10-1. Compliance with State Law. The City hereby adopts by reference Government Code Sections 65915-65918 et seq. regarding density bonuses and other incentives for accommodating the development of housing for households of specified income or for senior citizens, as set forth in the statute. Article VII. Zoning Regulations for Adult or Sexually Oriented Businesses. VII-1 Chapter 26. Comprehensive Zoning Ordinance Article VII. Zoning Regulations for Adult or Sexually Oriented Businesses. VII Sec. 26.7.1. Purpose. It is the intent of this Article to prevent adverse economic impact to the businesses and residents of the City, and to take steps to minimize potential increased crime, increased incidence of communicable disease, decreased property values, and the deterioration of neighborhoods which can be brought about by the increase in the number of Adult or Sexually Oriented Businesses, or their location in close proximity to each other, or their proximity to other uses that are not compatible with Adult or Sexually Oriented Businesses. The City Council finds that it has been demonstrated in various communities that the concentration of Adult or Sexually Oriented Businesses causes a depreciation in property values, an increase in the number of transients in the area, an increase in crime, an increase in noise, litter, and vandalism, and in addition to the effects described above, can cause other businesses to move elsewhere. It is, therefore, the purpose of this Article to establish reasonable and uniform regulations to prevent any increase in the number of, and any further concentration of Adult or Sexually Oriented Businesses, or their close proximity to incompatible uses, while permitting the existence of existing Adult or Sexually Oriented Businesses in certain limited areas. The requirements and regulations set forth in this Article VII Zoning Regulations for Adult or Sexually Oriented Businesses are in addition to the requirements set forth in Article VI Business Permit Regulations for Adult or Sexually Oriented Businesses or Similar Businesses of Chapter 5 Business License Taxes and Other City Taxes of the Code which set forth requirements for obtaining a business license. Sec. 26.7.2. Definitions. As used herein, the terms and phrases shall have the same meaning as defined in Chapter 5 Business License Taxes and Other City Taxes, Article VI Business Permit Regulations for Adult or Sexually Oriented Businesses or Similar Businesses, Section 5.81, “Definitions,” et seq. of this Code. Sec. 26.7.3. Location Requirements. Sec. 26.7.3-1. Zone. Adult or Sexually Oriented Businesses shall be permitted only in the C-2 Overlay Zone. Sec. 26.7.3-2. Required Distances. No Adult or Sexually Oriented Business shall be opened as a new business, converted from an existing business, established, located, expanded, or operated within certain distances of certain specified land uses as set forth below: (a)No Adult or Sexually Oriented Business shall be established on a Lot located within one thousand (1,000) feet of any other Lot containing an Adult or Sexually Oriented Business, whether such other Lot is located inside or outside the City limits. The required minimum distance between any two Adult or Sexually Oriented Businesses shall be measured along the Street, whether public or private, from the nearest side or rear Lot lines of the Lots upon which such uses are located. (b)No person shall cause or permit the establishment or maintenance of more than one Adult or Sexually Oriented Business on the same Property. Article VII. Zoning Regulations for Adult or Sexually Oriented Businesses. Chapter 26. Comprehensive Zoning Ordinance VII-2 (c)No such business shall be established or located within one thousand (1,000) feet of any Residence, public park, recreational area, public building, Religious Use, school, boys’ club, girls’ club, or similar existing youth organization, Bar, pool hall, or liquor store, whether such other use is located inside or outside the City limits. The required minimum distance between an Adult or Sexually Oriented Business and such other specified uses shall be measured along the Street, whether public or private, from the nearest side or rear Lot lines, of the Lots upon which such uses are located. Article VIII. Zoning Regulations for Off-Site Outdoor Advertising Structures. VIII-1 Chapter 26. Comprehensive Zoning Ordinance Article VIII. Zoning Regulations for Off-Site Outdoor Advertising Structures. VIII Sec. 26.8.1. Application of Article. This Article shall apply to all commercial Outdoor Advertising Structures within the City that are not located on the same Lot as the goods or services being advertised. This Article does not apply to on- site or noncommercial Outdoor Advertising Structures. All legally established off-site commercial Outdoor Advertising Structures existing on the effective date of this Ordinance that are not in compliance with the requirements of this Article are Legal Nonconforming Uses. Sec. 26.8.2. Development Agreement Required. The installation, construction, modification, or replacement of any Outdoor Advertising Structure is permitted in the I Zone and all Overlay Zones, with the exception of the Housing Overlay Zone, subject to the approval of a Development Agreement between the City and applicant, with appropriate standards and terms to be negotiated with the City, and complying with all other conditions imposed by this Article. Sec. 26.8.3. General Conditions. Sec. 26.8.3-1. Sign Dimensions. (a)The sign face of an Outdoor Advertising Structure shall not exceed eight hundred fifty (850) square feet in area, including the border and trim, but excluding the base or apron supports and other structural members. (b)Cutouts and other special advertising features or additions to a sign face shall not project more than five (5) feet above the maximum height limit. (c)Bi-directional or double-faced signs shall be located on the same Outdoor Advertising Structure. For parallel double-faced signs, the distance between sign faces shall not exceed eight (8) feet. For “V-shaped” double-faced signs, the distance between sign faces shall not exceed thirty-five (35) feet at their widest point and shall not exceed eight (8) feet at their closest point. Sec. 26.8.3-2. Structure Design and Materials. Each Outdoor Advertising Structure shall have no more than two poles, and shall be constructed of noncombustible material. Sec. 26.8.3-3. Maximum Height. The overall height of each Outdoor Advertising Structure shall not exceed thirty-five (35) feet, exclusive of cutouts or special additions, measured from the higher of either: (a)The finished grade of the roadway adjacent to the Lot on which the Outdoor Advertising Structure is located and from which the advertising display is to be viewed, or (b)The finished grade of the base of the Outdoor Advertising Structure. Article VIII. Zoning Regulations for Off-Site Outdoor Advertising Structures. Chapter 26. Comprehensive Zoning Ordinance VIII-2 Sec. 26.8.3-4. Location. The location of the Outdoor Advertising Structures shall be restricted as follows: (a)An Outdoor Advertising Structure shall not be located within any required setback area of the Zone or Overlay Zone in which the Outdoor Advertising Structure is located. (b)Outdoor Advertising Structures shall not be located within five (5) feet of any Building or within ten (10) feet of any Lot line. (c)Outdoor Advertising Structures with Digital Displays that are located within two hundred (200) feet of the edge of the Right-of-way of the I-710 freeway and are designed to be primarily view from the I-710 freeway are subject to the following standards: (1)An Outdoor Advertising Structure with a Digital Display that is located within two hundred (200) feet of the edge of the Right-of-way of the I-710 freeway and designed primarily to be viewed from the I-710 freeway shall not be located within five hundred (500) feet of another Outdoor Advertising Structure with a Static Display located on the same side of the freeway or within one thousand (1,000) feet of another Outdoor Advertising Structure with a Digital Display located on the same side of the freeway and designed to be oriented toward the freeway; and (2)An Outdoor Advertising Structure with a Static Display that is located within two hundred (200) feet of the edge of the Right-of-way of the I-710 freeway and designed primarily to be viewed from the I-710 freeway shall not be located within five hundred (500) feet of any another Outdoor Advertising Structure located on the same side of the freeway and designed to be oriented toward the freeway. (d)Outdoor Advertising Structures constructed after the effective date of this Ordinance and not oriented towards the I-710 freeway shall not be located within two thousand five hundred (2,500) feet of another Outdoor Advertising Structure. (e)Outdoor Advertising Structures existing on the effective date of this Ordinance may not be replaced unless they are in conformity with the dimension, height, and location requirements specified herein. (f)For purposes of this Article, measurements shall be made along the edge of the Street from which the display on the Outdoor Advertising Structure is designed to be primarily viewed, from a line perpendicular to the centerline of that Street passing through the nearest edge of the existing sign, to a line perpendicular to the centerline passing through the nearest edge of the proposed Outdoor Advertising Structure, as shown in Diagram 26.8.3-4 Measurement for Outdoor Advertising Structures. Article VIII. Zoning Regulations for Off-Site Outdoor Advertising Structures. VIII-3 Chapter 26. Comprehensive Zoning Ordinance DIAGRAM 26.8.3-4 Sec. 26.8.3-5. Prohibited Outdoor Advertising Structures. The following types of signs shall not be permitted: (a)Any form of movement, animation, or the appearance of an optical illusion of movement, oscillating or rotating sign, or any other design intended to attract attention through movement or the semblance of movement of the whole or any part of the sign or any other method or device that suggests movement, except such movement of a permitted Digital Display associated with changing from one message to another; or (b)Inflatable objects; or (c)Flashing signs, containing illuminated light or other devices which are intermittently on and off, which change in intensity, or which create the illusion of flashing in any manner; or (d)Obscene or pornographic signs. Sec. 26.8.3-6. Safety and Appearance. (a)No Outdoor Advertising Structure, including its supporting structure and lighting, shall present any hazard to the safety of pedestrian or vehicular traffic by obstructing Article VIII. Zoning Regulations for Off-Site Outdoor Advertising Structures. Chapter 26. Comprehensive Zoning Ordinance VIII-4 the flow of such traffic, obstructing the sight lines required for the safe movement of pedestrian or vehicular traffic, interfering with the visibility and effectiveness of any traffic control or warning device, or in any other manner as determined by the Director. (b)All signs shall be designed and maintained to be compatible with the design and materials used in the structure on which the sign is located. (c)No sign face or sign area shall be added to an existing sign unless within a permanent frame or panel indicated for such purpose on approved plans for the total sign structure. (d)All signs shall be maintained in good condition and working order, as determined by the Director, and free of graffiti, peeling paint, faded colors, and broken and damaged materials. (e)All signs must have the sign owner’s name, address and telephone number conspicuously and permanently attached on the exterior of the sign. (f)The images on Digital Displays shall not change more than once every eight (8) seconds. The images shall change instantaneously, with no special effects or video. The brightness of the sign shall be such that the difference of ambient light measurement and the operating sign light turned on to full white copy shall be no greater than 0.3 foot-candles when measured from a distance as determined in the Development Agreement. Sec. 26.8.3-7. Political Signs. Political signs are permitted in the I Zone and all Overlay Zones as follows: (a)All of the terms of this Article VIII apply to political signs, except that signs pertaining to a particular election do not require a Conditional Use Permit. (b)All political signs pertaining to a particular election shall be removed within ten (10) days after the date of the election. (c)The candidate, committee, or any other authorized Person posting political signs shall ensure that all signs include the name, address, and the required committee identification number of the campaign or political organization, if any. (d)If the Director finds that any political sign has been posted or is being maintained in violation of the provisions of this Section, the Director may cause said sign to be removed without prior notice. (e)Any political sign that remains posted for more than fourteen (14) days after the election to which it pertains shall be deemed abandoned. Sec. 26.8.3-8. Continuation of Nonconforming Signs. Every nonconforming Outdoor Advertising Structure may remain in use unless and until it has been deemed to be abandoned, as described in this Section 26.8.3-8, “Continuation of Nonconforming Signs.” For purposes of this Article VIII. Zoning Regulations for Off-Site Outdoor Advertising Structures. VIII-5 Chapter 26. Comprehensive Zoning Ordinance Chapter, an Outdoor Advertising Structure shall be deemed to have been abandoned if no copy appears on the sign for a period of at least one hundred and eighty (180) consecutive calendar days, or it is otherwise relatively clear that the sign has been forsaken or deserted; provided, however, that political signs shall be deemed abandoned as set forth in Section 26.8.3-7(e). Sec. 26.8.3-9. Abandoned Outdoor Advertising Structures. All nonconforming Outdoor Advertising Structures that have been abandoned shall be brought into full conformity with this Article or be removed, without amortization or compensation. If an abandoned Outdoor Advertising Structure is in violation of the location requirements, it shall be removed. The Director may cause any abandoned signs and any signs which constitute an immediate peril to persons or property to be removed summarily and without prior notice. Article VIII. Zoning Regulations for Off-Site Outdoor Advertising Structures. Chapter 26. Comprehensive Zoning Ordinance VIII-6 Article IX. Zoning Regulations for Drive-through and Drive-up Facilities. IX-1 Chapter 26. Comprehensive Zoning Ordinance Article IX. Zoning Regulations for Drive-through and Drive-up Facilities. IX Sec. 26.9.1. Purpose. This Section provides locational and operational guidelines for retail trade or service uses providing drive-through and drive-up facilities to ensure that the facilities are designed and operated to effectively mitigate problems of congestion, excessive pavement, litter, noise, pedestrian safety, traffic, and unsightliness. Sec. 26.9.2. Application of Article. The Article shall apply to drive-through and drive-up facilities. Sec. 26.9.3. General conditions. Sec. 26.9.3-1. Inwardly focused. Drive-through aisles should be inwardly focused within the site and located away from adjoining streets and adjoining properties, wherever feasible. Sec. 26.9.3-2. Pedestrian walkways. Pedestrian walkways (including ADA access areas) should not intersect the drive-through access aisles, but where they do they shall have clear visibility and be emphasized by enhanced paving or markings. Sec. 26.9.3-3. No reduction in off-street parking. The provision of drive-through and drive-up service facilities shall not justify a reduction in the number of required off-street parking spaces. Sec. 26.9.3-4. Accommodation of waiting vehicles. (a)Drive-through access aisles should provide sufficient space before the menu board to accommodate at least five waiting vehicles and at least five waiting vehicles between the menu board and the drive-up service window. (b)Drive-through lanes shall be designed separately from drive-through access aisles and shall avoid the blocking of parking stalls or pedestrian access. Article IX. Zoning Regulations for Drive-through and Drive-up Facilities. Chapter 26. Comprehensive Zoning Ordinance IX-2 DIAGRAM 26.9.3-4 (a). Accommodation of Drive-through Vehicles Sec. 26.9.3-5. Menu and preview boards. Menu and preview boards may only be installed in compliance with all of the following requirements. (a)As practical, visibility of outdoor menu and preview boards should be minimized from any adjoining street(s). Additional landscape areas or shrub plantings may be required to provide proper screening. (b)Any proposed carhop and/or walk-up menu boards shall not exceed four square feet in area. Sec. 26.9.3-6. Noise. Amplification equipment (e.g., speakers at menu boards, piped music, etc.) shall be located so as not to adversely impact adjoining uses. Noise standards in Table 26.4.1-7(b)(2) Noise Standards shall apply to any amplification equipment. Article IX. Zoning Regulations for Drive-through and Drive-up Facilities. IX-3 Chapter 26. Comprehensive Zoning Ordinance Sec. 26.9.3-7. Prevention of headlight glare. Each drive-through aisle should be appropriately screened with a combination of landscaping, low walls, and/or berms maintained at a minimum height of three feet to prevent headlight glare from impacting adjacent streets, adjoining properties, and parking lots. Sec. 26.9.3-8. Wall required when adjoining residential uses. A minimum six-foot-high solid decorative masonry wall shall be constructed on each property line that adjoins a parcel zoned for and/or developed with a residential use. The design of the wall and the proposed construction materials shall be subject to review and approval through the Site Plan and Design Review process. A minimum five-foot-deep landscaping strip shall be provided between the wall and any driveway. Article IX. Zoning Regulations for Drive-through and Drive-up Facilities. Chapter 26. Comprehensive Zoning Ordinance IX-4 Article X. Enforcement X-1 Chapter 26. Comprehensive Zoning Ordinance Article X. Enforcement. X Sec. 26.10.1. Application of Article. This Article provides for the enforcement of penalties in the case of violation of any of the terms or provisions of this Chapter and of any permit or right or exception granted hereunder. The enforcement rights set forth herein are in addition to those provisions of the Code that also specifically set forth the City’s rights of enforcement and remedies available to the City. All of the provisions of the Chapter of the Code setting forth enforcement rights and remedies shall apply to any violation of any of the terms or provisions of this Chapter and of any permit or right or exception granted hereunder. Sec. 26.10.1-1. Violation. It is unlawful for any Person to violate any term or provision of this Chapter or any part hereof or any permit, license, or exception granted hereunder, or to fail to comply with any order or regulation made hereunder. Whenever a violation occurs, the violation shall include not only the act or omission constituting the violation, but it shall also include causing, allowing, permitting, aiding, abetting, suffering, withholding, or concealing the fact of such act or omission, or destroying or tampering the evidence associated with the act or omission. The provisions of this Chapter and all permits and rights granted hereunder shall apply to any Person, whether or not the Person was the original owner of the property or applicant for the permit, right, exception, or approval, and whether the Person is the owner, lessee, licensee, agent, or employee, if the Person has notice of the terms and conditions of the permit or approval. Sec. 26.10.1-2. Criminal and Civil Enforcement. The City may enforce violations as a criminal (infraction or misdemeanor), civil, or administrative action, or any combination thereof. Any Person who violates any term or provision of this Chapter or any part hereof or any permit, license, or exception granted hereunder, or who fails to comply with any order or regulation made hereunder is guilty of a misdemeanor; provided, however, that in the sole discretion of the City Attorney’s office, a violation may be prosecuted as an infraction where the City Attorney’s office has determined that such action would be in the best interest of justice. The City Attorney may specify in the citation, accusatory pleading, or by amendment during the prosecutorial process that the matter will be prosecuted as an infraction. Any Person who has violated any term or provision of this Chapter or any part hereof or any permit, license, or exception granted hereunder, or has failed to comply with any order or regulation made hereunder shall be subject to the criminal, civil, and administrative penalties set forth in the Code and otherwise provided by law. Sec. 26.10.1-3. Continuing Violations. A Person is guilty of a separate offense for each and every day, or any portion thereof, during which there is any violation or failure to comply as described in this Section 26.10.1, “Application of Article,” et seq. that is committed, continued, permitted, or allowed by such Person. Sec. 26.10.1-4. Voiding of Permit, Certificates, and Licenses. Any permit, certificate, or license issued in conflict with the provisions of this Chapter shall be void. Sec. 26.10.1-5. Public Nuisance. In addition to the penalties herein provided, any condition caused, or permitted to exist, in violation of any of the provisions of this Chapter or any part hereof or of any permit, license, or exception granted hereunder, or in violation of any order or regulation made Article X. Enforcement. Chapter 26. Comprehensive Zoning Ordinance X-2 hereunder is hereby declared to be unlawful and a public nuisance, and may be summarily abated as such by this City, and shall further be subject to injunctive relief granted by any court of competent jurisdiction. Each day or portion of a day that such condition continues shall be regarded as a new and separate offense. Sec. 26.10.1-6. Remedies. All remedies permitted under this Chapter or the Code shall be cumulative and not exclusive. Conviction and punishment of any Person hereunder shall not relieve such Person from the responsibility of correcting prohibited conditions or removing prohibited Buildings, structures, or improvements, and shall not prevent the enforced correction or removal thereof. Nothing in this Article shall prevent the City from using one or more other remedies to address violations of this Chapter. Sec. 26.10.1-7. Responsibility. The Director shall have principal responsibility for monitoring and enforcing the conditions and standards imposed on all land use standards and entitlements granted by the City pursuant to this Chapter. In accordance with the provisions of California Penal Code Section 836.5(a), employees of the Department of Public Works, Water and Development Services, as directed and designated from time to time by the Director, are hereby authorized to issue citations for violations of this Chapter. The procedures to be followed for the issuance of said citations are those that are or may be authorized from time to time by provisions of the California Penal Code. Sec. 26.10.1-8. Enforcement. In addition to any other remedy provided for in this Code or otherwise by law, the Director may take any or all of the following actions for any violation of this Chapter or of the terms and conditions of any permit or approval that may be provided for in this Chapter: (a)Institute proceedings to revoke or suspend any permit or approval, including, without limitation, a Variance, Conditional Use Permit, Minor Conditional Use Permit, or Temporary Use Permit; (b)Revoke the business license held by any violator in accordance with the provisions of Chapter 5, “Business License Taxes and Other City Tax Section,” 68, “Revocation and Suspension of Licenses of the Code”; (c)Impose an enforcement fee as provided for in Section 26.10.1-9, “Enforcement Fees”; (d)Cause to be issued an administrative citation or compliance order as provided for in the Code; (e)Institute proceedings against a Person with multiple violations of the Code for “unfair business practices” under California Business and Professions Code Section 17200; (f)Request that the City Attorney take appropriate enforcement action. Referral by the Director is not a condition precedent to any enforcement action by the City Attorney. Article X. Enforcement X-3 Chapter 26. Comprehensive Zoning Ordinance Sec. 26.10.1-9. Enforcement Fees. (a)An enforcement fee may be imposed by the City against each Person who has violated the provisions of this Chapter or the terms and conditions of any permit, license, exception, or approval that has been provided pursuant to this Chapter. The purpose of this fee is to recover the costs of enforcement from any Person who violates the provisions of this Chapter or any permit, license, exception, or approval granted hereunder. The City Council shall establish the enforcement fees by Resolution, and may, from time to time, amend such fees. (b)The Director shall cause to be issued a notice imposing fees under this Section. The notice shall provide that the fee shall be due and payable within fifteen (15) days from the date of the notice. A penalty of ten percent (10%) per month shall be added to any fees that have not been paid when due. (c)Any person upon whom fees have been imposed pursuant to this Section may appeal the action in accordance with the following procedure: (1)A notice of appeal shall be filed with the Director within ten (10) days of the date of the notice. (2)At the time of filing the notice of appeal, the appellant shall deposit with the City Treasurer money in the amount of all fees due. If, as a result of the hearing, it is determined that the City is not entitled to all or a portion of the money, the City shall refund to the Person all or a portion of the money deposited. (3)The City Council shall hold a hearing on the appeal within sixty (60) days of the date of filing of the appeal. The City shall give the appellant at least five (5) days notice of the time and place of the hearing. The City Council shall render a decision within fifteen (15) days of the date of the hearing. The hearing may be continued if additional information is required in order to allow the City Council to render a decision. The purpose of the hearing shall be limited to whether or not the violation occurred. (4)The decision of the City Council shall be final except for judicial review. (5)Any notice issued pursuant to this Section shall set forth the appeal rights as provided for in this Section. Sec. 26.10.1-10. Business License Revocation or Suspension. (a)Notwithstanding any other provision of this Code, the Director may suspend a business license for thirty (30) days or less, or may revoke a business license issued pursuant to this Code, if the holder of such business license has violated the provisions of this Chapter or the terms and conditions of any permit or approval issued hereunder, in accordance with the procedure set forth in this Section. Article X. Enforcement. Chapter 26. Comprehensive Zoning Ordinance X-4 (b)Upon being notified of a second violation of this Chapter, or the terms and conditions of any permit or approval granted hereunder, within a three (3) year period from the date of the first violation, the Director shall notify the Person that a third violation within such three (3) year period may result in the suspension or revocation of the Person’s business license. (c)Upon being notified of a third violation of this Chapter, or the terms and conditions of any permit or approval granted hereunder within a three year period from the date of the first violation, the Director may notify the Person of the revocation or suspension of the Person’s business license. (d)Any notice of revocation or suspension issued pursuant to this Section shall be final upon the expiration of the appeal period if no appeal is timely filed or upon the decision of the City Council if an appeal is filed. (e)Any Person may appeal the suspension or revocation of the business license in accordance with the following procedures: (1)A notice of appeal shall be filed with the Director within fourteen (14) days from the date of the notice of revocation or suspension. (2)The City Council shall hold a hearing on the appeal within sixty (60) days of the date of the filing of the appeal. The City Council shall give the appellant at least ten (10) days notice of the time and place of the hearing. The City Council shall render a decision within fifteen (15) days of the date of the hearing. (3)The decision of the City Council shall be final except for judicial review. (4)Any notice revoking or suspending a business license pursuant to this Section shall set forth the appeal rights as provided for in this Section. Zoning Map Chapter 26. Comprehensive Zoning Ordinance Article X. Enforcement. Chapter 26. Comprehensive Zoning Ordinance X-2 Attachment C BANDINI BLVD61st StFruitland Av58th St60th StE WASHINGTON BLVD56th StSLAUSON AVRANDOLPH STS SANTA FE AVEAlcoa AvDistrict BlvdSoto St54th StS Boyle AvPacific Blvd52nd StE Vernon AvGifford AvE Slauson AvFruitland AvLOS ANGELES RIVERMaywood AvFishburn AvPine AvE 26Th StE 50th StLEONIS BLVDKing AvE 46th StMalabar StSeville AvClarendon Avkes St59th PlCorona AvE VERNON AV57th StUNION PACIFIC RRBURLINGTON NORTHERN SANTA FE RRE 27th StCarmelita Av52Nd PlE 58th StE 44th StMiles AvE 49th StE 52nd StFRUITLAND AVE 54th StAlcoa AvIndiana StE 56th StE 54th StArbutus AvMalburg WyExchange AvViolet AlBickett StAyers AvMaywood AvHampton StCharter St60th PlE 45th StBelgrave AvS Indiana StSierra Pine AvBANDINI BLVDLOS ANGELES JUNCTION RRUNION PACIFIC RRSPackers AvSeville AvChambers StHolabird AvFurlong PlAlcoa Av53rd St55th StUNION PACIFIC RRBURLINGTON NORTHERN SANTA FE RRE 49Th StSheila St61st StBelgrave AvDISTRICT BLVD StAyers AvIrving S t RANDOLPH STLoma Vista Av57th StEverett AvLoma Vista AvE 37TH STE SLAUSON AVPACIFIC BLVDE 28th ST30th StBOYLE AVSOTO STS Soto StS Santa Fe AvS Santa Fe AvSeville AvDOWNEY RDS ATLANTIC BLVDE 50th St52nd St54th St56th St58th St55th St58th StMayflower Av61st Pl61st StVernon City BoundaryVernon Sphere of InfluenceFreewayBase Mapncy Shelterrcial-1 Attachment D PUBLIC WORKS, WATER & DEVELOPMENT SERVICES OFFICE MEMORANDUM TO: Kevin Wilson, Director of Public Works, Water & Development Services FROM: Sergio Canales, Assistant Planner DATE: February 12, 2014 SUBJECT: Community Input Workshop Summary A “Zoning Ordinance Amendment flyer” was mailed to all interest parties and property owners in the City in January, 2015. The mailing was an invitation to attend one of two community workshops to discuss and provide input on the proposed revisions. Both workshops took place at Vernon City Hall Council Chambers. Comments received during the Community Workshops held on January 26th and February 5th regarding the proposed revisions are summarized in this memo. COMMENTS Residential Overlay x Long term property owner suggested that the City allow existing buildings to be used as lofts , art studios with living quarters etc. They mentioned that the City should not restrict locations for housing development, because in people eyes it seems that the only properties that can be developed are city owned properties. Instead of encouraging housing development…..it all looks one-sided. Retail and Commercial use x Why restrict wholesale businesses from doing retail. As it is, the majority of the wholesalers in Vernon are doing some type of retail. Why not make it easy for retailers, don’t restrict property owners/business owners from expanding its uses. x Owners should not be restricted from renting or leasing existing office space within their existing building and shall not limit ancillary uses. Owners rather see the space occupied rather than vacant Landscape requirement (5%) x Concern that the landscape requirement will be taking-up future parking and loading spaces, because of the increase it would also prevent more development for these smaller property sites. Attachment E Supplemental Environmental Impact Report (State Clearinghouse No. 2007061031) City of Vernon Focused General Plan and Zoning Ordinance Update Lead Agency: City of Vernon 4305 Santa Fe Avenue Vernon, CA 90058 December 2014 Volume 1 &LW\RI9HUQRQ *HQHUDO3ODQDQG =RQLQJ2UGLQDQFH8SGDWH 'UDIW6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW 6&+ 'HFHPEHU &LW\RI9HUQRQ 7KLVGRFXPHQWLVGHVLJQHGIRUGRXEOHVLGHGSULQWLQJWRFRQVHUYHQDWXUDO UHVRXUFHV 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW L Table of Contents Section Page 1.0 – Introduction .................................................................................1.0-1 Legal Requirements ................................................................................ 1.0-1 Purpose of the Program EIR ..................................................................... 1.0-1 Purpose of the Supplemental EIR .............................................................. 1.0-2 Responses to Notice of Preparation ........................................................... 1.0-4 Availability of Draft Supplemental EIR ........................................................ 1.0-6 Comments Requested ............................................................................. 1.0-7 Organization of this EIR ........................................................................... 1.0-7 Approach to EIR Analysis ......................................................................... 1.0-7 2.0 – Executive Summary ..................................................................... 2.0-1 Project Summary .................................................................................... 2.0-1 Project Location ...................................................................................... 2.0-2 Environmental Setting ............................................................................. 2.0-2 Environmental Impacts ............................................................................ 2.0-2 Issues to be Resolved .............................................................................. 2.0-7 Areas of Potential Controversy .................................................................. 2.0-7 Alternatives to the Proposed Project .......................................................... 2.0-7 3.0 – Project Description ...................................................................... 3.0-1 Project Title ........................................................................................... 3.0-1 Lead Agency Name and Address ............................................................... 3.0-1 Contact Person and Phone Number ............................................................ 3.0-1 Project Location ...................................................................................... 3.0-1 Project Sponsor’s Name and Address ......................................................... 3.0-1 General Plan Land Use Designation ........................................................... 3.0-1 Zoning District ....................................................................................... 3.0-1 Project Background ................................................................................. 3.0-1 Project Description .................................................................................. 3.0-2 4.0 – Environmental Impact Analysis ................................................... 4.1-1 4.1 Air Quality .................................................................................... 4.1-1 4.2 Hazards and Hazardous Materials ..................................................... 4.2-1 4.3 Noise ........................................................................................... 4.3-1 4.4 Transportation and Traffic ............................................................... 4.4-1 4.5 Utilities and Service Systems ........................................................... 4.5-1 5.0 – Alternatives ................................................................................. 5.0-1 Alternative Project Location ...................................................................... 5.0-1 Alternative 1: No Project.......................................................................... 5.0-2 Alternative 2: Additional Railway/Roadway Grade Separations ...................... 5.0-4 Alternative 3: Zoning Provisions to Permit Warehousing Citywide .................. 5.0-5 Alternative 4: No Truck and Freight Terminal Overlay .................................. 5.0-5 7DEOHRI&RQWHQWV LL )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH Relative Comparison of Impacts ................................................................ 5.0-6 6.0 – Analysis of Long Term Effects ...................................................... 6.0-1 Cumulative Impacts ................................................................................ 6.0-1 Growth Inducing Impacts ........................................................................ 6.0-4 Energy Conservation .............................................................................. 6.0-5 Significant Irreversible Environmental Changes ........................................... 6.0-9 Unavoidable Significant Environmental Impacts .......................................... 6.0-9 7.0 – Effects Found Not to Be Significant .............................................. 7.0-1 8.0 – Preparation Team ........................................................................ 8.0-1 Lead Agency .......................................................................................... 8.0-1 Environmental Analysis ............................................................................ 8.0-1 Transportation and Traffic ........................................................................ 8.0-1 9.0 – Organizations and Persons Consulted .......................................... 9.0-1 Volume II – Appendix (Under Separate Cover) Appendix A: Notice of Preparation/Initial Study Appendix B: Air Quality Data Appendix C: Traffic Impact Analysis ,QWURGXFWLRQ ([HFXWLYH6XPPDU\ 3URMHFW'HVFULSWLRQ (QYLURQPHQWDO,PSDFW$QDO\VLV $OWHUQDWLYHV $QDO\VLVRI/RQJ7HUP(IIHFWV (IIHFWV)RXQG1RWWREH6LJQLILFDQW 3UHSDUDWLRQ7HDP 5HIHUHQFHV ,QWURGXFWLRQ ([HFXWLYH6XPPDU\ 3URMHFW'HVFULSWLRQ (QYLURQPHQWDO,PSDFW$QDO\VLV $OWHUQDWLYHV $QDO\VLVRI/RQJ7HUP(IIHFWV (IIHFWV)RXQG1RWWREH6LJQLILFDQW 3UHSDUDWLRQ7HDP 5HIHUHQFHV 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW Introduction 1.0 7KLV6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW6XSSOHPHQWDO(,5HYDOXDWHVWKH HQYLURQPHQWDO HIIHFWV DVVRFLDWHG ZLWK WKH DGRSWLRQDQGLPSOHP HQWDWLRQ RI WKH IRFXVHG *HQHUDO 3ODQ DQG=RQLQJ2UGLQD QFH XSGDWH 7KH&L W\ FRPSOHWHG DQG FHUWLILHGD3URJUDP(,5ZKLFKDQDO\]HGDFRPSUHKHQVLYH*HQHUDO3ODQXSGDWHDQG UHYLVHG =RQLQJ 2UGLQDQFH 7KHDGRSWLRQ DQGLPSOHPHQWDWLR Q RID*HQHUDO3ODQ XSGDWHDQG=RQLQJ2UGLQDQFHUHYLVLRQFRQVWLWXWHD³SURMHFW´IRUWKHSXUSRVHVRIWKH &DOLIRUQLD(QYLURQPHQWDO4XDOLW\$FW&(4$DQGWKH6WDWH&(4$*XLGHOLQHV7KXV WKLV6XSSOHPHQWDO(,5KDVEHHQSUHSDUHGWRDGGUHVVWKHLPSDFWVDVVRFLDWHGZLWK WKLVSURMHFWDQGLQUHODWLRQWRWKHFHUWLILHG(,5 Legal Requirements 7KLV 6XSSOHPHQWDO (,5 KDV EHHQ SUHSDUHG LQ DFFRUGDQFH ZLWK WKH&DOLIRUQLD (QYLURQPHQWDO4XDOLW\$FWRI3XEOLF5HVRXUFHV&RGH6HFWLRQHWVHT WKH*XLGHOLQHVIRU,PSOHPHQWDWLRQRI&(4$SXEOLVKHGE\WKH5HVRXUFHV$JHQF\R I WKH6WDWHRI&DOLIRUQLD&DOLIRUQLD&RGHRI5HJXODWLRQV6HFWLRQHWVHTDQG WKH&LW\RI9HUQRQ¶V/RFDO*XLGHOLQHVIRU,PSOHPHQWLQJWKH&DOLIRUQLD(QYLURQPHQWDO 4XDOLW\$FW 7KHUHSRUWZDVSUHSDUHGE\SURIHVVLRQDOHQYLURQPHQWDOFRQVXOWDQWVXQGHUFRQWUDFW WRWKH&LW\RI9HUQRQ7KH&LW\RI9 HUQRQLVWKHOHDGDJHQF\IRUWKHSUHSDUDWLRQRI WKLV(,5DVGHILQHGE\&(4$3XEOLF5HVRXUFHV&RGH6HFWLRQDVDPHQGHG 7KHFRQWHQWRIWKLVGRFXPHQWUHIOHFWVWKHLQGHSHQGHQWMXGJPHQWRIWKH&LW\ Purpose of the Program EIR 7KHFHUWLILHG3URJUDP(,5ZDVLQWHQGHGWRSURYLGHLQIRUPDWLRQWRSXEOLFDJHQFLHV WKHJHQHUDOSXEOLFDQGGHFLVLRQPDNHUVUHJDUGLQJSRWHQWLDOHQYLURQPHQWDOLPSDFWV UHODWHG WR WKH DGRSWLRQ DQG ORQJWHUP LPSOHPHQWDWLRQ RI WKHXSGDWH G 9HUQRQ *HQHUDO 3ODQDQGUHYLVHG=RQ LQJ 2UGLQDQFH 7KHSXUSRVH RI DQ(,5XQGHUWKH SURYLVLRQVRI&(4$LV³WRLGHQWLI\WK HVLJQLILFDQWHIIHFWVRQWKHHQYLURQPHQWRID SURMHFWWRLGHQWLI\DOWHUQDWLYHVWRWKHSURMHFWDQGWRLQGLFDWHWKHPDQQHULQZKLFK WKRVH VLJQLILFDQW HIIHFWV FDQ EH PLWLJDWHG RUDYR LGHG´ 3XEOLF5HVRXUFHV&RGH 6HFWLRQ>D@ 7KHFHUWLILHG(,5ZDVD3URJUD P(,5XQGHUWKHSUR YLVLRQVRI6HFWLRQRIWKH 6WDWH &(4$ *XLGHOLQHV $FFRUGLQJ WR 6HFWLRQ RIWKH &(4$*XLGHOLQHV D 3URJUDP(,5PD\EHSUHSDUHGRQDVHULHVRIDFWLRQVWKDWFDQEHFKDUDFWHUL]HGDV RQH ODUJH SURMHFW DUHUHODWHG JHRJUDSKLFDOO\ DQG UHSUHVHQW ORJLFDO SDUWV LQ WKH FKDLQRIFRQWHPSODWHGDFWLRQVLQFRQQHFWLRQZLWKLVVXDQFHRIUXOHVUHJXODWLRQVRU SODQV7KH3URJUDP(,5DOORZVIRUDPRUHH[KDXVWLYHFRQVLGHUDWLRQRIHIIHFWVDQG DOWHUQDWLYHV WKDQZRXOGEHSUDFWLFDO LQ (,5V RQ VHSDUDWH LQGLYLGXDO DFWLRQV $ 3URJUDP(,5DOORZVIRUFRQVLGHUDWLRQRIFXPXODWLYHLPSDFWVWKDWPLJKWQRWEHIXOO\ FRQVLGHUHGRQDFDVHE\FDVHEDVLV ,QWURGXFWLRQ )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH 7KHFHUWLILHG3URJUDP(,5SURYLGHVDILUVWWLHUDQDO\VLVRIWKHHQYLURQPHQWDOHIIHFWV RIWKH9HUQRQ*HQHUDO3ODQXSGDWHDQGUHYLVHG=RQLQJ2UGLQDQFH6HFWLRQRI WKH &(4$*XLGHOLQH V LQGLFDWHV WKDWWLHULQ J LV DSSURSULDWH ZKHQWKH VHTXHQFH RI DQDO\VLVLVIURPDQ(,5SUHSDUHGIRUDJHQHUDOSODQSROLF\RUSURJUDPWRDQ(,5RU QHJDWLYHGHFODUDWLRQIRUDQRWKHUSODQSROLF\RU SURJUDPRIOHVVHUVFRSHRUWRD VLWH VSHFLILF (,5 RUQHJDWL YH GHFODUDWLRQ 6XEVHTX HQW DFWLYLWLHVSXUVXD QW WRWK H XSGDWHG9HUQRQ*HQHUDO3ODQDQGUHYLVHG=RQLQJ2UGLQDQFHPXVWEHH[DPLQHGLQ OLJKWRIWKHFHUWLILHG3URJUDP(,5WRGHWHUPLQHZKHWKHUDQDGGLWLRQDOHQYLURQPHQWDO GRFXPHQWPXVWEHSUHSDUHG,IDVXEVHTXHQWSURMHFWRUODWHUDFWLYLW\ZRXOGKDYH HIIHFWVWKDWZHUHQRWH[DPLQHGLQWKHFHUWLILHG3URJUDP(,5RUQRWH[DPLQHGDWDQ DSSURSULDWHOHYHORIGHWDLOWREHXVHGIRUWKHODWHUDFWLYLW\DQLQLWLDOVWXG\ZRXOG QHHGWREHSUHSDUHGOHDGLQJWRDQHJDWLYHGHFODUDWLRQRUDQ(,5,IWKH&LW\ILQ GV WKDWSXUVXDQWWR6HFWLRQRIWKH&(4$*XLGHOLQHVQRQHZHIIHFWVFRXOGRFFXU RUQRQHZPLWLJDWLRQPHDVXUHVZRXOGEHUHTXLUHGRQDVXEVHTXHQWSURMHFWWKH&LW\ FDQDSSURYHWKHDFWLYLW\DVEHLQJZLWKLQWKHVFRSHRIWKHSURMHFWFRYHUHGE\WKH FHUWLILHG3URJUDP(,5DQGQRQHZHQYLURQPHQWDOGRFXPHQWDWLRQZRXOGEHUHTXLUHG Purpose of the Supplemental EIR &(4$ DXWKRUL]HV D /HDG RU 5HVSRQVLEOH $JHQF\WRSUHSDUH D6XSSOH PHQW WRD SUHYLRXVO\FHUWLILHG(,5LIVRPHFKDQJHVRUDGGLWLRQVDUHQHFHVVDU\WRDSUHYLRXVO\ DQDO\]HGSURMHFWDQGWKHFRQGLWLRQVGHVFULEHGLQ&(4$*XLGHOLQHVDUHPHW 3XUVXDQWWR6HFWLRQRIWKH&(4$*XLGHOLQHVD6XEVHTXHQW(,5RU1HJDWLYH 'HFODUDWLRQPD\RQO\EHSUHSDUHGLI D :KHQDQ(,5KDVEHHQFHUWLILHGRUDQ HJDWLYHGHFODUDWLRQDGRSWHG IRUDSURMHFWQRVXEVHTXHQW(,5VKDOOEHSUHSDUHGIRUWKDWSUR MHFW XQOHVV WKH OHDGDJH QF\ GHWHUPLQHVRQ WKHEDVLVRIVXE VWDQWLDO HYLGHQFH LQ WKH OLJKW RI WKH ZKROHUHFRUG RQH RU PRUH RI WKH IROORZLQJ 6XEVWDQWLDO FKDQJHV DUH SURSRVHG LQWKH SURMHFWZ KLFK ZLOO UHTXLUH PDMRU UHYLVLRQVRIWK H SUHYLRXV (,5RUQHJDWLYH GHFODUDWLRQ GXHWR WKHLQYROYHP HQW RIQHZ VLJQLILFDQW HQYLURQPHQWDO HIIHFWV RU D VXEVWDQWLDO LQFUHDVH LQWKH VHYHULW\RISUHYLRXVO\LGHQWLILHGVLJQLILFDQWHIIHFWV 6XEVWDQWLDOFKDQJHVRFFXUZLWKUHVSHFWWRWKHFLUFXPVWDQFHV XQGHU ZKLFKWKH SURMHFW LVX QGHUWDNHQ ZKLFKZ LOO UHTXLUH PDMRUUHYLVLRQVRIWKHSUHYLRXV(,5RUQHJDWLYHGHFODUDWLRQ GXH WRWK H LQYROYHPHQW RI QHZ VLJQLILFDQWHQ YLURQPHQWDO HIIHFWVRUDVXEVWDQWLDOLQFUHDVHLQWKHVHYHULW\RISUHYLRXVO\ LGHQWLILHGVLJQLILFDQWHIIHFWVRU 1HZ LQIRUPDWLRQ RI VXEVWDQWLDO LPSRUWDQFH ZKLFKZDVQRW NQRZQDQGFRXOGQRWKDYHEHHQNQRZQ ZLWKWKHH[HUFLVHRI UHDVRQDEOH GLOLJHQFH DWWKHW LPH WKH SUHYLRXV (,5 ZDV FHUWLILHG DV FRPSOHWH RU WKH QHJDWLYHGH FODUDWLRQ ZDV DGRSWHGVKRZVDQ\RIWKHIROORZLQJ ,QWURGXFWLRQ 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW $ 7KH SURMHFW ZLOOK DYH RQHRU PRUH VLJQLILFDQW HIIHFWV QRW GLVFXVVHG LQ WKH SUHYLRXV(, 5 RUQ HJDWLYH GHFODUDWLRQ % 6LJQLILFDQW HIIHFWVSUHYLRX VO\ H[DPLQHG ZLOOEH VXEVWDQWLDOO\PRUHVHYHUHWKDQVKRZQLQWKHSUHYLRX V (,5 & 0LWLJDWLRQ PHDVXUHV RU DOWHUQDWLYHV SUHYLRXVO\ IRXQG QRWWREHIHDVLEOHZRXOGLQIDFWEHIHDVLEOHDQGZRXOG VXEVWDQWLDOO\UHGXFHRQHRUPR UHVLJQLILFDQWHIIHFWVRI WKH SURMHFW EXWWKH SURMHFW SURSRQHQWV GHFOLQH WR DGRSWWKHPLWLJDWLRQPHDVXUHRUDOWHUQDWLYHRU ' 0LWLJDWLRQ PHDVXUHV RUD OWHUQDWLYHV ZKLFK DUH FRQVLGHUDEO\ GLIIHUHQW IURP WKRVH DQDO\]HGLQWKH SUHYLRXV(,5ZRXOGVXEVWDQWLDOO\UHGXFHRQHRUPRUH VLJQLILFDQWHIIHFWVRQWKHHQYLURQPHQWEXWWKHSURMHFW SURSRQHQWVGHFOLQHWRDGRSWWKHPLWLJDWLRQPHDVXUHRU DOWHUQDWLYH E ,I FKDQJHV WRDS URMHFW RU LWVFL UFXPVWDQFHV RFFXUR U QHZ LQIRUPDWLRQ EHFRPHVDYDLOD EOH DIWHU DGRSWLRQ RIDQHJDWLYH GHFODUDWLRQ WKHOHDG DJHQF\VKDOOSUHS DUH DVXE VHTXHQW (,5 LI UHTXLUHG XQGHU VXEGLYLVLRQ D 2 WKHUZLVH WKH OHDG DJHQF\ VKDOO GHWHUPLQHZKHWKHUWRSUHSD UHDVXEVHTXHQWQHJDWLYHGHFODUDWLRQ DQDGGHQGXPRUQRIXUWKHUGRFXPHQWDWLRQ F 2QFHDSURMHFWKDVEHHQDSSURYHGWKHOHDGDJHQF\ VUROHLQSURMHFW DSSURYDOLVFRPSOHWHGXQOHVVIXUWKHUGLVFUHWLRQDU\DSSURYDORQWKDW SURMHFWLVUHTXLUHG,QIRUPDWLRQDSSHDULQJDIWHUDQDSSURYDOGRHV QRW UHTXLUH UHRSHQLQJ RIWKDWDSSURYDO ,IDIWHUWKHSURM HFW LV DSSURYHGDQ\RIWKHFRQGLWLRQVGHVFULEHGLQVXEGLYLVLRQDRFFXUV DVXEVHTXHQW(,5RUQHJDWLYHGHFODUDWLRQVKDOORQO\EHSUHSDUHGE\ WKHSXEOLFDJHQF\ZKLFKJUDQWVWKHQH[WGLVFUHWLRQDU\DSSURYDOIRU WKHSURMHFWLIDQ\,QWKLVVL WXDWLRQQRRWKHUUHVSRQVLEOHDJHQF\ VKDOOJUDQWDQDSSURYDOIRUWKHSURMHFWXQWLOWKHVXEVHTXHQW(,5KDV EHHQFHUWLILHGRUVXEVHTXHQWQHJDWLYHGHFODUDWLRQDGRSWHG G $VXEVHTXHQW(,5RUVXEVHTXHQWQHJDWLYHGHFODUDWLRQVKDOOEHJLYHQ WKHVDPHQRWLFHDQGSXEOLFUHYLHZDVUHTXLUHGXQGHU6HFWLRQ RU6HFWLRQ$VXEVH TXHQW(,5RUQHJDWLYHGHFODUDWLRQVKDOO VWDWH ZKHUH WKHSUHYLRX V GRFXPHQW LV DYDLODEOH DQGFDQ EH UHYLHZHG 3XUVXDQWWR&(4$*XLGHOLQHV6HFWLRQ D 7KH /HDG RU 5HVSRQVLEOH $JHQF\ PD\ FKRRVH WRS UHSDUH D 6XSSOHPHQWWRDQ(,5UDWKHUWKDQD6XEVHTXHQW(,5LI DQ\ RI WKHF RQGLWLRQV GHVFULEHG LQ6HFWLRQ ZRXOG UHTXLUHWKHSUHSDUDWLRQRID6XEVHTXHQW(,5DQG RQO\PLQRUDGGLWLRQVRUFKDQJHVZRXOGEHQHFHVVDU\WRPDNH WKH SUHYLRXV (,5DG HTXDWHO\ DSSO\ WR WKHSURMH FW LQWKH FKDQJHGVLWXDWLRQ ,QWURGXFWLRQ )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH E 7KH VXSSOHPHQWWR WKH(,5QHHGFR QWDLQ RQO\WKHLQIRUPDWLR Q QHFHVVDU\WRPDNHWKHSUHYLRX V(,5DGHTXDWHIRUWKHSURMHFWDV UHYLVHG F $VXSSOHPHQWWRDQ(,5VKDOOEHJLYHQWKHVDPHNLQGRIQRWLFHDQ G SXEOLFUHYLHZDVLVJLYHQWKHGUDIW(,5XQGHU6HFWLRQ G $ VXSSOHPHQW WRDQ (,5 PD\ EH FLUFXODWHG E\ LWVHOI ZLWKRXW UHFLUFXODWLQJWKHSUHYLRXVGUDIWRUILQDO(,5 H :KHQ WKH DJHQF\ GHFLGHV ZKHWKHU WR DSSURYH WKH SURMHFW WKH GHFLVLRQPDNLQJERG\VKDOOFRQVLGHUWKHSUHYLRXV(,5DVUHYLVHG E\ WKH VXSSOHPHQWDO (,5 $ILQGLQJXQGHU 6HFWLRQ VKDOO EH PDGH IRU HDFK VLJQLILFDQW HIIHFW VKRZQ LQWKH SUHYLRXV (,5 DV UHYLVHG 7KHUHIRUHLQDFFRUGDQFHZLWK&(4$*XLGHOLQHV6HFWLRQWKH&LW\DVWKH/HDG $JHQF\KDVSUHSDUHGWKLV6XSSOHPHQWWRWKHSUHYLRXVO\FHUWLILHG*HQ HUDO3ODQDQG =RQLQJ2UGLQDQFH8SGDWH3URJUDP(QYLURQPHQWDO,PSDFW5HSRUW7KLV(,5VHUYH V DV DQLQIR UPDWLRQ GRFXPHQW IRUXVHE \ SXEOLFDJ HQFLHV WKH JHQHUDO SXEOLF DQG GHFLVLRQ PDNHUV 7KLV (,5 LV QRW D& LW\ RI 9HUQRQSROLF\GRFX PHQW ,WG RHV KRZHYHUGLVFXVVWKHLPSDFWVRIGHYHORSPHQWSXUVXDQWWRWKHXSGDWHG*HQHUDO3ODQ DQGUHYLVHG=RQLQJ2UGLQDQFHDQGDQDO\]HVSURMHFWDOWHUQDWLYHV7KLV3URJUDP(,5 ZLOO EHX VHG E\WK H &LW\R I 9HUQRQ &LW\ &RXQFLO LQDVVHVVLQJLPS DFWV SULRU WR DGRSWLRQRIWKHXSGDWHG*HQHUDO3ODQDQGUHYLVHG=RQLQJ2UGLQDQFH Responses to Notice of Preparation 7RGHILQHWKHVFRSHRIWKHLQYHVWLJDWLRQRIWKHFHUWLILHG3URJUDP(,5WKH&LW\R I 9HUQRQ GLVWULEXWHG D 1RWLFH RI 3UHSDUDWLRQ 123 WRFLW\FRXQW\ DQGVWDW H DJHQFLHV RWKHUS XEOLF DJHQFLHV DQG LQWHUHVWHG SULYDWHRUJD QL]DWLRQV DQG LQGLYLGXDOV7KHSXUSRVH RIWKH123ZDVWRLGHQWLI\DJHQF\DQGSXEOLFFRQFHUQV UHJDUGLQJ SRWHQWLDO LPSDFWVR I WKHSURS RVHG SURMHFW &R PPHQW OHWWHUV RQ WKH FHUWLILHG3URJUDP(,5ZHUHUHFHLYHGIURPWKHIROORZLQJ 6DQ*DEULHO /RZHU/RV$QJHOHV5LYHUVDQG0RXQWDLQV&RQVHUYDQF\ 3XEOLF8WLOLWLHV&RPPLVVLRQ 1DWLYH$PHULFDQ+HULWDJH&RPPLVVLRQ 6RXWK&RDVW$LU4XDOLW\0DQDJHPHQW'LVWULFW &DOLIRUQLD'HSDUWPHQWRI7UDQVSRUWDWLRQ'LVWULFW 6RXWKHUQ&DOLIRUQLD$VVRFLDWLRQRI*RYHUQPHQWV 7KHFRPPHQWVZHUHDGGUHVVHGLQWKHFHUWLILHG3URJUDP(,5DVIROORZV Commenting Agency/Person Comment Addressed in EIR 6DQ*DEULHO /RZHU/RV $QJHOHV5LYHUVDQG0RXQWDLQV &RQVHUYDQF\50& 7KH50&HQFRXUDJHVRSHQ VSDFHMRLQWXVHVDORQJWKH/RV $QJHOHV5LYHUFRUULGRUIRU SURWHFWLRQRIWKLVZDWHUVKHG DVVHW7KH50&ZHOFRPHVWKH RSSRUWXQLW\WRUHYLHZWKH SURMHFW 3DJHRIWKH,QLWLDO6WXG\ $SSHQGL[$DGGUHVVHV ZDWHUVKHGDQGZDWHUTXDOLW\ LVVXHV7KHDQDO\VLVFRQFOXGHV WKDWLPSDFWZLOOEHOHVVWKDQ VLJQLILFDQWZLWKFRQWLQXHG LPSOHPHQWDWLRQRI1DWLRQDO ,QWURGXFWLRQ 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW Commenting Agency/Person Comment Addressed in EIR 3ROOXWLRQ'LVFKDUJH(OLPLQDWLRQ 6\VWHP13'(6UHTXLUHPHQWV 7KHRSHQVSDFHFRPPHQWLV QRWUHOHYDQWWRWKH(,5 3XEOLF8WLOLWLHV&RPPLVVLRQ 7KH*HQHUDO3ODQXSGDWH VKRXOGLQFOXGHODQJXDJHWR DGGUHVVUDLOVDIHW\SDUWLFXODUO\ ZLWKUHJDUGWRDWJUDGH UDLOURDGZD\FURVVLQJV 7KLVFRPPHQWGRHVQRWUDLVH DQHQYLURQPHQWDOFRQFHUQQRU DVNWKDWWKH(,5DGGUHVVD SDUWLFXODULVVXH7KHXSGDWHG *HQHUDO3ODQ&LUFXODWLRQ (OHPHQWDGGUHVVHVUDLOVDIHW\ LVVXHVRQSDJHVWRDQG WR 1DWLYH$PHULFDQ+HULWDJH &RPPLVVLRQ 7KHOHWWHURXWOLQHVWKH UHTXLUHPHQWVVHWIRUWKE\VWDWH ODZIRUPLWLJDWLQJDQ\LPSDFWV RQFXOWXUDOUHVRXUFHV 3DJHRIWKH,QLWLDO6WXG\ $SSHQGL[$DGGUHVVHV FXOWXUDOUHVRXUFHLVVXHV7KH DQDO\VLVFRQFOXGHVWKDWLPSDFW ZLOOEHOHVVWKDQVLJQLILFDQW ZLWKFRQWLQXHGFRPSOLDQFHZLWK VWDWHODZRQDSURMHFWE\ SURMHFWEDVLV 6RXWK&RDVW$LU4XDOLW\ 0DQDJHPHQW'LVWULFW 6&$40' 7KHOHWWHUVHWVIRUWK6&$40'¶V VWDQGDUGVIRUWKHFRQGXFWRI DLUTXDOLW\DQDO\VHVLQ(,5V 6HFWLRQRIWKH(,5 DGGUHVVHVDLUTXDOLW\LPSDFWV &DOLIRUQLD'HSDUWPHQWRI 7UDQVSRUWDWLRQ&DOWUDQV 'LVWULFW 7KHOHWWHULQGLFDWHVWKDWD WUDIILFVWXG\LVUHTXLUHGWR DGGUHVVWKH*HQHUDO3ODQ XSGDWHDWEXLOGRXW 6HFWLRQRIWKH(,5 VXPPDUL]HVWKHUHVXOWVRIWKH WUDIILFVWXG\$SSHQGL[' SUHSDUHGIRUWKHSURMHFW 6RXWKHUQ&DOLIRUQLD$VVRFLDWLRQ RI*RYHUQPHQWV6&$* 7KH(,5VKRXOGH[DPLQHKRZ WKHSURMHFWUHODWHVWR6&$*¶V 5HJLRQDO&RPSUHKHQVLYH3ODQ DQG*XLGH /DQGXVHDQGKRXVLQJSROLF\ LVVXHVDUHH[DPLQHGRQSDJHV DQGUHVSHFWLYHO\RIWKH ,QLWLDO6WXG\$SSHQGL[$ 7KHDQDO\VLVFRQFOXGHVWKDWWKH *HQHUDO3ODQXSGDWHFRQWLQXHV ORQJHVWDEOLVKHGSROLF\IRU 9HUQRQWRUHPDLQDVDQ H[FOXVLYHO\LQGXVWULDOFLW\ $OVRWKH+RXVLQJ(OHPHQW LQGLFDWHVWKDWQRQHZKRXVLQJ ZLOOEHSHUPLWWHGZKLFK LPSOHPHQWV6&$*5HJLRQDO +RXVLQJ1HHGV$OORFDWLRQ SROLFLHV 7KH&LW\RI9HUQRQGLVWULEXWHGDQ123W RFLW\FRXQW\DQGVWDWHDJHQ FLHVRWKHU SXEOLF DJHQFLHV DQGL QWHUHVWHG SULYDWH RUJDQL]DWLRQV DQGLQGLYLGXDOVWRLGHQWLI\ DJHQF\ DQG SXEOLFFRQFHUQ V UHJDUGLQJ SRWHQWLDO LPSDFWV RI WKHSUR SRVHG IRFXVHG *HQHUDO 3ODQDQG=RQLQJ2UGLQDQFHXSGD WH DQDO\]HGLQWKLV6XSSOHP HQWDO (,5 &RPPHQWOHWWHUVRQWKH6XSSOHPHQWDO(,5ZHUHUHFHLYHGIURPWKHIROORZLQJ 3XEOLF8WLOLWLHV&RPPLVVLRQ 1DWLYH$PHULFDQ+HULWDJH&RPPLVVLRQ 6RXWK&RDVW$LU4XDOLW\0DQDJHPHQW'LVWULFW &DOLIRUQLD'HSDUWPHQWRI7UDQVSRUWDWLRQ'LVWULFW ,QWURGXFWLRQ )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH &RSLHVRIZULWWHQFRPPHQWVUHFHLYHGGXULQJWKHGD\SXEOLFUHYLHZSHULRGIRUWKH 123 DUH LQFOXGHG LQ $SSHQGL[$RIWKLV(, 5 2Q6HSWHP EHU WKH&LW\ FRQGXFWHGDVFRSLQJPHHWLQJWRVROLFLWRUDOFRPPHQWVRQWKH123&R SLHVRIWKH QRWHVIURPWKDWPHHWLQJDUHDOVRLQFOXGHGLQ$SSHQGL[$1RFRPPHQWVZHUHUDLVHG DWWKHVFRSLQJPHHWLQJUHJDUGLQJWKH(,57KHZULW WHQFRPPHQWVDUHDGGUHVVHGLQ WKLV6XSSOHPHQWDO(,5DVIROORZV Commenting Agency/Person Comment Addressed in EIR 3XEOLF8WLOLWLHV&RPPLVVLRQ 7KH*HQHUDO3ODQXSGDWH VKRXOGLQFOXGHODQJXDJHWR DGGUHVVUDLOVDIHW\SDUWLFXODUO\ ZLWKUHJDUGWRDWJUDGH UDLOURDGZD\FURVVLQJV 7KLVFRPPHQWGRHVQRWUDLVH DQHQYLURQPHQWDOFRQFHUQQRU DVNWKDWWKH(,5DGGUHVVD SDUWLFXODULVVXH7KHFXUUHQW *HQHUDO3ODQ&LUFXODWLRQ (OHPHQWDGGUHVVHVUDLOVDIHW\ LVVXHVRQSDJHVWRDQG WR 1DWLYH$PHULFDQ+HULWDJH &RPPLVVLRQ 7KHOHWWHURXWOLQHVWKH UHTXLUHPHQWVVHWIRUWKE\VWDWH ODZIRUPLWLJDWLQJDQ\LPSDFWV RQFXOWXUDOUHVRXUFHV 3DJHVWRRIWKH,QLWLDO 6WXG\$SSHQGL[$DGGUHVVHV FXOWXUDOUHVRXUFHLVVXHV7KH DQDO\VLVFRQFOXGHVWKDWLPSDFW ZLOOEHOHVVWKDQVLJQLILFDQW ZLWKFRQWLQXHGFRPSOLDQFHZLWK VWDWHODZRQDSURMHFWE\ SURMHFWEDVLV 6RXWK&RDVW$LU4XDOLW\ 0DQDJHPHQW'LVWULFW 6&$40' 7KHOHWWHUVHWVIRUWK6&$40'¶V VWDQGDUGVIRUWKHFRQGXFWRI DLUTXDOLW\DQDO\VHVLQ(,5V 6HFWLRQRIWKH(,5 DGGUHVVHVDLUTXDOLW\LPSDFWV &DOLIRUQLD'HSDUWPHQWRI 7UDQVSRUWDWLRQ&DOWUDQV 'LVWULFW 7KHOHWWHULQGLFDWHVWKDWD WUDIILFVWXG\LVUHTXLUHGWR DGGUHVVWKH*HQHUDO3ODQ XSGDWHDWEXLOGRXW 6HFWLRQRIWKH(,5 VXPPDUL]HVWKHUHVXOWVRIWKH WUDIILFVWXG\$SSHQGL[& SUHSDUHGIRUWKHSURMHFW Availability of Draft Supplemental EIR 7KLV'UDIW6XSSOHPHQWDO(,5LVDYDLODEOHIRUSXEOLFLQVSHFWLRQDWWKH&LW\RI9HUQRQ &RPPXQLW\ 6HUYLFHV 'HSDUWPHQW 6RXWK 6DQWD)H$YHQX H 9HUQRQ 'RFXPHQWV PD\ EH UHYLHZHG GXULQJ UHJXODU EXVLQHVV KRXUV0RQGD\WK URXJK 7KXUVGD\ $ 0 WR 307 KLV 'UDIW 6XSSOHPHQWDO (,5 ZLOO DOVR EH DYDLODEOHRQWKH&LW\RI9HUQRQZHEVLWHZZZFLW\RIYHUQRQRUJ ,QWURGXFWLRQ 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW Comments Requested &RPPHQWV RIDOODJ HQFLHV DQG LQGLYLGXDOV DUH LQYLWHG UHJDUGLQJWKH LQIRUPDWLRQ FRQWDLQHGLQWKH'UDIW6XSSOHPHQWDO(,5:KHUHSRVVLEOHWKRVHUHVSRQGLQJVKRXOG HQGHDYRUWRSURYLGHLQIRUPDWLRQWKH\IHHOLVODFNLQJLQWKH'UD IW6XSSOHPHQWDO(,5 RUVKRXOGLQGLFDWHZKHUHWKHLQIRUPDWLRQPD\EHIR XQG$OOFRPPHQWVRQWKH'UDIW 6XSSOHPHQWDO(,5VKRXOGEHZHQWWRWKHIROORZLQJ&LW\RI9HUQRQFRQWDFW .HYLQ:LOVRQ'LUHFWRURI&RPPXQLW\6HUYLFHVDQG:DWHU &LW\RI9HUQRQ&RPPXQLW\6HUYLFHV'HSDUWPHQW 6RXWK6DQWD)H$YHQXH 9HUQRQ&$ NZLOVRQ#FLYHUQRQFDXV )ROORZLQJDGD\SHULRGRIFLUFXODWLRQDQGUHYLHZRIWKH'UDIW6XSSOHPHQWDO(,5 DOOFRPPHQWVDQGWKH&LW\¶VUHVSRQVHVWRWKHFRPPHQWVZLOOEHLQFRUSRUDWHGLQWRD )LQDO6XSSOHPHQWDO(,5SULRUWRFHUWLILFDWLRQRIWKHGRFXPHQWE\WKH&LW\RI9HUQRQ Organization of this EIR 7KLV (,5L V RUJDQL]HG LQWRQLQ H VHFWLRQV 6HFWLRQ LVWK LV,QWURGXFWLRQ 7KH ([HFXWLYH6XPPDU\SURYLGHGLQ6HFWLRQLQFOXGHVDEULHISURMHFWGHVFULSWLRQDQG VXPPDUL]HV SURMHFW LPSDFWV DQG PLWLJDWLRQ PHDVXUHV 6HFW LRQ SU RYLGHV D GHWDLOHG GHVFULSWLRQ RIWKHSUR SRVHG IRFXVHG*HQH UDO 3ODQD QG =RQLQJ 2UGLQDQFH XSGDWH6HFWLRQV DQDO\]HVSURMHFWLP SDFWVDQGLGHQWLILHVPLWLJDWLRQPHDVXUHV GHVLJQHG WR UHGXFH VLJQLILFDQW LPSDFWV 6HFW LRQ S URYLGHV DQDO\VLV RI DOWHUQDWLYHVWRWKHS URSRVHGSURMHFW$Q DQDO\VLVRIFXPXODWLYHLPSDFWVJURZWK LQGXFLQJ LPSDFWVH QHUJ\ FRQVHUYDWLRQ DQG VLJQLILFDQW LUUHYHUVLEOH HQYLURQPHQWDO LPSDFWV DUH DQDO\]HG LQ6 HFWLRQ (IIHFWV IRXQG QRWW R EH VLJQLILFDQW DUH SURYLGHGLQ6HFWLRQ6HFWLRQOLVWVWKHSUHSDUDWLRQWHDPDQG6HFWLRQ SURYLGHVDOLVWRISHUVRQVDQGRUJDQL]DWLRQVFRQVXOWHGGXULQJWKHSUHSDUDWLRQRIWKLV 6XSSOHPHQWDO(,5 7KH$SSHQGLFHVFRQVLVWRI$SSHQGL[$1RWLFHRI3UHSDUDWLRQ,QLWLDO6WXG\$SSHQGL[ %$LU4XDOLW\'DWDDQG$SSHQGL[&7UDIILF,PSDFW$QDO\VLVLQFOXGHGDVVXSSRUWLQJ LQIRUPDWLRQ WRWKH(,5,QFR PSOLDQFH ZLWK 3XEOLF 5HVRXUFHV 6HFWLRQ D PLWLJDWLRQPRQLWRULQJDQGUHSRUWLQJSURJUDPZLOOEHSUHSDUHGDVDVHSDUDWHO\ERXQG GRFXPHQWWKDWZLOOEHDGRSWHG LQFRQMXQFWLRQZLWKWKHFHUWLILFDWLRQRIWKH)LQDO(,5 DQGSURMHFWDSSURYDO Approach to EIR Analysis $VVWDWHGDERYHWKHDSSURDFKWRWKHDQDO\VLVSUHVHQWHGLQWKLV(,5LVSURJUDPPDWLF LQQDWXUHJLYHQWKHEURDGVFRSHRIWKH*HQHUDO3ODQXSGDWHDQG=RQLQJ2UGLQDQFH UHYLVLRQ(DFKHQYLURQPHQWDOLVVXHLVDQDO\]HGLQWKHVDPHPDQQHUVWDUWLQJZLWKD GLVFXVVLRQRIWKHH[LVWLQJHQYLURQPHQWDOVHWWLQJ7KUHVKROGVRIVLJQLILFDQFHDUHWKHQ GHILQHG DV WKH\ DUHXVHG WR PHDVXUH WKH SURMHFW¶V SRWHQWLDO LPSDFW LQ WKH ,QWURGXFWLRQ )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH HQYLURQPHQWDOLPSDFWVHFWLRQ7KHDQDO\VLVVHFWLRQVXPPDUL]HVWKHHQYLURQPHQWDO HIIHFWVRYHUWLPHUHVXOWLQJIURPLPSOHPHQWDWLRQRIWKHJRDOVDQGSROLFLHVFRQWDLQHG LQHDFKRIWKHXSGDWHG*HQHUDO3ODQHOHPHQWVDVDQDO\]HGLQWKHFHUWLILHG3URJUDP (,5 7KH DQDO\VLV VHFWLRQ WKHQ H[DPLQHV WKH HQYLURQPHQWDO HIIHFWV RYHU WLPH UHVXOWLQJIURPWKHLPSOHPHQWDWLRQRIWKHSURSRVHGH[SDQGHG&RPPHUFLDO2YHUOD\ &DQG&]RQHVDQGWKHSURSRVHG7UXFNDQG)UHLJKW7HUPLQDO2YHUOD\=RQH,I WKHDQDO\VLVLQGLFDWHVWKDWLPSOHPHQWDWLRQRIWKHSURSRVHG2YHUOD\=RQHVZLOOUHVXOW LQDVLJQLILFDQWLPSD FWQRWLGHQWLILHGLQWKHFHUWLILH G3URJUDP(,5IRUD SDUWLFXODU HQYLURQPHQWDOLVVXHPLWLJDWLRQPHDVXUHVDUHLQFOXGHG )RU WKH* HQHUDO 3ODQ XSGDWHDQDO\]HGLQWKHFHUWLILHG 3URJUDP (,5PRVWR I WKH PLWLJDWLRQ PHDVXUHV ZHUHG UDZQ IURP WKHXSGDWH G *HQHUDO 3ODQ ,PSOHPHQWDWLRQ 3ODQ $V SDUWRIWKHFHUWLILHG*HQHUDO 3ODQXSGDWHWKH&LW\SUH SDUHGDGHWDLOHG ,PSOHPHQWDWLRQ 3ODQ WKDWR XWOLQHV SURFHGXUHV SURJUDPV RU DSSURDFKHVWKH&LW\ ZLOOSXUVXHRYHUWLPH±HLWKHUDORQHRULQFROODERUDWLRQZLWKQRQ&LW\RUJDQL]DWLRQV RUVWDWHDQGIHGHUDODJHQFLHV±WRLPSOH PHQWWKHXSGDWHG* HQHUDO3ODQJRDOVDQG SROLFLHV6RPHRIWKHLPSOHP HQWDWLRQPHDVXUHVDUHSURFHVVHVRUSUR FHGXUHVWKH &LW\ FXUUHQWO\ SHUIRUPV RQD GD\WRGD\ EDVLV VXFK DV GHYHORSPHQW SURMHFW UHYLHZZKLOHRWKHUVLGHQWLI\QHZSURJUDPVRUSURMHFWVWKDWZLOOEHLPSOHPHQWHG ZLWKLQ VSHFLILHG WLPH IUDPHV %\ LGHQWLI\LQJ DU HVSRQVLEOH SDUW\ D WLPHOLQH IRU LPSOHPHQWDWLRQDQGDPRQLWRULQJIUHTXHQF\WKH,PSOHPHQWDWLRQ3ODQSURYLGHVD PHFKDQLVP IRUH QVXULQJ WKDW SRWHQWLDO LPSDFWV UHVXOWLQJ IURP ORQJWHUP LPSOHPHQWDWLRQ RIWKH*HQHUD O 3ODQXSG DWH DQG=RQLQJ2UGLQDQFHUHYLVLRQZHUH DYRLGHGRUUHGXFHG 1RW DOOLP SOHPHQWDWLRQ PHDVXUHV ZHUH LQFOXGHG LQ WKHFH UWLILHG3URJUDP (,5D V PLWLJDWLRQ PHDVXUHV 7KH(, 5 LGHQWLILHG RQO\WKR VH UHTXLUHG WRDYRLG RUUHGXFH VLJQLILFDQWLPSDFWV0LWLJDWLRQPHDVXUHVDQGWKH,PSOHPHQWDWLRQ3ODQLQFOXGHGDV SDUWRIWKHFHUWLILHG3URJUDP(,5DUHDSSOLFDEOHWRWKHSURSRVHGIRFXVHG*HQHUDO 3ODQDQG=RQLQJ2UGLQDQFHXSGDWHDQDO\]HGLQWKLV6XSSOHPHQWDO(,5 )RU HDFK HQYLURQPHQWDO LVVXH DUHDH [DPLQHG LQ 6HFWLRQ WKH GLVFXVVLRQ FRQFOXGHVZLWKDVWDWHPHQWUHJDUGLQJWKHOHYHORILPSDFWUHPDLQLQJZLWKLPSRVLWLRQ RIWKHPLWLJDWLRQPHDVXUHV ,QWURGXFWLRQ ([HFXWLYH6XPPDU\ 3URMHFW'HVFULSWLRQ (QYLURQPHQWDO,PSDFW$QDO\VLV $OWHUQDWLYHV $QDO\VLVRI/RQJ7HUP(IIHFWV (IIHFWV)RXQG1RWWREH6LJQLILFDQW 3UHSDUDWLRQ7HDP 5HIHUHQFHV ,QWURGXFWLRQ ([HFXWLYH6XPPDU\ 3URMHFW'HVFULSWLRQ (QYLURQPHQWDO,PSDFW$QDO\VLV $OWHUQDWLYHV $QDO\VLVRI/RQJ7HUP(IIHFWV (IIHFWV)RXQG1RWWREH6LJQLILFDQW 3UHSDUDWLRQ7HDP 5HIHUHQFHV 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW Project Summary 2.1 7KHSURMHFWDQDO\]HGLQWKLV6(,5LVWKHDGRSWLRQDQGLPSOHPHQWDWLRQRIWKHIRFXVHG *HQHUDO3ODQDQG=RQLQJ2UGLQDQFHXSGDWH 7KHSURSRVHGSURMHFWLVDIRFXVHGXSGDWHWRWKH*HQHUDO3ODQWRFRPSO\ZLWKQHZ 6WDWHODZVDQGPDNHPLQRUDGMXVWPHQWVWRODQGXVHSROLF\ 7KH3ODQDVDZKROHDSSOLHVWRWKHLQFRUSRUDWHGOLPLWVRI9HUQRQ Focused General Plan and Zoning Ordinance Update 7KHLQWHQWRIWKHSURMHFWZLWKUHVSHFWWRHDFKRIWKHHOHPHQWVLVVXPPDUL]HGEHORZ Update to General Plan Elements /DQG8VH(OHPHQW 7KH &LW\ RI 9HUQRQ LVDQH[FOXVLYHO\LQ GXVWULDO FLW\ ZLWK RQH ODQG XVHF DWHJRU\ ,QGXVWULDO DQGWKUH H RYHUOD\ GLVWULFWV &RPPHUFLDO5HQGHULQJDQG6ODXJKWHULQ J 7KHSURMHFWSURSRVHVWRH[SDQGWKHDUHDWKDWWKH&RPPHUFLDO2YHUOD\DSSOLHVDQG SURSRVHV QHZ LQIRUPDWLRQDQ G SROLFLHV WR IDFLOLWDWHPRUHLQ WHQVLYH HPSOR\PHQW JHQHUDWLQJ XVHVQHD U WUDQVLWVWRSV,Q DGGLWLRQ DGGLWLRQDO LQIRUPDWLRQ RQIORRG KD]DUGVLVSURYLGHGWRFRPSO\ZLWK6WDWHODZ$% 6DIHW\(OHPHQW 5HFHQW UHYLVLRQV WR $% UHTXLULQJ IORRG ULVN PDQDJHPHQW LQIRUPDWLRQ WR EH LQFOXGHGLQWKH6DIHW\(OHPHQWDUHSURSR VHG5HYLVLRQVWRHDUWKTXDNHIDXOWPDS V WRXSGDWHLQIRUPDWLRQSURYLGHGE\WKH&DOLIRUQLD*HRORJLFDO6XUYH\DUHSURSRVHG 5HVRXUFHV(OHPHQW /LPLWHGFKDQJHVWRWKH5HVRXUFHV(OHPHQWUHODWHGWRUHFHQWO\XSGDWHG8UEDQ:DWHU 0DQDJHPHQW 3ODQ8:03LQIRUPDWLRQDUHSURSR VHG ,Q DGGLWLRQWKHSURMHFW SURSRVHVUHYLVLRQVWRDGGUHVV$%WKH*OREDO:DUPLQJ6ROXWLRQV$FWRIDQG 6% 1RLVH(OHPHQW /LPLWHGFKDQJHVWRWKH1RLVH(OHPHQWWRUHIOHFWWKH&LW\¶VUHFHQWO\DGRSWHGKRXVLQJ SROLF\LVSURSRVHG ,PSOHPHQWDWLRQ3ODQ ,QRUGHUWRFRUUHODWHZLWKQHZSROLFLHVLQWKH*HQHUDO3ODQDOLPLWHGQXPEHURIQHZ DFWLRQVWRWKH,PSOHPHQWDWLRQ3ODQDUH SURSRVHG,QDGGLWLRQGXHWRWKHORVVRI UHGHYHORSPHQWIXQGLQJLQWKHLQ6WDWHFKDQJHVWRIXQGLQJVRXUFHVDUHSURSRVHG ([HFXWLYH6XPPDU\ )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH Project Location 2.2 7KH&LW\RI9HUQRQLVORFDWHGLQWKHFHQWUDOSRUWLRQRI/RV$QJHOHV&RXQW\GLUHFWO\ VRXWKRIGRZQWRZQ/RV$QJHOHV9HUQRQLVDGMDFHQWWRWKHFLWLHVRI/RV$QJHOHV +XQWLQJWRQ3DUN0D\ZRRG%HOODQG&RPPHUFH7KHPXQLFLSDOOLPLWVRIWKH&LW\RI 9HUQRQ HQFRPSDVV DSSUR[LPDWHO\ VTXDUHPLOH V H[WHQGLQJJH QHUDOO\ IURP $ODPHGD6WUHHWDQGWKH$ODPHGD&RUULGRURQWKHZHVWWR,QWHUVWDWH,RQ WKHHDVWDQGWKHFLWLHVRI0D\ZRRGDQG+XQWLQJWRQ3DUNWRWKHVRXWKWRWKH&LW\RI /RV $QJHOHV WRWKH QRUWK /DQGVZLWKLQ WKH PXQLFLSDO OLPLWVOD UJHO\ KDYH EHHQ GHYHORSHGZLWKLQGXVWULDOXVHVVLQFHLWVLQFRUSRUDWLRQLQ Environmental Setting 2.3 7KH 3URMHFW $UHD LV ORFDWHG LQ FHQWUDO /RV $QJHOHV &RXQW\7KHWRS RJUDSK\ LV UHODWLYHO\ IODWDQGLV ODUJHO\ EXLOWRXWZLWK DOPRVWH [FOXVLYHO\ LQGXVWULDO XVH ZLWK OLPLWHGUHWDLOFRPPHUFLDODQGIRRGVHUYLFHRSWLRQVWRVXSSRUWWKHODUJHGD\WLPH EXVLQHVVSRSXODWLRQDQGIHZUHVLGHQWV Environmental Impacts 2.4 %DVHGRQWKHSUHOLP LQDU\HQYLURQPHQWDODQDO\VLVFRQGX FWHGWKH&LW\GHWHUP LQHG WKDWWKHDGRSWLRQDQGORQJWH UPLPSOHPHQWDWLRQRIWKHXSGDWHG*HQHUD O3ODQDQG UHYLVHG =RQLQJ 2UGLQDQFH KDV WKH SRWHQWLDO WRUHVX OW LQVLJQLILFDQWHQ YLURQPHQWDO HIIHFWVZLWKUHJDUGWRWKHIROORZLQJHQYLURQPHQWDOLVVXHDUHDV $LU4XDOLW\ x +D]DUGVDQG+D]DUGRXV0DWHULDOV x 1RLVH x 7UDQVSRUWDWLRQDQG7UDIILF 8WLOLWLHVDQG6HUYLFH6\VWHPVZDWHUVXSSO\DQGVROLGZDVWH 7KLV6XSSOHPHQWDO(,5H[DPLQHVHDFKRIWKHVHLVVXHDUHDVLQVHSDUDWHVHFWLRQVLQ DGGLWLRQWRRWKHUUHTXLUHGWRSLFVVSHFLILHGLQWKH6WDWH&(4$*XLGHOLQHV7DEOH VXPPDUL]HVWKHHQYLURQPHQWDOLPSDFWVDVVRFLDWHGZLWKWKHSURMHFWDQGOLVWVWKH PLWLJDWLRQPHDVXUHVUHTXLUHGWRUHGXFHR UDYRLGLPSDFWVDVVWDWHGLQWKHFHUWLILHG *HQHUDO 3ODQ (,5DQ G UHPDLQ DSSOLFDEOH WRWKHS URSRVHG *HQHUDO3ODQ XSGDWH 0LWLJDWLRQEH\RQGWKDWUHTXLUHGE\WKHFHUWLILHG*HQHUDO3ODQ(,5LVQRWQHFHVVDU\ ([HFXWLYH6XPPDU\6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUWTable 2.0-2 Environmental Impact Summary Impact Summary 7KHQXPEHUVLQWKHILUVWFROXPQUHIHUWRWKH(,5VHFWLRQVZKHUHVSHFLILFLPSDFWWRSLFVDUHDGGUHVVHG7KHOHWWHUVUHIHUWRWKHWKUHVKROGVLGHQWLILHGLQ$SSHQGL[*RIWKH&(4$*XLGHOLQHVSignificant and Unavoidable Impacts 7UDQVSRUWDWLRQDQG7UDIILF$%3URMHFWHGORQJWHUPWUDIILFYROXPHVUHVXOWLQVLJQLILFDQWDQGXQDYRLGDEOHLPSDFWVWRWKHORFDODQGUHJLRQDO&RQJHVWLRQ0DQDJHPHQW3URJUDPFLUFXODWLRQV\VWHPZLWKLQFRUSRUDWLRQRIPLWLJDWLRQ0LWLJDWLRQ0HDVXUHVT-1Automated Traffic Surveillance and Control System (ATSAC).&RQGXFWDVWXG\WRGHWHUPLQHLI$76$&ZRXOGEHDEHQHILFLDODQGFRVWHIIHFWLYHV\VWHPIRUWKH&LW\WRRSHUDWHDQGPDLQWDLQT-2 Coordinate with Adjacent Jurisdictions.&RQWLQXHWRFRRUGLQDWHLQWHUVHFWLRQPDLQWHQDQFHDQGLPSURYHPHQWVZLWKDGMDFHQWMXULVGLFWLRQVVRWKDWLQWHUVHFWLRQVDORQJ6RWR6WUHHW3DFLILF%RXOHYDUG6ODXVRQ$YHQXH$ODPHGD6WUHHW$WODQWLF%RXOHYDUG%DQGLQL%RXOHYDUGDQG'RZQH\5RDGRSHUDWHDWDQDFFHSWDEOH/HYHORI6HUYLFHT-3 Coordinate with Rail Companies.&RRUGLQDWHZLWKUDLOURDGFRPSDQLHVLQUHPRYLQJREVROHWHUDLOVSXUV:RUNWRPLQLPL]HWUDIILFLPSDFWVWR&LW\VWUHHWVIURPWUXFNVXVLQJ+REDUW<DUGIDFLOLWLHVDQGRWKHUPXOWLPRGDOWUDQVSRUWDWLRQ\DUGVT-4 Coordinate with Metropolitan Transportation Authority.:RUNZLWKWKH0HWURSROLWDQ7UDQVSRUWDWLRQ$XWKRULW\0HWURWRDFKLHYHWKHIROORZLQJ± ,PSOHPHQWWKH0HWUR¶V&RQJHVWLRQ0DQDJHPHQW3ODQ&03ZLWKLQWKH&LW\± &RQWLQXHWRSURYLGHORFDODQGUHJLRQDOFRQQHFWLRQVWKURXJK0HWURORFDODQGUDSLGEXVOLQHV± ,PSURYHDFFHVVWRORFDO0HWURVWDWLRQVT-5 Minimize Parking Impacts.:RUNZLWKEXVLQHVVHVWRGHYHORSFUHDWLYHVWUDWHJLHVDQGVROXWLRQVWRDGGUHVVSDUNLQJVKRUWDJHV5HTXLUHQHZGHYHORSPHQWSURMHFWVWRPHHWWKHPLQLPXPSDUNLQJVWDQGDUGVLQWKH=RQLQJ2UGLQDQFHIRUERWKWUXFNVDQGDXWRPRELOHDQGDXWRPRELOHVLQFOXGLQJWUXFNWUDLOHUVWRUDJHHPSOR\HHSDUNLQJDQGYLVLWRUSDUNLQJ ([HFXWLYH6XPPDU\)RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWHT-6 Soto Street Widening.$WWKHWLPHSURSHUWLHVDORQJ6RWR6WUHHWDUHUHGHYHORSHGRUDVRWKHUZLVHGLFWDWHGE\&LW\SODQVIRUWKHZLGHQLQJRI6RWR6WUHHWUHTXLUHWKHGHGLFDWLRQRIULJKWVRIZD\WRDFKLHYHWKHURDGVWDQGDUGIRU6RWR6WUHHWHVWDEOLVKHGLQWKH&LUFXODWLRQDQG,QIUDVWUXFWXUH(OHPHQW&RPSOHWHWKHURDGZLGHQLQJSURMHFWDWWKHWLPHDGHTXDWHULJKWVRIZD\KDYHEHHQDFTXLUHGDQGRUGHGLFDWHGT-7 Interstate 710 Freeway Improvements.:RUNZLWK&DOWUDQVRQDOOSODQVDFWLYLWLHVDQGSURMHFWVUHJDUGLQJ,QWHUVWDWHWKDWPD\GLUHFWO\LPSDFW9HUQRQ¶VURDGZD\IDFLOLWLHVDQGWUDIILFSDWWHUQV&RRUGLQDWHZLWKWKH*DWHZD\&LWLHV&RXQFLORI*RYHUQPHQWVDQG6RXWKHUQ&DOLIRUQLD$VVRFLDWLRQRI*RYHUQPHQWVRQVWXGLHVDQGSURJUDPVUHJDUGLQJWKHLPSURYHPHQWVWRWKH,IUHHZD\T-8 Other Improvements.$W6DQWD)H$YHQXHDQGWK6WUHHWVWULSHDQHDVWERXQGOHIWWXUQODQHZLWKLQH[LVWLQJULJKWRIZD\WRSURYLGHDGGLWLRQDOLQWHUVHFWLRQFDSDFLW\Less than Significant Impacts with Mitigation Incorporation +D]DUGVDQG+D]DUGRXV0DWHULDOV$%&,PSOHPHQWDWLRQRIWKHSURSRVHGIRFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWHZLOOUHVXOWLQOHVVWKDQVLJQLILFDQWLPSDFWVIURPWKHXVHWUDQVSRUWDQGGLVSRVDORIKD]DUGRXVPDWHULDOVDQGZDVWHVZLWKPLWLJDWLRQLQFRUSRUDWLRQ0LWLJDWLRQ0HDVXUHVH-1 7KH &LW\ ZLOO FRQWLQXH WRLP SOHPHQW WKH SURYLVLRQV RI& LW\ RUGLQDQFHV WRSUR YLGH IRUWK H EXVLQHVVRFFXSDQF\LQVSHFWLRQSURJUDPDQGWKHUHJXODULQVSHFWLRQRIEXVLQHVVHVLQYROYHGLQWKHS URGXFWLRQVWRUDJH KDQGOLQJGLVSR VDO WUHDWPHQW HPLVVLRQV GLVFKDUJH RUUHF\FOLQJRIKD]DUGRXVPD WHULDOV6XFKDFWLYLW\ZLOOEHIXQGHGDVSDUWRIWKH&LW\¶VDQQXDOEXGJHWLQJSURFHVVVSHFLDOWD[DQGRUZLOOEHIXQGHGDVDIHHSURJUDPH-2 $W WKHWLP H DQ\QHZRUUHYL VHG +D]DUGRXV 0DWHULDOV %XVLQHVV DSSOLFDWLRQ IRUD QHZ EXVLQHVV RUDFWLYLW\ LVU HFHLYHG IRU D ORFDWLRQ ZLWKLQ RQHTXDUWHU PLOH RIDQ\ UHVLGHQFH VFKRRO KRVSLWDOUHVLGHQWLDO DVVLVWHG FDUH IDFLOLW\ RUVLPL ODU XVH VHQVLWLYH XVHV PD\ EH ORFDWHG ZLWKLQ WKH &LW\R URXWVLGHLWVERXQGDULHVRUJUHDWHUGLVWDQFHDVPD\EHGHWHUPLQHGE\WKH'LUHFWRURI(QYLURQPHQWDO+HDOWK'HSDUWPHQWIRUSDUWLFXODUEXVLQHVVW\SHVWK H&LW\ZLOOUHYLHZWK HDSSOLFDWLRQDQGGH WHUPLQHZKHWKHUD+HDOWK5LVN$VVHVVPHQW+5$LVUHTXLUHGSXUVXDQWWR6WDWHODZDQGRU&LW\2UGLQDQFHWRDGGUHVVDQ\SRWHQWLDOLPSDFWVWRWKHVHXVHV,IDQ+5$LVGHHPHGDSSURSULDWHDQGIXUWKHULIWKH ([HFXWLYH6XPPDU\6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW+5$ LGHQWLILHV SRWHQWLDO ULVNVDVVR FLDWHG ZLWKWKHEXVLQHVVDFWLYLW\U HODWLYH WR SUR[LPLW\ WRWK HUHVLGHQFHVFKRROKRVSLWDOUHVLGHQWLDODVVLVWHGFDUHIDFLOLW\RUVLPLODUXVHWKH&LW\VKDOOHQVXUHWKDWDFWLRQLVWDNHQWRDGGUHVVVXFKULVN7KHDFWLRQPD\FRQVLVWRI 'HQ\LQJWKHDSSOLFDWLRQZLWKLQWKHOLPLWVRIWKH&RGHRIWKH&LW\RI9HUQRQRU 5HTXLULQJ WKH EXVLQHVV RSHUDWRU WR LQFRUSRUDWH SUHYHQWDWLYH RU DPHOLRUDWLYH PHDVXUHV LQWR WKHEXVLQHVVSURFHVVHVRUDFWLYLWLHVWRORZHUWKHULVNWR DFFHSWDEOHOHYHOVDVVHWIRUWKE\IHGHUDORUVWDWHUHJXODWLRQVDQGSROLFLHV1RLVH$ ,PSDFWVZLOOEHOHVVWKDQVLJQLILFDQWDWWKHSURJUDPOHYHOZLWKLPSOHPHQWDWLRQRIPLWLJDWLRQ*HQHUDO3ODQSROLFLHVDQGUHJXODWRU\UHTXLUHPHQWV0LWLJDWLRQ0HDVXUHVN-1 Noise Regulations.&RQWLQXHWRHQIRUFH&LW\QRLVHUHJXODWLRQVFRQWDLQHGLQWKH=RQLQJ2UGLQDQFHWRSURWHFW UHVLGHQWV DQG VFKRRO FKLOGUHQ IURP H[FHVVLYH QRLVH OHYHOV DVVRFLDWHG ZLWK VWDWLRQDU\ QRLVHVRXUFHV3HULRGLFDOO\HYDOXDWHUHJXODWLRQVIRUDGHTXDF\DQGUHYLVHDVQHHGHGWRDGGUHVVFRPPXQLW\QHHGVDQGFKDQJHVLQOHJLVODWLRQDQGWHFKQRORJ\N-2 Siting of New Businesses and Activities near Sensitive Land Uses. 5HYLHZ DOOGH YHORSPHQWSURSRVDOV DQG EXLOGLQJ SHUPLWVZLWKLQWKH&LW\WR GHWHUPLQH ZKHWKHUWKHSURS RVHG XVH KDV WKHSRWHQWLDOWRH[FHHG&LW\RQHKRXUQRLVHVWDQGDUGV7KH&LW\¶VVWDQGDUGVDUHORZHUDWORFDWLRQVQHDUH[LVWLQJUHVLGHQFHVDQGVFKRROV$VDSSURSULDWHUHTXLUHDFRXVWLFDODQDO\VHVIRUDOOVXFKGHYHORSPHQWDQGDFWLYLWLHVQHDUVXFKXVHV DQGGHWHUPLQHLIPLWLJDWLRQPHDVXUHVDUHUHTXLUHG5HTXLUHSURSHUW\DQGEXVLQHVVRZQHUVWRLPSOHPHQWPLWLJDWLRQWRDFKLHYH&LW\QRLVHVWDQGDUGVNo Impact and Less than Significant Impacts $LU4XDOLW\DQG&OLPDWH&KDQJH$%&,PSDFWVUHODWHGWRVKRUWWHUPDQGORQJWHUPFULWHULDSROOXWDQWHPLVVLRQVDWWK HSURJUDPPDWLFOHYHOZLOOEHOHVVWKDQVLJQLILFDQWZLWKLPSOHPHQWDWLRQRIH[LVWLQJ*HQHUDO3ODQSROLF\DQGH[LVWLQJVWDQGDUGV' ,PSDFWV UHODWHG WR WKH H[SRVXUH RI VHQVLWLYH UHFHSWRUV WR VXEVWDQWLDO SROOXWDQW FRQFHQWUDWLRQV DQGJUHHQKRXVHJDVHVZLOOEHOHVVWKDQVLJQLILFDQWDWWKHSURJUDPPDWLFOHYHO+D]DUGVDQG+D]DUGRXV0DWHULDOV' ,PSDFWVWRGHYHORSPHQWDQGSHUVRQVGXHWREXLOGLQJVLWLQJRQFRQWDPLQDWHGS URSHUWLHVZLOOEHOHVVWKDQ VLJQLILFDQW ([HFXWLYH6XPPDU\)RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH8WLOLWLHVDQG6HUYLFH6\VWHPV$ ,PSOHPHQWDWLRQRIWKHSURSRVHGSURMHFWZLOOQRWUHTXLUHQHZRUH[SDQGHGZDWHUVXSSO\HQ WLWOHPHQWVWREHVHFXUHG% ,PSDFWVDVVRFLDWHGZLWKVROLGZDVWHUHJXODWLRQVDQGDGHTXDF\RIGLVSRVDOVLWHVZLOOEHOHVVWKDQVLJQLILFDQW ([HFXWLYH6XPPDU\ 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW 2.5 Issues to be Resolved 3XUVXDQWWR6HFWLRQERIWKH &(4$*XLGHOLQHVDQ(,5VXPPDU\P XVW LGHQWLI\³,VVXHVWREHUHVROYHGLQFOXGLQJWKHFKRLFHDPRQJDOWHUQDWLYHVDQGZKHWKHU RUKRZWRPLWLJDWHWKHVLJQLILFDQWHIIH FWV´7KLV(,5LGHQWLILH VDQGUHVROYHVLVVXHV UHODWHG WR SURMHFWDOWHUQDW LYHV LQ6HFWL RQ 3RWH QWLDOO\ VLJQLILFDQW LPSDFWV DUH LGHQWLILHGLQWKHDQDO\VLVSUR YLGHGLQ6HFWLRQDQG PLWLJDWLRQLVFRQVLGHUHGIRUDOO LPSDFWV 2.6 Areas of Potential Controversy $ 1RWLFHRI3UH SDUDWLRQ 123 RID'UDIW6XSS OHPHQWDO (QYLURQPHQWDO ,PSDFW 5HSRUWZDVFLUFXODWHGIRUDGD\SXE OLFUHYLHZSHULRGIURP6HSWHPEHU WKURXJK2FWREHU5HVSRQVHVWRWKHFLUFXODWLRQRIWKH123LGHQWLILHGD YDULHW\ RIHQYLURQP HQWDO FRQFHUQV UHODWHG WR DLUTXDOLW \ WUDQVSRUWDWLRQ DQGUDLO VDIHW\VHH$SSHQGL[$7KHVHDUHDVR ISRWHQWLDOFRQWURYHUV\DUHH[DPLQHGLQWKLV (,5 2.7 Alternatives to the Proposed Project &(4$UHTXLUHVWKDWDQ(,5H[DPLQHDOWHUQDWLYHVWRWKHSURMHFWWKDWDUHFDSDEOHRI UHGXFLQJRUHOLPLQDWLQJWKHXQ DYRLGDEOHVLJQLILFDQWHIIHFWV)RXUDOWHUQDWLYHVZHUH FRQVLGHUHG7KHDOWHUQDWLYHVH[DPLQHGLQ6HFWLRQDUH $OWHUQDWLYH 1R3URMHFW x $OWHUQDWLYH $GGLWLRQDO5DLOZD\5RDGZD\*UDGH6HSDUDWLRQV x $OWHUQDWLYH =RQLQJ3URYLVLRQVWR3HUPLW:DUHKRXVLQJ&LW\ZLGH x $OWHUQDWLYH 1R7UXFNDQG)UHLJKW7HUPLQDO2YHUOD\ $OWHUQDWLYHZDVH[DPLQHGD VSDUWRIWKHFHUWLILHG*HQHUDO3ODQ(,5KRZHYHULWLV QRORQJHUDSSOLFDEOHDQGKDVQRWEHHQH[DPLQHGIXUWKHU 7KHDOWHUQDWL YHV DQDO\VLV LQGLFDWHV WKDW $OWHUQDWLYH ZLOOUHVXOWLQ HTXLYDOHQW LPSDFWVZKHQFRPSDUHGWRWKHSURSRVHGSURMHFW$OWHUQDWLYHZLOOJHQHUDOO\UHVXOW LQ UHGXFHG LPSDFWV UHODWHG WR DLUTXDOLW\KD ]DUGV DQG WUDIILFDQGHTXLYDOHQW LPSDFWVUHODWHGWRZDWHUVXSSO\ODQGILOOFDSDFLW\DQGQRLVHZ KHQFRPSDUHGWRWKH SURSRVHGSURMHFW$OWHUQDWLYH ZLOOUHVXOWLQJHQHUDOO\UHGXFHGLPSDFWVUHODWHGWR DLUTXDOLW\WUDIILFZDWHUVXSSO\ODQGILOOFDSDFLW\DQGQRLVHDQGHTXLYDOHQWLPSDFWV UHODWHGWRKD]DUGVZKHQFRPSDUHGWRWKHSURSRVHGSURMHFW$OWHUQDWLYHZDVIRXQG WREHWKHHQYLURQPHQWDOO\VXSHULRUDOWHUQDWLYHWRWKHSURSRVHGSURMHFW ([HFXWLYH6XPPDU\ )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH 7KLVSDJHLQWHQWLRQDOO\OHIWEODQN ,QWURGXFWLRQ ([HFXWLYH6XPPDU\ 3URMHFW'HVFULSWLRQ (QYLURQPHQWDO,PSDFW$QDO\VLV $OWHUQDWLYHV $QDO\VLVRI/RQJ7HUP(IIHFWV (IIHFWV)RXQG1RWWREH6LJQLILFDQW 3UHSDUDWLRQ7HDP 5HIHUHQFHV ([HFXWLYH6XPPDU\ 3URMHFW'HVFULSWLRQ (QYLURQPHQWDO,PSDFW$QDO\VLV $OWHUQDWLYHV $QDO\VLVRI/RQJ7HUP(IIHFWV (IIHFWV)RXQG1RWWREH6LJQLILFDQW 3UHSDUDWLRQ7HDP 5HIHUHQFHV 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW Project Description 3.0 Project Title &LW\RI9HUQRQ)RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH Lead Agency Name and Address &LW\RI9HUQRQ 6DQWD)H$YHQXH 9HUQRQ&DOLIRUQLD Contact Person and Phone Number 6.HYLQ:LOVRQ'LUHFWRURI&RPPXQLW\6HUYLFHVDQG:DWHU Project Location 7KH SURMHFW DSSOLHV WRD OO SDUFHOV ZLWKLQ WKH &LW\ RI 9HUQRQ DQG WKH &LW\¶V XQLQFRUSRUDWHGVSKHUHRILQIOXHQFH9HUQRQLVORFDWHGLQWKHFHQWUDOSR UWLRQRI/RV $QJHOHV&RXQW\GLUHFWO\VRXWKRIGRZQWRZQ/RV$QJHOHV9HUQRQLVDGMDFHQWWRWKH FLWLHV RI /RV $QJHOHV +XQWLQJWRQ 3DUN0D\ZR RG DQG&RPPHUFH7KH&LW\¶V SODQQLQJ DUHD HQFRPSDVVHV DSSUR[LPDWHO\ VTX DUH PLOHV ([KLELW5HJLRQ DO &RQWH[WDQG9LFLQLW\0DSLOOXVWUDWHV9HUQRQ¶VORFDWLRQZLWKLQ/RV$QJHOHV&RXQW \ DQGLWVORFDOFRQWH[W Project Sponsor’s Name and Address &LW\RI9HUQRQ 6DQWD)H$YHQXH 9HUQRQ&DOLIRUQLD General Plan Land Use Designation ,QGXVWULDOZLWKYDULRXVRYHUOD\V Zoning District ,QGXVWULDOZLWKYDULRXVRYHUOD\V Project Background 7KH&LW\RI9HUQRQDGRSWHGDFRPSUHKHQVLYHXSGDWHWRWKH&LW\¶V* HQHUDO3ODQDQG =RQLQJ 2UGLQDQFH LQ $ 3URJUDP (QYLURQPHQWDO ,PSDFW 5HSRUW 3(,5ZD V SUHSDUHGDWWKHWLPHDQGFHUWLILHGE\WKH9HUQRQ&LW\&RXQFLOLQ1RYHPEHU,Q -DQXDU\ WKH *HQHUDO3ODQ DQG =RQLQJ 2UGLQDQFHZHUHDJDLQD PHQGHG WR XSGDWHWKH&LW\¶V+RXVLQJ(OHPHQWIRUWKHSHULRGDQGDGGWKH+RXVLQ J DQG(PHUJHQF\6KHOWHU2YHUOD\VWRWKHODQGXVHSROLF\PDSDQG]RQLQJPDS$ 0LWLJDWHG1HJDWLYH'HFODUDWLRQZDVDGRSWHGIRUWKHKRXVLQJUHODWHGDPHQGPHQWV 3URMHFW'HVFULSWLRQ )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH 7KHHQWLUHW\RIWKHDFUH3ODQQLQJ$UHDLVGHVLJQDWHGDQG]RQHG,QGXVWULDO, 9DULDWLRQVLQODQGXVHVDUH VXSSRUWHGWKURXJKDVHULHVRIRYHUOD\V&XUUHQWO\WKH *HQHUDO 3ODQDQG =RQLQJ &RGH LGHQWLILHV ILYH RYHUOD\ GLVWULFWV 7KH& RPPHUFLDO 2YHUOD\ 'LVWULFW & HQFRPSDVVHV DFUHVDQ G VXSSRUWV UHWDLO FRPPHUFLDO VHUYLFHDQGUHVWDXUDQWXVHV7KH5HQGHULQJ2YHUOD\'LVWULFW5HQFRPSDVVHV DFUHVDQGVXSSRUWVUHQGHULQJWKHSURFHVVLQJRIDQLPDOSURGXFWVLQWRXVHIXOYDOXH DGGHGPDWHULDOVRQORWVRYHURQHDFUHLQ VL]H7KH6ODXJKWHULQJ2YHUOD\'LVWULFW 6HQFRPSDVVHVDFUHVDQGVXSSRUWVWKHVODXJKWHULQJRIDQLPDOVRQORWVRYHU RQH DFUH LQ VL]H7KH+RXVLQJ2YHUOD \ 'LVWULFW +VXSS RUWV GHYHORSPHQW RI UHVLGHQWLDOXQLWVRQDSSUR[LPDWHO\WZRDFUHVLQWKHHDVWHUQSRUWLRQRIWKH3ODQQLQJ $UHD 7KH(PHUJH QF\ 6KHOWHU 2YHUOD\ 'LVWULFW (6VXS SRUWV GHYHORSPHQW RI HPHUJHQF\VKHOWHUV RQDSSUR[LPDWHO\ DFUHVLQWKHQRUWKZHVWSRUWLRQRIWKH 3ODQQLQJ$UHD Project Description 7KHSURSRVHGSURMHFWLVDIRFXVHGXSGDWHWRWKH*HQHUDO3ODQWRFRPSO\ZLWKQHZ 6WDWHODZVDQGPDNHPLQRUDGMXVWPHQWVWRODQGXVHSROLF\7KHSURMHFWFRQVLVWVRI VHYHUDOFRPSRQHQWV 8SGDWHWKH/DQG8VH(OHPHQWWRH[SDQGWKHORFDWLRQVZKHUHFRPPHUFLDOXVHV DQGWUXFNLQJDQGIUHLJKWWHUPLQDOVFDQEHHVWDEOLVKHGLQWKH&LW\ 8SGDWH WKH /DQG8VH5HVRXUFHV6DIH W\ DQG1RLVH(OHPHQWVWRFRP SO\ ZLWK UHFHQWO\SDVVHG6WDWHODZVDQGWRXSGDWHSHUWLQHQWLQIRUPDWLRQ 8SGDWH WKH ,PSOHPHQWDWLRQ 3ODQZLWK QHZ DSSOLFDEOH SROLFLHV UHODWHG WRWK H DERYHUHYLVHGSROLF\FKDQJHV 5HYLVHWKH=RQLQJ2UGLQDQFHDQG=RQLQJ0DSWRHVWDEOLVKDQGDSSO\DQHZ7UXFN DQG)UHLJKW7HUPLQDO2YHUOD\7)RYHUQHWDFUHV 5HYLVHWKH=RQLQJ2UGLQDQFHDQG=RQLQJ0DSWRUHSODFHDQGH[SDQGWKHH[LVWLQJ &RPPHUFLDO2YHUOD\ZLWKWKHQHZ&DQG&&RPPHUFLDO2YHUOD\VRYHU QHWDFUHVDQGQHWDFUHVUHVSHFWLYHO\ (VWDEOLVK QHZ GHILQLWLRQV WR DGGUHVV WKH UHYLVLRQV GHVFULEHGDERYHDQ G RWKHU PLQRUDPHQGPHQWVWRWKH=RQLQJ2UGLQDQFH (VWDEOLVKDQHZ0LQRU&RQGLWLRQDO8VH3HUPLWSURFHVV 3URYLGHVWDQGDUGVIRUGLJLWDOELOOERDUGV 3HUIRUPDGGLWLRQDOFOHDQXSQRQVXEVWDQWLYHUHYLVLRQVWRWKH=RQLQJ2UGLQDQFH WKDWGRQRWDIIHFWWKHDQ\SULRUSROLF\GLUHFWLYHV (DFK RIWK HVH FRPSRQHQWV LVGLVFXVVHG LQ GHWDLOE HORZ )RU WKHSXUSRVHV RI WKLV 6XSSOHPHQWDO (QYLURQPHQWDO ,PSDFW 5HSRUW(, 5 WKHIRFXVHGXS GDWH WRWKH 9HUQRQ *HQHUDO 3ODQ DQG=RQLQJ2UGLQDQF H LV FROOHFWLYHO\ UHIHUUHG WR DV³WK H SURMHFW´ DQG³WKH3URSRVHG )RFXVHG8SGDWH´7KH³3ODQQLQJ$UHD´LVWKHDUHDWR ZKLFKWKHSURMHFWDSSOLHVWKLVLQFOXGHVDOOSDUFHOVZLWKLQWKH&LW\RI9HUQRQDQGLWV XQLQFRUSRUDWHGVSKHUHRILQIOXHQFH 3URMHFW'HVFULSWLRQ 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW Update to General Plan Elements /DQG8VH(OHPHQW 7KH/DQG8VH(OHPH QWJXLGHV WKHSK\VLFDOIRUPR I9HUQRQDQGKRZODQGZLOOE H XVHGRYHUWKHORQJWHUPVHH([KLELW3URSRVHG*HQHUDO3ODQ/DQG8VH0DS 7KLVHOHPHQWVHWVIRUWKWKHORFDWLRQW\SHDQGLQWHQVLW\XVHVDQGDOVRHVWDEOLVKHV WKHGHVLUHGPL[DQGUHODWLRQVKLSEHWZHHQXVHV/DQGXVHGHVLJQDWLRQVLGHQWLI\WKH W\SHV DQG QDWXUHR I GHYHORSPHQW SHUPLWWHG WKURXJKRXW WKH SODQQLQJDUHD7KH JRDOVDQGSROLFLHVFRQWDLQHGLQWKH/DQG8VH(OHPHQWSURYLGHWKHIRXQGDWLRQIRU PDLQWDLQLQJ9HUQRQDVDUHJLRQDOPDQXIDFWXULQJDQGLQGXVWULDOFHQWHUZKLOHDOORZLQJ IRUVRPHFRPPHUFLDOXVHVDQGSXEOLFIDFLOLWLHV ,QUHFRJQLWLRQRI9HUQRQ¶VXQLTXHVWDWXVDVDQH[FOXVLYHO\LQGXVWULDOFLW\WKH *HQHUDO3ODQHVWDEOLVKHGDVLQJOHODQGXVHFDWHJRU\,QGXVWULDODQGWKUHHRYHUOD\ GLVWULFWV&RPPHUFLDO5HQGHULQJDQG6ODXJKWHULQJ7KH3URMHFWSURSRVHVWRH[SDQG WKHDUHDWKDWWKH&RPPHUFLD O2YHUOD\DSSOLHV1HZLQIRUP DWLRQDQGSROLFLHVDUH SURSRVHG WR IDFLOLWDWH H[SDQVLRQRIFR PPHUFLDO XVHV QHZ WUXFNDQ G IUHLJKW WHUPLQDOVDQGWRSURPRWHPRUHLQWHQVLYHHPSOR\PHQWJHQHUDWLQJXVHVQHDUWUDQVLW VWRSV$GGLWLRQDOLQIRUPDWLRQRQIORRGKD]DUGVLVSURYLGHGWRFRPSO\ZLWK6WDWHOD Z $% GLVFXVVHG EHORZ )LJXUH /DQG 8VH DQG =RQLQJ 6XPPDU\ VXPPDUL]HVWKHDUHDRIHDFKGHVLJQDWLRQDQG]RQHRIWKHSURSRVHG/DQG8VH3ROLF\ 0DSDQG=RQLQJ0DSQRWHWKDWVRPHRYHUOD\GLVWULFWVRYHUODS Figure 3.0-1 Land Use and Zoning Summary 6DIHW$OHPHQW 7KH6DIHW\(OHPHQWHVWDEOLVKHVSROLFLHVWRSURWHFWWKHFRPPXQLW\IURPQDWXUDODQG KXPDQFDXVHGKD]DUGV7KHHOHPHQWLQFOXGHVDGLVFXVVLRQRIWKRVHIHDWXUHVZLWKLQ 3URMHFW'HVFULSWLRQ )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH RUQHDUWKHSODQQLQJDUHDWKDWUHSUHVHQWDSRWHQWLDOGDQJHUWREXLOGLQJVVWUXFWXUHV SXEOLF IDFLOLWLHV DQG LQIUDVWUXFWXUH 7KH HOHPHQW HVWDEOLVKHV JRDOVSR OLFLHV DQG SODQV WR PLQLPL]H GDQJHUV WRUHVLGHQWV ZRUNHUV DQGYL VLWRUV DVVRFLDWHG ZLWK VHLVPLFKD]DUGVIORRGLQJDQGKD]DUGRXVPDWHULDOV 7KH6DIHW\(OHPHQWKDVEHHQXSGDWHGWRFRPSO\ZLWK$%HQDFWHGLQDQG HIIHFWLYHLQ$%UHYLVHGPXOWLSOHVHFWLRQVRIWKH*R YHUQPHQW&RGHDQG UHTXLUHVIORRGULVNPDQDJHPHQWLQIRUPDWLRQWREHLQFOXGHGLQWKH6DIHW\(OHPHQW $V SDUW RI WKLVX SGDWH IORRG GDWD IURP QHZ )HGHUDO (PHUJHQF\ 0DQDJHPHQW $JHQF$(0$IORRGPDSVZDVDGGHGWRWKH6DIHW\(OHPHQW 5HYLVLRQVZHUHDOVR PDGHWRHDUWKTXDNHIDXOWPDSVWRXSGDWHLQIRUPDWLRQSURYLG HGE\WKH&DOLIRUQLD *HRORJLFDO6XUYH\7KHH[LVWLQJ6DIHW\(OHPHQWJRDOVZLOOUHPDLQWKHVDPH 5HVRXUFHV(OHPHQW 7KH5HVRXUFHV(OHPHQWFRQWDLQVJRDOVDQGSROLFLHVWKDWHQFRXUDJHFRQVHUYDWLRQDQG PDQDJHPHQWRIERWKFXOWXUDODQGQDWXUDOUHVRXUFHVLQFOXGLQJZDWHUUHVRXUFHVRSHQ VSDFHHQHUJ\UHVRXUFHVDLUTXDOLW\DQGKLVWRULFEXLOGLQJVDQGVLWHV 7KH 3URMHFW LQYROYHV OLPLWHG FKDQJHV WR WKH 5HVRXUFHV (OHPHQW6SHFLILFDOO\ LQIRUPDWLRQUHODWHGWRWKH8UEDQ:DWHU0DQDJHPHQW3ODQ8:03DSSOLFDEOHWRWKH &LW\LVXSGDWHGWRUHIOHFWLQIRUPDWLRQLQWKHPRVWUHFHQWO\DGRSWHG8:03 $GGLWLRQDOO\ LQIRUPDWLRQ DQGDSROLF\DUHDGGHGWRDGGUH VV $%WKH*OREDO :DUPLQJ6ROXWLRQV$FWRIDQG6%%RWKODZVUHTXLUHFRQVXOWDWLRQ ZLWK UHJLRQDO JRYHUQPHQWDO JURXSV WR FRRUGLQDWH ODQGX VH FLUFXODWLRQDQ G LQIUDVWUXFWXUHSODQQLQJ7KHH[LVWLQJ5HVRXUFHV(OHPHQWJRDOVZLOOUHPDLQWKHVDPH 1RLVH(OHPHQW 7KH 1RLVH (OHPHQWIRFXVHV RQ PLQLPL]LQJ FRPPXQLW\ QRLVH E\LG HQWLI\LQJ LWV VRXUFHV DQG DVVHVVLQJDOWH UQDWLYH PHWKRGV WR UHGXFH LPSDFWV 7KHHOHPHQ W HVWDEOLVKHV SROLFLHV WR DEDWH QRLVH DQG UHGXFHWKHGHWULP HQWDOKHDOWKHIIH FWV DVVRFLDWHGZLWKH[FHVVLYHQRLVHOHYHOV7KHHOHPHQWLGHQWLILHVQRLVH VWDQGDUGVDQG ODQG XVH FRPSDWLELOLW\ JXLGHOLQHV WR EH XVHG LQ WKH DVVHVVPHQWRIGH YHORSPHQW SURSRVDOVWRSURWHFWQRLVHVHQVLWLYHODQGXVHVIURPH[FHVVLYHQRLVH 7KH 3URMHFW SURSRVHV OLPLWHG FKDQJHV WR WKH1R LVH (OHPHQW WR UHIOHFW WKH &LW\¶V UHFHQWO\DGRSWHGKRXVLQJSROLF\WRSHUPLWKRXVLQJDQGHPHUJHQF\VKHOWHUVLQWZR LGHQWLILHG ORFDWLRQV LQ WKH&LW\LQFOXG LQJ DQH Z SROLF\ WR UHTXLUH QHZ UHVLGHQWLDO GHYHORSPHQW WRXWLOL]HFRQ VWUXFWLRQ DSSURDFKHV WKDWPLQLPL]HDGYHUVH QRLVH DQG YLEUDWLRQHIIHFWVRQUHVLGHQWV$OORWKHU1RLVH(OHPHQWJRDOVUHPDLQWKHVDPH ,PSOHPHQWDWLRQ3ODQ 7KH *HQHUDO3ODQ LQFOXGHV D FRPSUHKHQVLYH ,PSOHPHQWDWLRQ 3ODQWK DW SURYLGHV GLUHFWLRQIRUWUDQVODWLQJJRDOV DQGSROLFLHVWRVSHFLILFDFWLRQV7KH,PSOHPHQWDWLRQ 3ODQ VHUYHV DVDED VLV IRU PDNLQJ IXWXUH SURJUDPPLQJ GHFLVLRQVUHODWHG WRWKH DVVLJQPHQW RIVWDII DQG WKH H[SHQGLWXUH RI &LW\ IXQGV 7KH ,PSOHPHQWDWLRQ 3ODQ LGHQWLILHV LQGLYLGXDO SURJUDP UHVSRQVLELOLW\ IXQGLQJ VRXUFHVDQGDWLPHIUD PH IRU FRPSOHWLRQ 3URMHFW'HVFULSWLRQ 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW $ OLPLWHG QXPEHU RI QHZDFWLRQVZHUH DGGHG WR WKH,P SOHPHQWDWLRQ 3ODQ WR FRUUHODWHZLWKQHZSROLFLHVLQWKH*HQHUDO3ODQDQGIXQGLQJVRXUFHVZHUHUHYLVHGWR UHIOHFWWKHORVVRIUHGHYHORSPHQWIXQGLQJWKURXJKRXWWKHVWDWH Update to Zoning Ordinance and Zoning Map 8SGDWHV WRWKH =RQLQJ 2UGLQDQFH DQG =RQLQJ 0DS VHH ([KLELW 3URSRVHG =RQLQJ 0DS DUH ODUJHO\LQWHQ GHG WRD FKLHYH FRQVLVWHQF\ EHWZHHQ WKH UHYLVLRQV SURSRVHGLQWKH)RFXVHG*HQHUDO3ODQXSGDWHDQGWKH=RQLQJ 2UGLQDQFH5HYLVLRQV LQFOXGH H[SDQVLRQR I WKH&RPPHUFLDO2 YHUOD\ DUHD DQGHVWDEOLVK PHQW RIWKH& DQG&FRPPHUFLDORYHUOD\VHVWDEOLVKPHQWRIDQHZ7UXFNDQG)UHLJKW7HUPLQDO 2YHUOD\'LVWULFWWRSHUPLWDQGSURYLGHIRUGHYHORSPHQWVWDQGDUGVIRUWKHVHXVHVLQ FHUWDLQ DUHDVRIWK H &LW\DOORZIRUVWUHDPOLQHG UHYLHZ RI FHUWDLQ W\SHVR I GHYHORSPHQWSURMHFWVWKURXJKDQHZ0LQRU&RQGLWLRQDO8VH3HUPLWSURFHVVSURYLGH VWDQGDUGV IRU GLJLWDO ELOOERDUGV DQGPLQ RU QRQVXEVWDQWLYH FKDQJHV WR FOHDQXS ODQJXDJHLQWKH2UGLQDQFHWRIDFLOLWDWHLWVLQWHUSUHWDWLRQ &RPPHUFLDO2YHUOD\([SDQVLRQ 7KH&LW\SUHSDUHGUHYLVLRQVWRWKH=RQLQJ2UGLQDQFHWRDFKLHYHFRQVLVWHQF\ZLWKWKH *HQHUDO3ODQ/DQG8 VH0DSDQGSROLFLHVUHODWHGWRFRPPHUFLDOXVHVRISURSHUW\ 7KHVHFKDQJHVDUHUHIOHFWHGLQWKHSURSRVHGDPHQGPHQWVWRWKH=RQLQJ2UGLQDQFH ZLWKWKHHVWDEOLVKPHQWRIWZRVHSDUDWHFRPPHUFLDORYHUOD\V 7KH & 2YHUOD\ =RQH HQFRPSDVVHV DFUHV DQGLG HQWLILHV DUHDV IRUWK H GHYHORSPHQWRIPHUFDQWLOHIDFLOLWLHVLQFOXGLQJFRPPHUFLDOVHUYLFHDQGEXVLQHVV RSHUDWLRQVWKDWDUHQHFHVVDU\WRVXSSRUW LQGXVWULDOXVHVDWORFDWLRQVZKHUHVXFK FRPPHUFLDO VHUYLFH DQGEXVLQHVVRS HUDWLRQV ZRXOGVHUYHH[LVWLQJ RQVLWH EXVLQHVVHV DQG VXUURXQGLQJ XVHV E\LP SURYLQJ DFFHVV WRD JUHDWHU UDQJH RI IDFLOLWLHVDQGVHUYLFHV 7KH&2YHUOD\=RQHHQFRPSDVVHVDFUHVDQGLVGHVLJQHGWRDFFRPPRGDWH LQOLPLWHGDQGVSHFLILFDUHDVRIWKH&LW\ WKRVHXVHVWKDWPD\RUGLQDULO\FRQIOLFW ZLWKWKHLQGXVWULDOFKDUDFWH URIWKH&LW\7KH&2YHUOD\=RQHLVLQWH QGHGWR SURYLGHIRUDUHDVIRUFRPPHUFLDOUHWDLOIDFLOLWLHVDWDKLJKHUOHYHORILQWHQVLW\WKDQ WKRVHSHUPLWWHGLQWKH&2YHUOD\=RQH )UHLJKW7HUPLQDO2YHUOD\=RQLQJ'LVWULFW 7KH&LW\SURSRVHVWRHVWDEOLVKDQHZ7UXFNDQG)UHLJKW7HUPLQDO=RQLQJ2YHUOD\ 'LVWULFW 7)LQDSRUWLRQR I WKH&LW\ DV UHSUHVHQWHG LQ([KLELW'HYHORSP HQW VWDQGDUGVLQFOXGLQJVLWHSODQQLQJVWDQGDUGVDQGDOORZDEOHXVHVDUHLQFOXGHGLQWKH =RQLQJ 2UGLQDQFH DPHQGPHQWV 8QGHUH[ LVWLQJ VWDQGDUGV WUXFNDQ G IUHLJKW WHUPLQDOV ZHUH FRQVLGHUHG OHJDO QRQFRQIRUPLQJ XVHV DQG QHZ XVHV ZHUHQR W SHUPLWWHG :LWKWKH SURSRVHG DPHQGPHQW KRZHYHU QHZ VXFK XVHVZRXOGEH SHUPLWWHG VXEMHFW WR GHYHORSPHQW VWDQGDUGV DQG LVVXDQFH RI D&RQGL WLRQDO 8VH 3HUPLWDQGRQO\ZLWKLQWKHQHZ7UXFNDQG)UHLJKW7HUPLQDO2YHUOD\'LVWULFW 6WUHDPOLQH$GPLQLVWUDWLYH5HYLHZ3URFHVV 7KHSURMHFWLQFOXGHVWKHDGGLWLRQRID0LQ RU&RQGLWLRQDO8VH 3HUPLWSURFHVVWRWKH =RQLQJ2UGLQDQFH7KHSXUSRVHRID0LQRU&RQGLWLRQDO8VH3HUPLWLVWRDOORZIRUWKH 3URMHFW'HVFULSWLRQ )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH SURSHU LQWHJUDWLRQ RI XVHV LQWR WKHFR PPXQLW\ ZKLFK PD\ RQO\E H VXLWDEOH LQ VSHFLILF ORFDWLRQV RU GHVLJQHG DQGFRQVWUXFWH G LQ DSDUWLFX ODUPDQQHU RUXQG HU FHUWDLQFRQGLWLRQVEXWDUHRIDVFDOHWKDWZRXOGEHOHVVLPSDFWIXOWKDQWKRVHWKDW PD\EHSHUPLWWHGZLWKD&RQGLWLRQDO8VH3HUPLW7KH0LQRU&R QGLWLRQDO8VH3HUPLW ZRXOGEHUHYLHZHGDQGDSSURYHGRUGHQLHGE\WKH'LUHFWRURI&RPPXQLW\6HUYLFHV DQGZRXOGEHDSSOLFDEOHWRFHUWDLQFR PPHUFLDOXVHVLQFLGHQWDOXVHVDQGDQFLOODU\ UHWDLOXVHVDVVSHFLILHGLQWKH=RQLQJ2UGLQDQFH 'LJLWDO%LOOERDUGV 7KH SURMHFW LQFOXGHV HVWDEOLVKPHQWR I GHYHORSPHQW VWDQGDUGV DQG GHILQLWLRQV UHODWHG WR WKHUHJX ODWLRQ RI GLJLWDO ELOOERDUGV IRU ZKLFKWKHH[LVWLQ J =RQLQJ 2UGLQDQFHLVVLOHQW &LW\ VWDQGDUGV FRPSRUWZLWK VWDQGDUGVDQGJXLGHOLQHVRI WKH &DOLIRUQLD'HSDUWPHQWRI7UDQVSRUWDWLRQ&DOWUDQVIRUGLJLWDOELOOERDUGVZLWKLQ IHHWRIDIUHHZD\ULJKWRIZD\ 'HILQLWLRQVDQG&OHDQ8S,WHPV 6HFWLRQ'HILQLWLRQVRIWKH=RQ LQJ2UGLQDQFHLVSURSRVHGWREHXSGDWHGWR LQFUHDVH FODULW\LQLQWHUSUH WDWLRQ DQGLPSOHP HQW WKHDERYHSROLF\FKDQJHV$ QXPEHU RI GHILQLWLRQV DUHSURSRVH G WR EHDGGHGRUPRG LILHG LQFOXGLQJ WKH GHILQLWLRQVRIFDQRS\FHOOWRZHUFRPPXQLW\IDFLOLW\FRQWUDFWRU¶V\DUGIORRUDUHD UDWLR IUHLJKW WHUPLQDOJDUDJ H KD]DUGRXVZDVWH IDFLOLW\LQFLGHQ WDO XVHSRZH U JHQHUDWLQJ IDFLOLW\ SXEOLF XWLOLW\ UHWDLO XVHVODXJKWHULQJ WUXFNWHUPLQDODQ G ZDUHKRXVHXVHDPRQJRWKHUV 7KH =RQLQJ 2UGLQDQFH LVS URSRVHG WRE H XSGDWHG ZLWKWKH IROORZLQJ DGGLWLRQDO FKDQJHV $GGLWLRQDOXVHVSHUPLWWHGE\ULJKWDGGHGDQGXVHVSHUPLWWHGZLWKD&RQGLWLRQDO 8VH3HUPLWRU0LQRU&RQGLWLRQDO8VH3HUPLWDGGHGRUUHYLVHG %XIIHUUHTXLUHPHQWVIRUDFXWHO\KD]DUGRXVPDWHULDOVZLWKLQIHHWRIDVFKRRO DGGHG 6FUHHQLQJRIRXWGRRUVWRUDJHDFWLYLWLHVPRGLILHG &ODULILFDWLRQVRQZDWHUXVDJHUHTXLUHPHQWVIRU&RQGLWLRQDO8VH3HUPLWVDGGHG 3HUIRUPDQFHPHDVXUHVIRUQR[LRXVRGRUVDGGHG &ODULILFDWLRQVRQUHTXLUHGQXPEHURISDUNLQJE\XVHSDUNLQJDFFHVVDQGVWUHHW GHGLFDWLRQ ([WHQVLRQ RI DPRUWL]DWLRQ RI QRQFRQIRUPLQJ RXWGRRU DFWLYLWLHV DQG VWRUDJH WR 2WKHUPLQRUFODULILFDWLRQDQGW\SRJUDSKLFDOFKDQJHV Project Objectives 7KLV3URMHFWLVEHLQJSXUVXHGVRWKDWWKH&LW\¶V*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH DUH FRQVLVWHQW ZLWK 6WDWH ODZ DQGFRQ VLVWHQW ZLWKHDFKRWKHUDQGWRSUR YLGH VWDQGDUGVDQG=RQLQJ'LVWULFW2YHUOD\VIRUXVHVWKDWZHUHQRWSUHYLRXVO\DGGUHVVHG RUDGGUHVVHGWRDOHVVHUGHWDLOLQWKHH[LVWLQJ=RQLQJ2UGLQDQFH 3URMHFW'HVFULSWLRQ 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW 2WKHU REMHFWLYHV RI WKH*HQHUDO3ODQUH PDLQ XQFKDQJHG6SHFLILFDOO\WKH&LW\¶ V LQWHQWLVWRFRQWLQX HWRVXSSRUWWKHRQJR LQJLQGXVWULDOFKDUDFWHURIWKH &LW\ZKLOH UHFRJQL]LQJWKHFKDQJLQJLQGXVWULDOHQYLURQPHQWWKURXJKRXWWKH8QLWH G6WDWHVDQG JOREDOO\ DQG WRUHVS RQG DSSURSULDWHO\ 7KH 9HUQRQ *HQHUDO3ODQLV LQWHQGHG WR DFKLHYHWKHIROORZLQJREMHFWLYHV 7RDOORZ9HUQRQWRUHPDLQDQH[FOXVLYHO\ LQGXVWULDOFLW\WKDWVHUYHVWKHQHHGVRI LQGXVWU\ LQFOXGLQJ WKH PDQXIDFWXUH RI JRRGV IRUOR FDO QDWLRQDO DQG LQWHUQDWLRQDOFRQVXPHUV 7R SURYLGH DEDOD QFHG WUDQVSRUWDWLRQ V\VWHP IRU WKH VDIH DQGHIILFLHQW PRYHPHQWRISHRSOHJRRGVDQGHPHUJHQF\VHUYLFHVWKURXJKRXWWKH&LW\ 7RPDLQWDLQDQGLPSURYHWKH&LW\¶VLQIUDVWUXFWXUHVHUYLFHVWRPHHWWKHQHHGVRI LQGXVWU\ 7RPLQLPL]HWKHULVNWRSXE OLFKHDOWKVDIHW\DQGZHOIDUHDVVRFLDWHGZLWKWKH SUHVHQFHRIQDWXUDODQGKXPDQFDXVHGKD]DUGV 7RFRQVHUYHDQGSURWHFWWKH&LW\¶VQDWXUDOUHVRXUFHVLQFOXGLQJZDWHUHQHUJ\ RSHQVSDFHDQGDLUTXDOLW\ Surrounding Land Uses 7KHSURMHFWDSSOLHVWRDOOSDUFHOVZLWKLQWKH&LW\ RI9HUQRQDQGLWVXQLQFRUSRUDWHG VSKHUH RI LQIOXHQFH 9HUQRQLVDGMDFHQ W WRWKHFLWLH V RI/RV$QJHOHV+X QWLQJWRQ 3DUN 0D\ZRRGDQG&RPPH UFH 6XU URXQGLQJ XVHV LQ WKHVH FLWLHVLQFOXGH UHVLGHQWLDOFRPPHUFLDODQGLQGXVWULDOXVHV :LWK UHJDUG WRS URSRVHG *HQHUDO 3ODQOD QG XVH FKDQJHV DQG UHODWHGFRQVLVWHQ F\ =RQLQJ0DSFKDQJHVWKHSURMHFWZRXOGH[SDQGWKH&RPPHUFLDO2YHUOD\'LVWULFW 7KH&RPPHUFLDO2YHUOD\'LVWULFWZRXOGEHFRPSULVHGRIWZRVHSDUDWHFRPPHUFLDO RYHUOD\V&DQG&7KH&&RPPHUFLDO2YHUOD\'LVWULFWZRXOGFRQVWLWXWHWKH H[SDQVLRQDUHDDQGLVSURSRVHGWRLQFOXGHDGGLWLRQDOSDUFHOVDORQJ6RWR6WUHHWDV ZHOODVSURSHUWLHVRQ6ODXVRQ$YHQXHDQG$WODQWLF%RXOHYDUG6XUURXQGLQJXVHVDUH JHQHUDOO\ LQGXVWULDO LQQD WXUH ZLWKD OLPLWHG QXPEHU RI FRPPHUFLDO XVHV $GGLWLRQDOO\WKHSRWHQWLDOH[SDQVLRQRIWKH&RPPHUFLDO2YHUOD\'LVWULFWZRXOGEH DGMDFHQWWR0D\ZRRG(OHPHQWDU\6FKRROORFDWHGLQWKHDGMDFHQW&LW\RI0D\ZRRG 7KH =RQLQJ 0DSKDVDQDGGLWLRQDOSUR SRVHG DPHQGPHQW WKH7UXFNDQG )UHLJKW 7HUPLQDO 2YHUOD\ 'LVWULFW 7KLVRYHUOD \ ZRXOGDSS O\ WRDQRUWKHUQSRU WLRQ RIWK H &LW\DVLQGLFDWHGLQ([KLELW3URSRVHG=RQLQJ0DS6XUURXQGLQJXVHVDUH JHQHUDOLQGXVWULDOLQQDWXUHDVZHOODVUDLO\DUGVDQGUDLOOLQHV7KH/RV$QJHOHV 5LYHUERUGHUVPXFKRIWKLVSURSRVHG2YHUOD\'LVWULFW Environmental Setting 7KH&LW\RI9HUQRQLVORFDWHGLQWKHFHQWUDOSRUWLRQRI/RV$QJHOHV&RXQW\GLUHFWO\ VRXWKHDVW RIGRZQW RZQ /RV$QJHOH V 9HUQRQL V DGMDFHQW WRWKHFLWLHVRI/RV $QJHOHV+XQWLQJWRQ3DUN0D\ZRRGDQG&RPPHUFH9HUQRQLVFRQQHFWHGWRWK H UHJLRQDO UDLOOLQHV YLD WKH $ODPHGD &RUULGRU ZKLFKLVWKH SULPDU\ FRQQHFWLRQ EHWZHHQ WKHSRUWVR I /RV $QJHOHV DQG /RQJ %HDFK DQGWKH UDLO \DUGV ORFDWHG LQ 9HUQRQ&RPPHUFHDQGGRZQWRZQ/RV$QJHOHV$SRUWLRQR IWKH+REDUW<DUGDQ 3URMHFW'HVFULSWLRQ )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH LQWHUPRGDO IDFLOLW\ ZKHUH ODUJH VKLSSLQJ FRQWDLQHUV DUHWUDQ VIHUUHG IURP UDLOURDG FDUVWRWUXFNVDQGYLFHYHUVDLVDOVRORFDWHGLQ9HUQRQ 7KH FRUSRUDWH OLPLWVRIWKH& LW\ RI 9HUQRQ HQFRPSDVV DSSUR[LPDWHO\ VTXDUH PLOHVH[WHQGLQJJHQHUDOO\IURP$ODPHGD6WUHHWDQGWKH$ODPHGD&RUULGRURQWK H ZHVW WR WKH , IUHHZD\ WRWKH HDVWDQG IURP WKH FLWLHVR I 0D\ZRRG DQG +XQWLQJWRQ3DUNRQWKHVRXWKDQGWKHFLWLHVRI/RV$QJHOHVDQG&RPPHUFHWRWKH QRUWK$SRUWLRQRIXQLQFRUSRUDWHG/RV$Q JHOHV&RXQW\LVORFDWHGLQWKHSODQQLQJ DUHDWKDWLQFOXGHVSULPDULO\LQGXVWULDOXVHVDQGSRUWLRQVR IWKH/RV$QJHOHV5LYHU /DQGV ZLWKLQ9HUQ RQ ODUJHO\ KDYH EHHQ GHYHORSHG ZLWK LQGXVWULDOXVHVVLQ FH LQFRUSRUDWLRQLQ&ORVHW RHPSOR\HHVFRPPXWHLQWR9HUQRQGDLO\WR ZRUN LQ WKHPDQXIDFWXULQJZDUHKR XVLQJ LQGXVWULDODQGWUD QVSRUWDWLRQ UHODWHGEXVLQHVVHV$VRI9HUQRQKDGRQO\UHVLGHQFHVDQGDSRSXODWLRQRI SHUVRQV Required Approvals 7KH&LW\&RXQFLOPXVWDSSURYHD*HQHUDO3ODQ$PHQGPHQWWKDWLQFRUSRUDWHVWKH IRFXVHGXSGDWHVLQWRWKHFXUUHQW*HQHUDO3ODQLQFOXGLQJDQDPHQGPHQWWRWKH /DQG8VH0DSWRH[SDQGWKH&RPPHUFLDO2YHUOD\ 7KH&LW\&RXQFLOPXVWDSSURYHD=RQH2UGLQDQFH7H[W$PHQGPHQWWRFUHDWHDQG LPSOHPHQW WKH7UXFNDQG)UH LJKW 7HUPLQDO 2YHUOD\ H[SDQG WKH&RPPHUFLDO 2YHUOD\ DQG LQFRUSRUDWH RWKHU IRFXVHG DPHQGPHQWV DV LWHPL]HGDERYH WR IDFLOLWDWHLPSOHPHQWDWLRQDQGHDVHLQWHUSUHWDWLRQRIWKH=RQLQJ2UGLQDQFH 7KH&LW\&RXQFLOPXVWDSSURYHD=RQLQJ0DS$PHQGPHQWWRDSSO\WKH7UXFNDQG )UHLJKW7HUPLQDO2YHUOD\DQGH[SDQVLRQRIWKH&R PPHUFLDO2YHUOD\LQFOXGLQJ ERWK&DQG&RYHUOD\VWRWKH=RQLQJ0DS Other Public Agencies Whose Approval Is Required 1RQH Approach 7KHHQYLURQPHQWDODQDO\VLVFRQWDLQHGLQWKLV6XSSOHPHQWDO3URJUDP(,5LVEDVHGRQ WKHIROORZLQJDVVXPSWLRQV 3URMHFW 6SHFLILF (QYLURQPHQWDO 5HYLHZ,Q WKH& LW\ RI 9HUQRQ DOO GHYHORSPHQW SURSRVDOV WKDWDUHFRQVLGH UHG ³SURMHFWV´ XQGHU &(4$DUHVXE MHFWWRWKH HQYLURQPHQWDO UHYLHZ SURFHVVWRGH WHUPLQH WKH OHYHO RILPSDFWDQ G WRLPSR VH DSSURSULDWHPLWLJDWLRQPHDVXUHVLIQHHGHGWRDYRLGVLJQLILFDQWLPSDFWV 3XUSRVH DQG )RFXV RIWKLV6X SSOHPHQWDO (,5IRU WKH )RFXVHG *HQHUDO 3ODQDQG =RQLQJ 2UGLQDQFH (QYLURQPHQWDO 5HYLHZ 7KLV SURMHFW ZRXOG QRWDXWK RUL]H DQ\ SODQVIRUFRQVWUXFWLRQRIQHZXVHVRUUHGHYHORSPHQWRIDQ\SURSHUWLHVWRSURGXFH QHZ XVHV 7KHSURSRVHG SURMHFW LVDQXSGDWHWR H[LVWLQJ SROLF\GRFXPHQWV1R RWKHUGLUHFWHQYLURQPHQWDOLPSDFWVZRXOGRFFXU7KHSXUSRVHRIWKHHQYLURQPHQWDO DVVHVVPHQWLVWRLGHQWLI\FKDQJHVWRWKH*HQHUDO3ODQDQG=RQLQJ 2UGLQDQFHVDQG WKHDVVRFLDWHGFKDQJHVWRWKHSUHYLRXVO\FHUWLILHG(,5QHHGHGWRPDNHWKHSUHYLRXV (,5DGHTXDWHO\DSSO\WRWKHSURMHFWDVUHYLVHG&(4$*XLGHOLQHV6HFWLRQ 3URMHFW'HVFULSWLRQ 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW Exhibit 3.0-1 Regional Context and Vicinity Map 3URMHFW'HVFULSWLRQ )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH Proposed General Plan Land Use Policy Map Proposed Zoning Map Introduction 1 Executive Summary 2 Project Description 3 Environmental Impact Analysis 4 Alternatives 5 Analysis of Long Term Effects 6 Effects Found Not to be Significant 7 Preparation Team 8 References 9 1 Introduction 2 Executive Summary 3 Project Description 4 Environmental Impact Analysis 5 Alternatives 6 Analysis of Long Term Effects 7 Effects Found Not to be Significant 8 Preparation Team 9 References 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW Air Quality 4.1 This section of the Supplemental EIR examines potential impacts to air quality in Vernon, and whether future development permitted due to changes to the General Plan and the Zoning Code and associated changes to the certified Program EIR would increase those impacts. The Initial Study (Appendix A) indicated that there will be no impacts relative to objectionable odors. Environmental Setting Vernon lies within the South Coast Air Basin (SCAB), a 6,600-square-mile coastal plain bounded by the Pacific Ocean to the west and the San Gabriel, San Bernardino, and San Jacinto mountains to the north and east. The SCAB includes all of Orange County and the non-desert portions of Los Angeles, Riverside, and San Bernardino Counties. The SCAB is a non-attainment area for federal standards for carbon monoxide (CO). The SCAB is also a non-attainment area for federal and state air quality standards for ozone (O3), particulate matter less than 10 microns in diameter (PM10) and particulate matter less than 2.5 microns in diameter (PM2.5). Climate and Meteorological Conditions Area climatological conditions are characterized by warm summers, mild winters, infrequent rainfall, moderate onshore daytime breezes, and moderate humidity. All seasons generally exhibit onshore wind flows during the day and offshore flows at night, after the land cools below the temperature of the ocean. The likelihood of strong offshore flows, including Santa Ana winds, is greater during winter than during summer. (California Air Resources Board, 1984) The topography and climate of Southern California combine to produce unhealthful air quality within the SCAB. Low temperature inversion, light winds, shallow vertical mixing, and extensive sunlight, in conjunction with topographical features such as adjacent mountain ranges that hinder dispersion of air pollutants, combine to create degraded air quality, especially in inland valleys of the basin. Existing Air Quality Conditions Air quality is determined primarily by the type and amount of contaminants emitted into the atmosphere, the size and topography of a basin, and a basin’s meteorological conditions. Atmospheric conditions such as wind speed, wind direction, and air temperature gradients, along with local topography, provide the link between air pollution emissions and air quality. The Program Environmental Impact Report discussed air quality standards, regulations, and pollutant concentrations. The SCAQMD regulates air quality improvement programs within the SCAB and works to improve regional air quality to achieve federal and state standards. The monitoring stations record concentrations of various pollutants including: O3, carbon monoxide (CO), nitrogen dioxide (NO2), sulfur dioxide (SO2), PM10, particulate matter less than 2.5 microns $LU4XDOLW\ 4.1-2 )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH in diameter (PM2.5), lead (Pb), and sulfates (SO4). An updated Table 4.1-1 summarizes the state and federal standards and sources of criteria pollutants as of 2012. Air pollution levels are measured at monitoring stations located throughout the Basin. Areas that are in nonattainment with respect to criteria pollutants are required to prepare plans and implement measures that will bring the region into attainment. Table 4.1-2 (South Coast Air Basin Attainment Status) summarizes the attainment status in the Basin for the criteria pollutants. The Basin is currently in nonattainment status for ozone and inhalable and fine particulate matter. Pollution problems in the Basin are caused by emissions within the area and the specific meteorology that promotes pollutant concentrations. Emissions sources vary widely from smaller sources such as individual residential water heaters and short-term grading activities to extensive operational sources including long-term operation of electrical power plants and other intense industrial use. Pollutants in the Basin are blown inward from coastal areas by sea breezes from the Pacific Ocean and are prevented from horizontally dispersing due to the surrounding mountains. This is further complicated by atmospheric temperature inversions that create inversion layers. The inversion layer in Southern California refers to the warm layer of air that lies over the cooler air from the Pacific Ocean. This is strongest in the summer and prevents ozone and other pollutants from dispersing upward. A ground-level surface inversion commonly occurs during winter nights and traps carbon monoxide emitted during the morning rush hour. Measurements taken by SCAQMD at the Central Los Angeles monitoring station from 2001 to 2005 were summarized in the certified Program EIR. Table 4.1-3 summarizes measurements taken from 2006 to 2012 and shows that air quality standards at these locations have been exceeded for PM2.5, PM10, and O3. This is consistent with the entire SCAB's classification as non-attainment for PM10 and O3. The following summary of pollutants was provided in the Program EIR with updated information on exceedance of standards for Ozone. All other pollutants Ozone (O3). The most pervasive air quality problem in the Basin is high ozone concentrations. Ozone is the principal component of smog and is formed in the atmosphere through a complex series of photochemical reactions involving volatile organic compounds (VOC) and nitrogen oxides (NOX), which are commonly referred to as precursors of O3 and are both considered critical in O3 formation; NOX includes various combinations of nitrogen and oxygen, including NO, NO2, NO3, etc. Significant O3 production generally requires about three hours in a stable atmosphere with strong sunlight. Ozone is a regional air pollutant because it is transported and diffused by wind concurrent with the photochemical reaction process. Motor vehicles are the major source of ozone precursors in the air basin. During late spring, summer, and early fall, light winds, low mixing heights, and abundant sunshine combine to produce conditions favorable for maximum production of O3. Ozone causes eye and respiratory irritation, reduces resistance to lung infection, and may aggravate pulmonary conditions in persons with lung disease. Ozone is also damaging to vegetation and untreated rubber. Control $LU4XDOLW\ 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW 3 strategies for O3 have focused on reducing emissions from vehicles, industrial processes using solvents and coatings, and consumer products. In each of the five latest years for which air quality data exists (2006-2012), the state 1-hour ozone standard was exceeded in Central Los Angeles for as many as eight days (see Table 4.1-4). In 1997, the United States Environmental Protection Agency (USEPA) issued a new standard for O3, using an 8-hour average. After years of litigation, the standard was approved and attainment designations were made. Los Angeles County is in nonattainment for both the state and federal standards; federal standards were exceeded at the Central Los Angeles monitoring station for a total of five days between 2001 and 2005, with the most in one year being two days in 2003. In June of 2005, the federal 1-hour O3 standard was revoked by the USEPA. Carbon Monoxide (CO). CO is a colorless and odorless gas which, in the urban environment, is associated primarily with the incomplete combustion of fossil fuels in motor vehicles. Relatively high concentrations are typically found near crowded intersections and along heavily used roadways carrying slow-moving traffic. Even under the most severe meteorological and traffic conditions, high concentrations of CO are limited to locations within a relatively short distance (300 to 600 feet) of heavily traveled roadways. Overall, CO emissions are decreasing as a result of the Federal Motor Vehicle Control Program, which has mandated increasingly lower emission levels for vehicles manufactured since 1973. Concentrations of CO are typically higher in winter. As a result, California has required the use of oxygenated gasoline in the winter months to reduce CO emissions. CO interferes with the transfer of oxygen to the blood. It may cause dizziness and fatigue and can impair central nervous system functions. The 1-hour and 8-hour average CO standards have not been exceeded at the Central Los Angeles Monitoring Station during the last five years (see Table 4.1-4). Nitrogen Dioxide (NO2). There are two oxides of nitrogen that are important in air pollution: nitric oxide (NO) and NO2. NO, along with some NO2, is emitted from motor vehicle engines, power plants, refineries, industrial boilers, ships, aircraft, and railroads. NO2 is primarily formed when NO reacts with atmospheric oxygen in the presence of VOC and sunlight; the other product of this reaction is O3. Nitrogen dioxide is the whiskey-brown colored gas, more commonly known as smog, observed during periods of heavy air pollution. Concentrations of NO2 are highest during the late fall and winter. NO2 increases damage from respiratory disease and irritation, and may reduce resistance to certain infections. Neither the federal nor state standards for NO2 have been exceeded in Central Los Angeles during the last five years (see Table 4.1-4). Particulate Matter (PM). PM is a complex mixture of extremely small particles and liquid droplets. PM is made up of a number of components, including acids (such as nitrates and sulfates), organic chemicals, metals, and soil or dust particles. Natural sources of particulates include windblown dust and ocean spray. $LU4XDOLW\ 4.1-4 )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH The size of PM is directly linked to the potential for causing health problems. The USEPA is concerned about particles that are 10 micrometers in diameter or smaller because those are the particles that generally pass through the throat and nose and enter the lungs. Once inhaled, these particles can affect the heart and lungs and cause serious health effects. Health studies have shown a significant association between exposure to PM and premature death. Other important effects include aggravation of respiratory and cardiovascular disease, lung disease, decreased lung function, asthma attacks, and certain cardiovascular problems such as heart attacks and irregular heart beat (USEPA 2006). Individuals particularly sensitive to fine particle exposure include older adults, people with heart and lung disease, and children. The USEPA groups PM into two categories: fine particulate matter and coarse particulate matter. Fine Particulate Matter (PM2.5). Fine particles, such as those found in smoke and haze, are 2.5 micrometers in diameter and smaller. Sources of fine particles include all types of combustion activities (motor vehicles, power plants, wood burning, etc.) and certain industrial processes. PM2.5 is the major cause of reduced visibility (haze) in California. Ammonium nitrates and ammonium sulfates represent a dominant fraction of PM2.5 components and are formed in the atmosphere thorough secondary reactions of precursor emissions of NOx, SOx and ammonia. Reducing the sulfur content of fuels has proven to be an effective measure of control for SOx reductions, and thereby PM2.5. Control of PM2.5 is primarily achieved through the regulation of emission sources, such as the USEPA’s Clean Air Interstate Rule and Clean Air Visibility Rule for stationary sources, and the 2004 Clean Air Non-road Diesel Rule, the Tier 2 Vehicle Emission Standards, and Gasoline Sulfur Program; or the California Air Resources Board (CARB) Goods Movement reduction plan. Coarse Particulate Matter (PM10). Inhalable coarse particles, such as those found near roadways and dusty industries, are larger than 2.5 micrometers and smaller than 10 micrometers in diameter. Sources of coarse particles include crushing or grinding operations and dust from paved or unpaved roads. The health effects of PM10 are similar to PM2.5. Control of PM10 is primarily achieved through the control of dust at construction and industrial sites, the cleaning of paved roads, and the wetting or paving of frequently used unpaved roads. Sulfur Dioxide (SO2). SO2 is a combustion product, with the primary source being power plants and heavy industry that use coal or oil as fuel. SO2 is also a product of diesel engine combustion. The health effects of SO2 include lung disease and breathing problems for asthmatics. SO2 in the atmosphere contributes to the formation of acid rain. In the SCAB, there is relatively little use of coal and oil, and SO2 is of lesser concern than in many other parts of the country. The federal and state standards for SO2 have not been exceeded in the last five years at the Central Los Angeles Monitoring Station (see Table 4.1-4). $LU4XDOLW\ 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW 5 Table 4.1-1 National and California Ambient Air Quality Standards Pollutant Averaging Time California Standards1 Federal Standards2 Concentration3 Method4 Primary3.5 Secontary3.6 Method7 Ozone (O3) 1 Hour 0.09 ppm (180 μg/m3)Ultraviolet Photometry -Same as Primary Standard Ultraviolet Photometry 8 Hour 0.07 ppm (137 μg/m3) 0.075 ppm (147 μg/m3) Respirable Particulate Matter (PM10) 24 Hour 50 μg/m3 Gravimetric or Beta Attenuation 150 μg/m3 Same as Primary Standard Inertial Separation and Gravimetric Analysis Annual Arithmetic Mean 20 μg/m3 - Fine Particulate Matter (PM2.5) 24 Hour No Separate State Standard 35 μg/m3 Same as Primary Standard Inertial Separation and Gravimetric Analysis Annual Arithmetic Mean 12 μg/m3 Gravimetric or Beta Attenuation 15 μg/m3 Carbon Monoxide (CO) 1 Hour 20 ppm (23 mg/ m3) Non-Dispersive Infrared Photometry (NDIR) 35 ppm (40 mg/m3)None Non-Dispersive Infrared Photometry (NDIR) - 1 Hour 9.0 ppm (10mg/m3) 9 ppm (10 mg/m3) 8 Hour (Lake Tahoe) 6 ppm (7 mg/ m3)- - Nitrogen Dioxide (NO2) Annual Arithmetic Mean 0.03 ppm (57 μg/m3)Gas Phase Chemiluminescence 0.053 ppm (100 μg/m3) Same as Primary Standard Gas Phase Chemiluminescence 1 Hour 0.18 ppm (339 μg/m3) 100 ppb (188 μg/m3)- Sulfur Dioxide (SO2) 1 Hour 0.25 ppm (655 μg/m3) Ultraviolet Fluorescence 75 ppb (196 μg/m3)- Ultraviolet Fluorescence; Spectrophotometry (Pararosaniline Method) - 3 Hour - - 0.5 ppm (1,300 μg/m3) 24 Hour 0.04 ppm (105 μg/m3) 0.14 ppm (for certain areas)9 - Annual Arithmetic Mean - 0.030 ppm (for certain areas)9 - Lead9 30 Day Average 1.5 μg/m3 Atomic Absorption -- High Volume Sampler and Atomic Absorption Calendar Quarter - 1.5 μg/m3 (for certain areas)11 Same as Primary Standard Rolling 3-Month Average10 - 0.15 μg/m3 Visibility Reducing Particles 8 Hour See footnote 12 Beta Attenuation and Transmittance through Filter Tape No Federal Standards Sulfates 24 Hour 25 μg/m3 Ion Chromatography Hydrogen Sulfide 1 Hour 0.03 ppm (42 μg/m3)Ultraviolet Fluorescence Vinyl Chloride9 24 Hour 0.01 ppm (26 μg/m3)Gas Chromatography Source: ARB, June 2012 PPM, parts per million μg/m3, micrograms per cubic meter 1. California standards for ozone, carbon monoxide (except 8-hour Lake Tahoe), sulfur dioxide (1 and 24 hour), $LU4XDOLW\ 4.1-6 )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH and particulate matter (PM10, PM2.5, and visibility reducing particles), are values that are not to be exceeded. All others are not to be equaled or exceeded. California ambient air quality standards are listed in the Table of Standards in Section 70200 of Title 17 of the California Code of Regulations. 2. National standards (other than ozone, particulate matter, and those based on annual averages or annual arithmetic mean) are not to be exceeded more than once a year. The ozone standard is attained when the fourth highest eight-hour concentration in a year, averaged over three years, is equal to or less than the standard. For PM10, the 24-hour standard is attained when the expected number of days per calendar year with a 24-hour average concentration above 150 ǋg/m3 is equal to or less than one. For PM2.5, the 24-hour standard is attained when 98 percent of the daily concentrations, averaged over three years, are equal to or less than the standard. Contact U.S. EPA for further clarification and current federal policies. 3.Concentration expressed first in units in which it was promulgated. Equivalent units given in parentheses are based upon a reference temperature of 25°C and a reference pressure of 760 torr. Most measurements of air quality are to be corrected to a reference temperature of 25°C and a reference pressure of 760 torr; ppm in this table refers to ppm by volume, or micromoles of pollutant per mole of gas. 4. Any equivalent procedure which can be shown to the satisfaction of the ARB to give equivalent results at or near the level of the air quality standard may be used. 5. National Primary Standards: The levels of air quality necessary, with an adequate margin of safety to protect the public health. 6. National Secondary Standards: The levels of air quality necessary to protect the public welfare from any known or anticipated adverse effects of a pollutant. 7. Reference method as described by the EPA. An “equivalent method” of measurement may be used but must have a “consistent relationship to the reference method” and must be approved by the EPA. 8. To attain the 1-hour national standard, the 3-year average of the 98th percentile of the daily maximum 1-hour average at each monitor within an area must not exceed 100ppb. To directly compare the national standards to the California standards the units can be converted from ppb to ppm. In this case, the national standards of 100ppb is identical to 0.100ppm. 9. On June 2, 2010, a new 1-hour SO2 standard was established and the existing 24-hour and annual primary standards were revoked. To attain the 1-hour national standard, the 3-year average of the annual 99th percentile of the 1-hour daily maximum concentrations at each site must not exceed 75 ppb. The 1971 SO2 national standards (24-hour and annual) remain in effect until one year after an area is designated for the 2010 standard, except that in areas designated nonattainment for the 1971 stanards, the 1971 standards remain in effect until implementation plans to attain or maintain the 2010 standards are approved. Note that the 1-hour national standard is in units of parts per billion (ppb). California standards are in units of parts per million (ppm). To directly compare the 1-hour national standard to the California standard the units can be converted to ppm. In this case, the national standard of 75 ppb is identical to 0.075 ppm. 10. The ARB has identified lead and vinyl chloride as “toxic air contaminants” with no threshold level of exposure for adverse health effects determined. These actions allow for the implementation of control measures at levels below the ambient concentrations specified for these pollutants. 11. The national standard for lead was revised on October 15, 2008 to a rolling 3-month average. The 1978 lead standard (1.5 μg/m3 as a quarterly average) remains in effect until one year after an area is designated for the 2008 standard, except that in areas designated nonattainment for the 1978 standard, the 1978 standard remains in effect until implementation plans to attain or maintain the 2008 standard are approved. 12. In 1989, the ARB converted both the general statewide 10-mile visibility standard and the Lake Tahoe 30-mile visibility standard to instrumental equivalents, which are “extinction of 0.23 per kilometer” and “extinction of 0.07 per kilometer” for the statewide and Lake Tahoe Air Basin standards, respectively. $LU4XDOLW\ 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW 7 Table 4.1-2 South Coast Air Basin Attainment Status Pollutant Federal State O3 (1-hr) -- Nonattainment O3 (8-hr) Nonattainment Nonattainment PM10 Nonattainment Nonattainment PM2.5 Nonattainment Nonattainment CO Attainment Attainment NO2 Attainment Nonattainment SO2 Attainment Attainment Pb Nonattainment Nonattainment VRP -- Unclassified SO4 -- Attainment H2S -- Unclassified Sources: ARB 2013 Table 4.1-3 Air Quality Data for 2006 to 2012: Central Los Angeles Monitoring Station Pollutant (units) Averaging Time Maximum Concentrationsi 2006 2007 2008 2009 2010 2011 2012 O3 (ppm) 1 hour 0.11 0.115 0.109 0.139 0.098 0.087 0.093 8 hours 0.079 0.102 0.090 0.100 0.080 0.065 0.077 CO (ppm) 1 hour 3 3 3 3 3 N/A N/A 8 hours 2.6 2.2 2.1 2.2 2.3 2.4 1.9 NO2 (ppm) 1 hour 0.11 0.10 0.12 0.12 0.089 0.110 77.3* Annual (AAM) 0.0288 0.0299 0.0275 0.0281 0.025 0.0231 24.8* PM10 (μg/m3) 24 hours 59 78 66 72 42 53 80 Annual(AAM) 30.3 33.3 30.9 33.1 27.1 29.0 30.2 PM2.5 (μg/m3) 24 hours 56.2 64.2 78.3 61.7 39.2 49.3 58.7 Annual (AAM) 15.6 16.8 15.7 14.3 11.9 13.0 12.5 SO2 (ppm) 1 hour 0.03 0.01 0.01 0.01 9.8* 19.8* 5.2* 24 hours 0.006 0.003 0.002 0.002 1.5* N/A N/A Source: South Coast Air Quality Management District, 2006-2012. * In ppb Table 4.1-4 2006-2012 Air Quality Standards Exceedance Year O3 (PPM) PM10 (μg/m3)PM2.5 (μg/m3) Fed* 8-hr State 1-hr State 8-hr Fed 24-hr State 24-hr Fed^ 24-hr 2006 0 8 4 0 3 (5.1) 11 (3.3) 2007 3 3 6 0 5 (9) 20 (0.6) 2008 3 3 7 0 2 (4%) 10 (3.0) 2009 2 3 5 0 4 (6.7) 7 (1.9) 2010 1 1 1 0 0 2 (0.6%) 2011 0 0 0 0 1 (2%) 4 (1.2%) 2012 1 0 2 0 4 4 Source: SCAQMD 2006-2012 -- pollutant not monitored * 0.075 ppm ^35 μg/m3 $LU4XDOLW\ 4.1-8 )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH Sensitive Receptors The SCAQMD defines sensitive receptors as populations more susceptible to the effects of air pollution than the general population. Sensitive receptors, as defined by SCAQMD and used in this section of this Supplemental EIR, include asthmatics, the elderly, very young children, people already weakened by other disease or illness, and persons engaged in strenuous work or exercise. Sensitive receptors located in or near the vicinity of known air emissions sources, including freeways and heavily traveled intersections, are of particular concern. Toxic Air Pollutants Toxic air pollutants, such as asbestos, can be emitted during the demolition of buildings that contain toxic contaminants and during the operation of certain industrial processes that utilize toxic substances. Federal and state governments have implemented a number of programs to control toxic air emissions. For example, the federal Clean Air Act provides a program for the control of hazardous air pollutants. In addition, the California legislature has enacted programs such as the Tanner Toxics Act (AB1807), the Air Toxics Hot Spot Assessment Program (AB2588), the Toxics Emissions Near Schools Program (AB3205) and the Disposal Site Air Monitoring Program (AB3374). Additionally, mobile sources can also contribute to toxic air pollution. The Multiple Air Toxics Exposure Study (MATES-II) is a comprehensive monitoring study of TACs that was initiated as part of AQMD’s environmental justice program. This study revealed that diesel exhaust is responsible for approximately 70 percent of the total cancer risk from air pollution. While diesel is considered a toxic air pollutant, and as such is called a “non-criteria” air contaminant because ambient air quality standards have not been established, diesel pollution may be addressed under measures that seek to control PM2.5 because diesel pollution manifests as ultrafine particulate matter. Regulatory Framework The Program EIR includes a summary of the Federal Clean Air Act, the California Clean Air Act, and the 2003 and 2007 SCAQMD Air Quality Management Plan (AQMP), all of which are applicable to the current project. The SCAQMD AQMP was updated in 2012. The 2012 AQMP was adopted by the SCAQMD board on December 7, 2012. The 2012 AQMP incorporated the latest scientific and technological information and planning assumptions, including the 2012 Regional Transportation Plan/Sustainable Communities Strategy and updated emission inventory methodologies for various source categories. The 2012 AQMP includes the new and changing federal requirements, implementation of new technology measures, and the continued development of economically sound, flexible compliance approaches. The SCAQMD is currently in the process of preparing the 2015 AQMP update. $LU4XDOLW\ 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW 9 The SCAQMD has published a handbook (CEQA Air Quality Handbook, November 1993) that provides local governments with guidance for analyzing and mitigating project-specific air quality impacts. This handbook provides standards, methodologies, and procedures for conducting air quality analyses in EIRs. In order to control air pollution in the Basin, SCAQMD adopts rules that establish permissible air pollutant emissions and governs a variety of businesses, processes, operations, and products to implement the AQMP and the various federal and state air quality requirements. SCAQMD does not adopt rules for mobile sources; those are established by ARB or the United States Environmental Protection Agency (EPA). Rules that will be applicable during construction of future development include Rule 403 (Fugitive Dust) and Rule 1113 (Architectural Coatings). Rule 403 prohibits emissions of fugitive dust from any grading activity, storage pile, or other disturbed surface area if it crosses the project property line or if emissions caused by vehicle movement cause substantial impairment of visibility (defined as exceeding 20 percent opacity in the air). Rule 403 requires the implementation of Best Available Control Measures (BACM) and includes additional provisions for projects disturbing more than five acres and those disturbing more than fifty acres. Rule 1113 establishes the thresholds for low-VOC coatings. Global Climate Change Global climate change (GCC) refers to the change in average meteorological conditions on the Earth with respect to temperature, wind patterns, precipitation and storms. Global temperatures are regulated by naturally occurring atmospheric gases such as water vapor, CO2 (carbon dioxide), N2O (nitrous oxide), CH4 (methane), hydrofluorocarbons, perfluorocarbons, and sulfur hexafluoride. These particular gases are important due to their residence time (duration they stay) in the atmosphere, which ranges from 10 years to more than 100 years. These gases allow solar radiation into the Earth’s atmosphere, but prevent heat from escaping, thus warming the Earth’s atmosphere. GCC can occur naturally as it has in the past with the previous ice ages. According to CARB, the climate change that is currently in effect differs from previous climate changes in both rate and magnitude (CARB, 2004, Technical Support document for Staff Proposal Regarding Reduction of Greenhouse Gas Emissions from Motor Vehicles). Gases that trap heat in the atmosphere are often referred to as greenhouse gases. Greenhouse gases are released into the atmosphere by both natural and anthropogenic (human) activity. Without the natural greenhouse gas effect, the Earth’s average temperature would be approximately 61° Fahrenheit (F) cooler than it is currently. The cumulative accumulation of these gases in the earth’s atmosphere is considered to be the cause for the observed increase in the earth’s temperature. Although California’s rate of growth of greenhouse gas emissions is slowing, the state is still a substantial contributor. In 2004, the state is estimated to have produced 492 million gross metric tons of carbon dioxide equivalent greenhouse gas emissions. Despite a population increase of 16 percent between 1990 and $LU4XDOLW\ 4.1-10 )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH 2004, California has significantly slowed the rate of growth of greenhouse gas emissions due to the implementation of energy efficiency programs as well as adoption of strict emission controls. Global climate change first became a matter of concern in the 1980s, and the United Nations in 1988 created the Intergovernmental Panel on Climate Change to assess the potential impacts of global warming and develop strategies that could be instituted by nations in order to reduce greenhouse gas emissions. In California, efforts to reduce California’s energy use began in the 1970s, although not in response to global climate change concerns. Title 24 Part 6, enacted in 1978, required buildings to meet energy efficiency standards. Vehicle emissions of greenhouse gases were targeted in 2002 with the passage of AB1493, which required CARB to develop regulations to limit greenhouse gas emissions by cars and light duty trucks. These measures went into effect in 2009, and it is estimated that vehicle emissions of greenhouse gases will be reduced by approximately 18 percent by 2020. (CARB 2004) Although the United States has pledged over $29 billion for research into global climate change, the USEPA does not currently regulate vehicle greenhouse gas emissions. However, the USEPA does have the authority to regulate vehicle greenhouse gas emissions under the Clean Air Act, as found in the Supreme Court ruling in Massachusetts v. USEPA (2007). In 2006, AB 32, the California Global Warming Solutions Act, was signed into law by Governor Schwarzenegger, giving CARB the primary responsibility in reducing statewide greenhouse gas emissions to 1990 levels by 2020. CARB is also required by January 1, 2008 to determine greenhouse gas emission levels for 1990 and to approve a statewide greenhouse gas emissions limit to be achieved by 2020 that is based on this limit. Specific, anticipated impacts to California have been identified in the 2009 California Climate Adaptation Strategy prepared by the California Natural Resources Agency (CNRA) through extensive modeling efforts.ii General climate changes in California indicate that: x California is likely to get hotter and drier as climate change occurs with a reduction in winter snow, particularly in the Sierra Nevadas x Some reduction in precipitation is likely by the middle of the century x Sea-levels will rise up to an estimated 55 inches x Extreme events such as heat waves, wildfires, droughts, and floods will increase x Ecological shifts of habitat and animals are already occurring and will continue to occur It should be noted that changes are based on the results of several models prepared under different climatic scenarios; therefore, discrepancies occur between the projections. The potential impacts of global climate change in California are detailed below. $LU4XDOLW\ 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW 11 Public Health and Welfare Concerns related to public health and climate change includes higher rates of mortality and morbidity, change in prevalence and spread of disease vectors, decreases in food quality and security, reduced water availability, and increased exposure to pesticides. These concerns are all generally related to increase in ambient outdoor air temperature, particularly in summer. Higher rates of mortality and morbidity could arise from more frequent heat waves at greater intensities. Health impacts associated with extreme heat events include heat stroke, heat exhaustion, and exacerbation of medical conditions such as cardiovascular and respiratory diseases, diabetes, nervous system disorders, emphysema, and epilepsy. Climate change would result in degradation of air quality promoting the formation of ground-level pollutants, particularly ozone. Degradation of air quality would increase the severity of health impacts from criteria and other air pollutants discussed in Section 4.3 (Air Quality). Temperature increases and increases in carbon dioxide are also expected to increase plant production of pollens, spores, and fungus. Pollens and spores could induce or aggravate allergic rhinitis, asthma, and obstructive pulmonary diseases. Precipitation projections suggest that California will become drier over the next century due to reduced precipitation and increased evaporation from higher temperatures. These conditions could result in increased occurrences of drought. Surface water reductions will increase the need to pump groundwater, reducing supplies and increasing the potential for land subsidence. Precipitation changes are also suspected to impact the Sierra snowpack (see Water Management herein). Earlier snow melts could coincide with the rainy season and could result in failure of the flood control devices in that region. Flooding can cause property damage and loss of life for those affected. Increased wildfires are also of concern as the State dries over time. Wildfires can also cause property damage, loss of life, and injuries to citizens and emergency response services. Sea-level rises would also threaten human health and welfare. Flood risks will be increased in coastal areas due to strengthened storm surges and greater tidal damage that could result in injury and loss of property and life. Gradual rising of the sea will permanently inundate many coastal areas in the state. Other concerns related to public health are changes in the range, incidence, and spread of infectious, water-borne, and food-borne diseases. Changes in humidity levels, distribution of surface water, and precipitation changes are all likely to shift or increase the preferred range of disease vectors (i.e. mosquitoes). This could expose more people and animals to potential for vector-borne disease. Biodiversity and Habitat Changes in temperature will change the livable ranges of plants and animals throughout the state and cause considerable stress on these species. Species will shift their range if appropriate habitat is available and accessible if they cannot $LU4XDOLW\ 4.1-12 )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH adapt to their new climate. If they do not adapt or shift, they face local extirpation or extinction. As the climate changes, community compositions and interactions will be interrupted and changed. These have substantial implications on the ecosystems in the state. Extreme events will lead to tremendous stress and displacement on affected species. This could make it easier for invasive species to enter new areas, due to their ability to more easily adapt. Precipitation changes would alter stream flow patterns and affect fish populations during their life cycle. Sea level rises could impact fragile wetland and other coastal habitat. Water Management Although disagreement among scientists on long-term precipitation patterns in the State has occurred, it is generally accepted by scientists that rising temperatures will impact California’s water supply due to changes in the Sierra Nevada snowpack. Currently, the State’s water infrastructure is designed to both gather and convey water from melting snow and to serve as a flood control device. Snowpack melts gradually through spring warming into early summer, releasing an average of approximately 15 million acre-feet of water. The State’s concern related to climate change is that due to rising temperatures, snowpack melt will begin earlier in the spring and will coincide with the rainy season. The combination of precipitation and snowmelt would overwhelm the current system, requiring tradeoffs between water storage and flood protection to be made. Reduction in reserves from the Sierra Nevada snowpack is troublesome for California and particularly for Southern California. Approximately 75-percent of California’s available water supply originates in the northern third of the state while 80 percent of demand occurs in the southern two-thirds. There is also concern that rising temperatures will result in decreasing volumes from the Colorado River basin. Colorado River water is important to Southern California because it supplies water directly to Metropolitan Water District of Southern California. Water from the Colorado River is also used to recharge groundwater basins in the Coachella Valley. Agriculture California is the most agriculturally productive state in the U.S. resulting in more than 37 billion dollars in revenue in 2008. California is the nation’s leading producer of nearly 80 crops and livestock commodities, supplying more than half of the nation’s fruit and vegetables and over 90 percent of the nation’s production of almonds, apricots, raisin grapes, olives, pistachios, and walnuts. Production of crops is not limited to the Central Valley but also occurs in Southern California. Strawberries and grapes are grown in San Bernardino and Riverside Counties. Orange County and San Diego County also contribute to strawberry production. Cherries are also grown in Los Angeles and Riverside County. Anticipated impacts to agricultural resources are mixed when compared to the potentially increased temperatures, reduced chill hours, and changes in precipitation associated with climate change. For example, wheat, cotton, maize, sunflower, and rice are anticipated to show declining yields as temperatures rise. Conversely, grapes and almonds would benefit from warming temperatures. Anticipated increases in the number and severity in heat waves would have a negative impact on livestock where heat stress would make livestock more vulnerable to disease, infection and $LU4XDOLW\ 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW 13 mortality. The projected drying trend and changes in precipitation are a threat to agricultural production in California. Reduced water reliability and changes in weather patterns would impact irrigated farmlands and reduce food security. Furthermore, a drying trend would increase wildfire risk. Overall, agriculture in California is anticipated to suffer due to climate change impacts. Forestry Increases in wildfires will substantially impact California’s forest resources that are prime targets for wildfires. This can increase public safety risks, property damage, emergency response costs, watershed quality, and habitat fragmentation. Climate change is also predicted to affect the behavior or plant species including seed production, seedling establishment, growth, and vigor due to rising temperatures. Precipitation changes will affect forests due to longer dry periods and moisture deficits and drought conditions that limit seedling and sapling growth. Prolonged drought also weakens trees, making them more susceptible to disease and pest invasion. Furthermore, as trees die due to disease and pest invasion (i.e. the Bark Beetle invasion of the San Bernardino Forest), wildfires can spread more rapidly. Transportation and Energy Infrastructure Higher temperatures will require increased cooling, raising energy production demand. Higher temperatures also decrease the efficiency of distributing electricity and could lead to more power outages during peak demand. Climate changes would impact the effectiveness of California’s transportation infrastructure as extreme weather events damage, destroy, and impair roadways and railways throughout the state causing governmental costs to increase as well as impacts to human life as accidents increase. Other infrastructure costs and potential impacts to life would increase due to the need to upgrade levees and other flood control devices throughout the state. Infrastructure improvement costs related to climate change adaptation are estimated in the tens of billions of dollars. The global warming potential (GWP) is a measure of how much a given mass of greenhouse gas is estimated to contribute to global warming. It is a relative scale which compares the gas being measured to carbon dioxide (whose GWP is by definition 1). GWP is based on a number of factors, including the heat-absorbing ability of each gas and the decay rate of each gas relative to that of carbon dioxide. The higher the GWP, the more impact the gas has on global warming. The GWP measures in this report are based on a 100-year time horizon. The principal greenhouse gases resulting from anthropogenic activity that enter and accumulate in the atmosphere are discussed below: x Carbon Dioxide (CO2): Carbon dioxide is created in the combustion of fossil fuels, forest clearing, and biomass burning. Human activity is more closely tied to carbon dioxide concentrations in the atmosphere than other greenhouse gases, and carbon dioxide is used as a reference to compare the impacts of other greenhouse gases. Concentrations of carbon dioxide in the atmosphere have typically increased at a rate of 0.5% per year and levels today are 30% higher than those prior to the industrial revolution. $LU4XDOLW\ 4.1-14 )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH x Methane (CH4): Methane is a hydrocarbon produced through production and distribution of natural gas and oil, coal production, incomplete fuel combustion, waste decomposition, and animal digestion. Methane concentrations in the atmosphere are over twice their pre-industrial levels, and increasing 0.6% each year, although this rate is thought to be slowing. The global warming potential of methane is 23.iii x Nitrous Oxide (N2O): Nitrous oxide is emitted during fossil fuel combustion, biomass burning, and certain agricultural and industrial activities. Compared to carbon dioxide, nitrous oxide is an especially dangerous greenhouse gas, with a global warming potential of 296. x Fluorinated Gases: Hydrofluorocarbons, perfluorocarbons, and sulfur hexafluoride are synthetic, powerful greenhouse gases that are emitted from a variety of industrial processes. Fluorinated gases are often used as substitutes for ozone-depleting substances (i.e., CFCs, HCFCs, and halons). These gases are typically emitted in smaller quantities, but because they are some of the most potent greenhouse gases, they are referred to as having a “High Global Warming Potential.” The global warming potential of these gases ranges from 140 to 23,900. Since adoption of the Program EIR, the Air Resources Board Scoping Plan, Executive Order S-3-05, the Sustainable Communities and Climate Protection Act, California Green Building Standards, and the Water Conservation Landscaping Act were adopted. In addition, the City of Vernon has established a goal to become a leader in environmentally responsible energy generation. Air Resources Board Scoping Plan The ARB Scoping Plan is the comprehensive plan to reach the GHG reduction targets stipulated in AB 32. The key elements of the plan are to expand and strengthen energy efficiency programs, achieve a statewide renewable energy mix of 33 percent, develop a cap-and-trade program with other partners in the Western Climate Initiative (includes seven states in the United States and four territories in Canada), establish transportation-related targets, and establish fees.iv ARB estimates that implementation of Scoping Plan measures will reduce GHG emissions in the state by 174 MMTC2E by 2020; therefore, implementation of the Scoping Plan will meet the 2020 reduction target. In a report prepared on September 23, 2010, ARB indicates that 40 percent of the reduction measures identified in the Scoping Plan have been secured.v ARB held the hearing for the cap-and-trade program rulemaking on December 16, 2010. The cap-and-trade program began January 1, 2012 after ARB completed a series of activities that deal with the registration process, compliance cycle, and tracking system; however, covered entities will not have an emissions obligation until 2013.vi ARB is currently working on the low carbon fuel standard where public hearings and workshops are currently being conducted. In August 2011, the Scoping Plan was reapproved by the ARB Board with the program’s environmental documentation. $LU4XDOLW\ 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW 15 Executive Order S-3-05 Executive Order S-3-05 was issued by California Governor Arnold Schwarzenegger and established targets for the reduction of greenhouse gas emissions at the milestone years of 2010, 2020, and 2050. Statewide GHG emissions must be reduced to 1990 levels by year 2020 and by 80 percent beyond that by year 2050. The Order requires the Secretary of the California Environmental Protection Agency (CalEPA) to coordinate with other State departments to identify strategies and reduction programs to meet the identified targets. A Climate Action Team (CAT) was created and is headed by the Secretary of CalEPA who reports on the progress of the reduction strategies. The latest CAT Biennial Report to the Governor and Legislature was completed in December 2010.vii CAT also works in 11 subgroups to support development and implementation of the Scoping Plan (see California Global Warming Solutions Act herein). Table 4.1-5 Scoping Plan Measures Measure Description T-1 Pavely I and II – Light Duty Vehicle Greenhouse Gas Standards T-2 Low Carbon Fuel Standard T-3 Regional Transportation-Related Greenhouse Gas Targets T-4 Vehicle Efficiency Measures T-5 Ship Electrification at Ports T-6 Good Movement Efficiency Measures T-7 Heavy-Duty Vehicle Aerodynamic Efficiency T-8 Medium and Heavy-Duty Vehicle Hybridization T-9 High Speed Rail E-1 Energy Efficiency (Electricity Demand Reduction) E-2 Increase Combined Heat and Power Use E-3 Renewable Portfolio Standard E-4 Million Solar Roofs CR-1 Energy Efficiency (Natural Gas Demand Reduction) CR-2 Solar Water Heating GB-1 Green Buildings W-1 Water Use Efficiency W-2 Water Recycling W-3 Water System Energy Efficiency W-4 Reuse Urban Runoff W-5 Increase Renewable Energy Production W-6 Public Good Charge (Water) I-1 Energy Efficiency for Large Industrial Sources I-2 Oil and Gas Extraction GHG Reductions I-3 Oil and Gas Transmission Leak Reductions I-4 Refinery Flare Recovery Process Improvements I-5 Removal of Methane Exemption from Existing Refinery Regulations RW-1 Landfill Methane Control RW-2 Increase Landfill Methane Capture Efficiency RW-3 Recycling and Zero Waste $LU4XDOLW\ 4.1-16 )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH Measure Description F-1 Sustainable Forest Target H-1 Motor Vehicle Air Conditioning H-2 Non-Utilities and Non-Semiconductor SF6 Limits H-3 Semiconductor Manufacturing PFC Reductions H-4 Consumer Products High GWP Limits H-5 High GWP Mobile Source Reductions H-6 High GWP Stationary Source Reductions H-7 High GWP Mitigation Fees A-1 Large Dairy Methane Capture Sustainable Communities and Climate Protection Act In January 2009, California Senate Bill (SB) 375 went into effect known as the Sustainable Communities and Climate Protection Act.viii The objective of SB 375 is to better integrate regional planning of transportation, land use, and housing to reduce sprawl and ultimately reduce greenhouse gas emissions and other air pollutants. SB 375 tasks ARB to set greenhouse gas reduction targets for each of the California’s 18 regional Metropolitan Planning Organizations (MPOs). Each MPO is required to prepare a Sustainable Communities Strategy (SCS) as part of their Regional Transportation Plan (RTP). The SCS is a growth strategy in combination with transportation policies that will show how the MPO will meet its GHG reduction target. If the SCS cannot meet the reduction goal, an Alternative Planning Strategy (APS) may be adopted that meets the goal through alternative development, infrastructure, and transportation measures or policies. In the Southern California Association of Governments (SCAG) region (in which the project is located), sub-regions can also elect to prepare their own SCS or APS. In August 2010, ARB released the proposed GHG reduction targets for the MPOs to be adopted in September 2010. The proposed reduction targets for the SCAG region were 8-percent by year 2020 and 13-percent by year 2035. The 8-percent year 2020 target was adopted in September 2010 and tentatively adopted the 13- percent year 2035 target until February 2011 to provide additional time for SCAG, ARB, and other stakeholders to account for additional resources (such as state transportation funds) needed to achieve the proposed targets. In February 2011, the SCAG President affirmed the year 2035 reduction target and SCAG staff updated ARB on additional funding opportunities. The status of funding was requested to be revisited again in year 2014. California Green Building Standards New California Green Building Standards Code (CALGREEN) went into effect on January 1, 2011.ix The purpose of the new addition to the California Building Code (CBC) is to improve public health, safety, and general welfare by enhancing the design and construction of buildings using concepts to reduce negative impacts or produce positive impacts on the environment. The CALGREEN regulations cover planning and design, energy efficient, water efficiency and conservation, material conservation and resources efficiency, and environmental quality. Many of the new regulations have the effect of reducing greenhouse gas emissions from the $LU4XDOLW\ 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW 17 operation of new buildings. Table 4.1-6 (CALGREEN Requirements) summarizes the previous requires of the CBC and the new requirements of CALGREEN that went into effect in January 2011. Minor technical revisions and additional requirements went into effect in July 2012. Table 4.1-6 CALGREEN Requirements Item Requirements Previous CALGREEN 4.1 Stormwater Management Stormwater management required on projects > than one acre All projects subject to stormwater management. Surface Drainage Surface water must flow away from building Drainage patterns must be analyzed 4.2 Energy Efficiency California Energy Code Minimum energy efficiency to be established by California Energy Commissions 4.3 Indoor Water Use HCD maximum flush rates; CEC water use standards for appliances and fixtures Indoor water use must decrease by at least 20 percent (prescriptive or performance based) Multiple Showerheads Not covered Multiple showerheads can not exceed combined flow of the code Irrigation Controllers Not covered Irrigation controllers must be weather or soil moisture based controllers 4.4 Joint Protection Plumbing and Mechanical Codes All openings must be sealed with materials that rodents cannot penetrate Construction Waste Local Ordinances Establishes minimum 50 percent recycling and waste management plan Operation Plumbing Code for gray water systems Educational materials and manuals must be provided to building occupants and owners to ensure proper equipment operation 4.5 Fireplaces Local Ordinances Gas fireplaces must be direct-vent sealed- combustion type; Wood stoves and pellet stoves must meet USEPA Phase II emissions limits Mechanical Equipment Not covered All ventilation equipment must be sealed from contamination during construction VOCs Local Ordinances Establishes statewide limits on VOC emissions from adhesives, paints, sealants, and other coatings Capillary Break No prescriptive method of compliance Establishes minimum requirements for vapor barriers in slab on grade foundations Moisture Content Current mill moisture levels for wall and floor beams is 15-20 percent Moisture content must be verified prior to enclosure of wall or floor beams Whole House Fans Not covered Requires insulted louvers and closing mechanism when fan is off Bath Exhaust Fans Not covered Requires Energy Star compliance and humidistat control HVAC Design Minimal requirements for heat loss, heat gain, and duct systems Entire system must be designed in respects to the local climate 7 Installer Qualifications HVAC installers need not be trained HVAC installers must be trained or certified Inspectors Training only required for structural materials All inspectors must be trained Source: HCD 2010 $LU4XDOLW\ 4.1-18 )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH Water Conservation in Landscaping Act Section 65591 of the Government Code requires all local jurisdictions to adopt a water efficient landscape ordinance. The ordinance is to address water conservation through appropriate use and grouping of plants based on environmental conditions, water budgeting to maximize irrigation efficiency, storm water retention, and automatic irrigation systems. Failure to adopt a water efficiency ordinance requires a local jurisdiction to enforce the provisions of the State’s model water efficiency ordinance. In 2009, the Department of Water Resources (DWR) updated the Model Water Efficient Landscape Ordinance pursuant to amendments to the 1991 Act. These amendments and the new model ordinance went into effect on January 1, 2010. The amended Act is applicable to any new commercial, multi-family, industrial or tract home project containing 2,500 square feet (SF) or more of landscaping. Individual landscape projects of 5,000 SF or more on single-family properties will also be subject to the Act. All landscape plans are required to include calculations verifying conformance with the maximum applied water allowance and must be prepared and stamped by a licensed landscape architect. Green Vernon Vernon is committed to green energy and development. Listed below are ways the city is planning to achieve its goal of becoming a leader in environmentally responsible energy generation and environmentally sustainable city management.x x Vernon purchased 30,000 acres of property in Kern County for the development of wind and solar-generated electricity. The initial proposed wind energy project is expected to generate 175 megawatts of renewable energy. x A climate action plan will be prepared to guide the City on how to take advantage of opportunities to reduce emissions of gases linked to climate change. x The city has commissioned a study to create a Green Industrial Development Plan to establish a series of programs to enhance environmental sustainability and support economic vitality while protecting the health of its residents and workers and the residents in surrounding communities. Threshold for Determining Significance Air Quality For the purpose of this EIR, a significant impact will occur if implementation of the updated General Plan and revised Zoning Ordinance will: A. Conflict with or obstruct implementation of the applicable air quality plan; $LU4XDOLW\ 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW 19 B. Violate any air quality standard or contribute substantially to an existing or projected air quality violation; C. Result in a cumulatively considerable net increase of any criteria pollutant for which the program region is non-attainment under an applicable federal or state ambient air quality standard (including releasing emissions which exceed quantitative thresholds for ozone precursors); D. Expose sensitive receptors to substantial pollutant concentrations; or E. Create objectionable odors affecting a substantial number of people. Projects that exceed these thresholds are considered to have a significant adverse impact on air quality. The certified Program EIR determined that the General Plan Update would not conflict with or obstruct implementation of the applicable air quality plan and would not result in the creation of objectionable odors which would affect a substantial number of people. This determination is still applicable, and will not be analyzed further in this Supplemental EIR. To determine if maximum daily criteria pollutant emissions from construction and operation of the proposed project are significant, the SCAQMD significance thresholds are used. These thresholds are identified in Table 4.1-7 (SCAQMD Maximum Daily Emissions Thresholds (lbs/day)). Table 4.1-7 SCAQMD Maximum Daily Emissions Thresholds (lbs/day) Pollutant Construction Operation NOX 100 55 VOC/ROG 75 55 PM10 150 150 PM2.5 55 55 SOX 150 150 CO 550 550 Lead 3 3 Source: SCAQMD 2012 SCAQMD has also established thresholds for emissions of toxic air contaminants. Toxic air emissions from a project are considered potentially significant if maximum incremental cancer risk is greater than 10 persons in 1,000,000 (1E-05). Cancer risk is determined by calculating the annual average toxic concentration (μg/m3) and multiplying it by the unit risk factor (URF) for the toxic and the lifetime exposure adjustment (LEA) of the receptor. URF represents the estimated probability that a person will contract cancer as a result of inhalation of a toxic of 1 μg/m3 continuously over 70 years. Because some receptors are exposed to toxics for less than 70 years (i.e. off-site workers), the LEA adjusts the receptors $LU4XDOLW\ 4.1-20 )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH exposure to represent actual exposure time. The LEA for residential uses and other sensitive receptors is 1, representing an assumed exposure of 70 continuous years. Acute and chronic non-cancer risks are considered significant if the project toxic air contaminant emissions result in a hazard index greater than or equal to 1. The hazard index is determined by calculating the average annual toxic concentration (μg/m3) divided by the reference exposure level (REL) for a particular toxic. The REL is the concentration at which no adverse health impacts are anticipated and is established by OEHHA. Greenhouse Gas Emissions The proposed project could result in potentially significant impacts related to greenhouse gas emissions and global climate change if it would: A. Generate greenhouse gas emissions, either directly or indirectly, that may have a significant impact on the environment. B. Conflict with an applicable plan, policy, or regulation adopted for the purposes of reducing the emissions of greenhouse gases. As a policy document, the proposed General Plan update and revised Zoning Ordinance will not directly result in construction or operation of any development that contributes to climate change and associated impacts. However, implementation of the General Plan will guide future development that will generate greenhouse gases and will contribute to climate change. Future development projects will be required to determine if individually they exceed recognized or adopted thresholds that comply with adopted greenhouse gas reduction plans. A numerical threshold for determining the significance of greenhouse gas emissions in the South Coast Air Basin (Basin) has not been established by the South Coast Air Quality Management District (SCAQMD). As an interim threshold based on guidance provided in the California Air Pollution Control Officers Association (CAPCOA) CEQA and Climate Change handbook, the City has opted to use a non- zero threshold approach based on Approach 2 of the handbook. Threshold 2.5 (Unit-Based Thresholds Based on Market Capture) establishes a numerical threshold based on capture of approximately 90 percent of emissions from future development. The latest threshold developed by SCAQMD using this method is 10,000 metric tons carbon dioxide equivalent (MTCO2E) per year for industrial projects, 3,500 MTCO2E for residential projects, 1,400 MTCO2E for commercial projects, and 3,000 MTCO2E for mixed use projects. This threshold is based on the review of 711 CEQA projects. These thresholds will be utilized for implementing development in the future in determining if emissions of greenhouse gases will be significant, until an officially adopted threshold is established and accepted by the City. $LU4XDOLW\ 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW 21 Environmental Impact Impacts 4.1.A through 4.1.C Criteria Pollutants With the exception of a limited number of vacant lots, Vernon is completely built out. New development will result from rebuilding activity and the replacement of older, less efficient buildings with more functional ones. The updated General Plan and revised Zoning Ordinance provide for Vernon to remain a primarily industrial city with limited housing. All new businesses established in the City over the lifetime of the General Plan update are anticipated to be similar to those which exist today. The proposed expanded Commercial Overlay District along Santa Fe Avenue, Pacific Boulevard, Atlantic Boulevard, and Slauson Avenue, and portions of Soto Street will allow for limited commercial uses. The proposed project will also establish and apply a new Truck and Freight Terminal Overlay. However, as indicated in the certified General Plan EIR, long-term implementation of the updated General Plan and revised Zoning Ordinance is anticipated to result in a decrease in overall building square footage citywide, by approximately 1.2 million square feet, as older buildings are replaced by structures that meet current City standards for off-street parking and loading and other development standards. Air quality impacts for General Plan build out year 2030 were analyzed in the certified Program EIR using CARB’s land use and air pollution emissions model (URBEMIS 2007). Compared to 2007 (baseline) conditions, the previous General Plan and Zoning Ordinance update resulted in a reduction of all pollutant and greenhouse gas emissions. Since adoption of the certified Program EIR in 2007, the City of Vernon has adopted a Housing Element that identifies opportunities for housing in the City. Existing 2012 land use conditions will serve as the baseline, and year 2035 build out conditions based on the updated General Plan Land Use Plan, which includes the adopted Housing Element, will serve as the proposed project conditions. The analysis utilizes guidance provided in the South Coast Air Quality Management District (SCAQMD) 1993 California Environmental Quality Act (CEQA) Air Quality handbook as amended and supplemented. The California Emissions Estimator Model (CalEEMod) v 2013.2.2 was used to forecast emissions levels for baseline and project operational activity. Underlying land use designations for the City is Industrial. The implementation of zoning overlays will not affect this underlying land use designation. Therefore, CalEEMod was used to model air quality and greenhouse gas emissions for general light industrial use for the entire city minus rail and utility right-of-ways, streets, and vacant parcels during baseline conditions. Project build out conditions includes vacant parcels as future development is likely to occur. Emissions Sources The zoning overlay areas are intended to allow for more flexible, non-industrial land uses. As the built-out city redevelops, older industrial uses within each Overlay may be replaced by other uses. Default CalEEMod trip and emissions rates for uses $LU4XDOLW\ 4.1-22 )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH anticipated within each Overlay Zone are discussed below. The General Light Industry land use category is estimated to generate approximately 6.97 daily trips per 1,000 square feet and use 4.9 kWhr/square foot/year of Title-24 electricity energy intensity, 3.23 kWhr/square foot/year of nontitle 24 Electricity energy intensity, 7.04 kWhr/square foot/year lighting energy intensity, 1.21 KBTU/square foot/year Title-24 Gas Energy Intensity, and 0.49 KBTU/square foot/year of nontitle-24 Natural Gas Energy Intensity. Consumer products include cleaning supplies and aerosol products that emit volatile organic compounds (VOC). Use of consumer products is common in all settings. Commercial Overlay Zones The C-1 Overlay Zone identifies areas for the development of mercantile facilities including commercial, service, and business operations that are necessary to support industrial uses and serve existing on-site businesses and surrounding uses by improving access to a greater range of facilities and services. The C-2 Overlay Zone identifies areas for uses that may ordinarily conflict with the industrial character of the City. Commercial retail facilities within the C-2 Overlay Zone can provide for higher levels of intensity than those permitted in the C-1 Overlay Zone. Potential commercial land uses fall under CalEEMod’s retail strip mall designation. Compared to the CalEEMod General Light Industry land use designation, retail strip malls have a higher trip rate of 44.32 daily trips per 1,000 square feet. Although the trip rate is higher, general light industrial uses will have a higher rate of heavy- duty and medium-duty trips. Retail strip malls also have a higher electricity and natural gas usage rate per square foot. According to CalEEMod, each square foot of retail strip mall space is estimated to use 4.9 KWhr/year of Title-24 electricity energy intensity, 3.23 KWhr/year of nontitle-24 electricity energy intensity, 7.04 KWhr/year of lighting energy intensity, 1.21 KBTU/year Title-24 natural gas energy intensity, and 0.49 KWhr/year nontitle-24 natural gas energy intensity. Housing Overlay Zone The Housing Overlay Zone will allow for limited residential development in Vernon. It is assumed that housing will be multi-family. The CalEEMod default trip rate for mid-rise apartments is 6.59 daily trips per dwelling unit, less than per 1,000 square foot of light industrial. Each dwelling unit is also estimated to use approximately 267.12 KWhr/year of Title-24 electricity energy intensity, 2,553.86 KWhr/year of nontitle-24 electricity energy intensity, 741.44 KWhr/year of lighting energy intensity, 5,523.82 KBTU/year of Title-24 natural gas energy intensity, and 1,662 KWhr/year of nontitle-24 natural gas energy intensity. The size of each dwelling unit varies and is not comparable to an industrial use due to the difference in equipment, appliances used. Emergency Shelter Overlay Zone The Emergency Shelter Overlay Zone is intended to allow the development of a shelter to the homeless. It is anticipated that the only vehicle trips to the facility will be limited to the on-site manager, employees, and volunteers. Energy consumption will be similar to that of multi-family residential units and is not comparable to industrial use. $LU4XDOLW\ 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW 23 Rendering and Slaughtering Overlay Zones The Rendering and Slaughtering Overlay Zones are intended to support the processing of animal products into useful, value-added materials. The rendering and slaughtering use falls under the CalEEMod manufacturing land use category and will generate approximately 3.82 daily trips per 1,000 square feet, less than that of light industrial use. Each square foot of manufacturing use is estimated to use the same amount of electricity and natural gas as general light industry. Truck and Freight Terminal Overlay Zone Truck and freight uses fall under the CalEEMod unrefrigerated warehouse (no rail) category. Warehouse land uses are anticipated to generate approximately 2.59 daily trips per 1,000 square feet, less than light industrial use. Each square foot of warehouse use is estimated to use less electricity and natural gas as light industrial use, using 0.79 KWhr/year of Title-24 electricity energy intensity, 1.34 KWhr/year of nontitle-24 electricity energy intensity, 2.23 KWhr/year of lighting energy intensity, 0.88 KBTU/year of Title-24 natural gas energy intensity, and 0.03 KBTU/year of nontitle-24 natural gas energy intensity. The underlying land use designations of the city remain industrial. The Overlay Zones merely provide opportunities for more flexible uses as the city evolves, and does not change the underlying land use. No specific uses are being authorized at this time. The type and scale of each proposed development project will have an effect on air quality impacts and will be determined on a project by project basis. AQMP Consistency and Pollutant Emissions A significant impact could occur if the proposed project conflicts with or obstructs the implementation of the current SCAQMD AQMP. Conflicts and obstructions that hinder implementation of the AQMP can delay efforts to meet attainment deadlines for criteria pollutants and maintaining existing compliance with applicable air quality standards. As a policy document, no development is authorized or will directly occur from the adoption of the General Plan update. However, development will occur within the planning area as guided by the policies of the General Plan. Short-term criteria pollutant emissions will occur during site preparation, grading, building construction, paving, and painting/coating activities. Emissions will occur from use of construction equipment, worker, vendor, and hauling trips, and disturbance of on-site soils (fugitive dust). Long-term criteria air pollutant emissions will result from the operation of potential development. Long-term emissions are categorized as area source emissions, energy demand emissions, and operational emissions. Operational emissions will result from automobile, truck, and other vehicle sources associated with daily trips to and from future development. As indicated in the Initial Study for the certified General Plan EIR, the General Plan Resources Element includes the following policies that ensure compliance with the AQMP. The Resources Element ensures that land use decisions implement and comply with federal, state, and local regulations pertaining to air quality. The $LU4XDOLW\ 4.1-24 )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH policies of the Resources Element remain applicable and continued implementation would provide for continued compliance with SCAQMD regulations. The underlying land use designations of the city remain industrial, as was analyzed in the previous General Plan EIR. The proposed Overlay Zones merely provide opportunities for more flexible uses as the city evolves, and does not change the underlying land use or intent of the General Plan to support primarily industrial uses in the city. Therefore, compliance with SCAQMD regulations is consistent with the findings of the certified General Plan EIR and no additional impacts will result. GOAL R-2 Contribute to the continued gradual improvement of air quality in the South Coast Air Basin. POLICY R-2.1: Coordinate and cooperate with the South Coast Air Quality Management District and Southern California Association of Governments in efforts to implement the regional Air Quality Management Plan. POLICY R-2.2: Encourage and facilitate the use of public transportation to reduce emissions associated with automobile use. POLICY R-2.3: Continue to expand the number of City-owned alternative fuels vehicles, hybrid vehicles, and other energy-efficient vehicles as they may be available. POLICY R-2.4: Encourage the use of clean, efficient, state-of-the-art natural gas power plants. Using CalEEMod, long-term emissions from the planning area were modeled. Table 4.1-8 (Existing 2012 Total Daily Emissions (lbs/day)) summarizes the current operational daily emissions based on all general light industrial use in the city excluding approximately vacant parcels. Table 4.1-9 (2035 General Plan Buildout Total Daily Emissions (lbs/day)) summarizes the total operational daily emissions for General Plan Buildout year 2035 reflecting complete industrial use include the currently vacant parcels. These represent a worst-case scenario based on complete industrial buildout based on General Plan land use policy. Table 4.1-10 (Net Daily Emissions (lbs/day)) summarizes the change in daily emissions from the existing 2012 baseline year to buildout year 2035. $LU4XDOLW\ 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW 25 Table 4.1-8 Existing 2012 Total Daily Emissions (lbs/day) Source ROG NOX CO SO2 PM10 PM2.5 6XPPHU Area 2,977.60 0.12 12.15 0.0009 0.04 0.04 Energy 63.26 575.07 483.06 3.45 43.71 43.71 Mobile 3,992.54 13,111.85 53,171.59 109.64 212.93 195.52 Summer Total 7,033.40 13,687.04 53,667.80 113.09 256.68 239.27 :LQWHU Area 2,977.60 0.12 12.15 0.00087 0.04 0.04 Energy 63.26 575.07 483.06 3.45 43.71 43.71 Mobile 4,116.64 13,828.83 51,193.08 104.07 213.95 196.46 Winter Total 7,157.50 14,404.03 51,688.29 107.52 257.70 240.21 Table 4.1-9 2035 General Plan Buildout Total Daily Emissions (lbs/day) Source ROG NOX CO SO2 PM10 PM2.5 6XPPHU Area 3,162.03 0.11 12.27 0.00092 0.04 0.04 Energy 67.18 610.73 513.01 3.66 46.42 46.42 Mobile 1,857.18 5,226.49 23,937.84 122.42 159.88 147.51 Summer Total 5,086.38 5,837.32 24,463.12 126.08 206.34 193.97 :LQWHU Area 3,162.03 0.11 12.27 0.00092 0.04 0.04 Energy 67.18 610.73 513.01 3.66 46.42 46.42 Mobile 1,897.96 5,470.36 23,399.86 116.32 160.25 147.86 Winter Total 5,127.16 6,081.19 23,925.14 119.99 206.71 194.32 $LU4XDOLW\ 4.1-26 )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH Table 4.1-10 Net Daily Emissions (lbs/day) Source ROG NOX CO SO2 PM10 PM2.5 6XPPHU Existing 7,033.40 13,687.04 53,667.80 113.09 256.68 239.27 Proposed 5,086.38 5,837.32 24,463.12 126.08 206.34 193.97 Net Emissions -1,947.02 -7,849.72 -29,204.68 +12.99 -50.34 -45.30 Percent Change -27.68 -57.35 -54.42 +11.49 -19.61 -18.93 :LQWHU Existing 7,157.50 14,404.03 51,688.29 107.52 257.70 240.21 Proposed 5,127.16 6,081.19 23,925.14 119.99 206.71 194.32 Net Emissions -2,030.34 -8,322.84 -27,763.15 +12.47 -50.99 -45.89 Percent Change -28.37 -57.78 -53.71 +11.60 -19.79 -19.10 Based on modeling data, total emissions from total General Plan buildout would on average reduce reactive organic gases (volatile organic compounds) (ROG/VOC) by 27.68 percent in the summer and 28.37 percent in the winter, oxides of nitrogen (NOX) by 57.35 percent in the summer and 57.78 percent in the winter, carbon monoxide (CO) by 54.42 percent in the summer and 53.71 percent in the winter, coarse particulate matter (PM10) by 19.61 percent in the summer and 19.79 percent in the winter, and fine particulate matter (PM2.5) daily by 18.93 percent in the summer and 19.10 percent in the winter. Sulfur Dioxide (SO2) is projected to increase by 11.49 percent in the summer and 11.60 percent in the winter; however these increases are nominal and will not exceed the emission threshold. The reduction in total emissions is consistent with the findings of the certified General Plan EIR and impacts will remain less than significant. Impact 4.1.D Expose sensitive receptors to substantial pollutant concentrations The proposed General Plan update and revised Zoning Ordinance would not authorize any specific construction; however, future development projects constructed pursuant to General Plan land use policies could potentially expose sensitive receptors to temporary, localized pollutant concentrations in excess of air quality standards, even if the broader region is in attainment. Examples include emissions of fugitive dust and vehicle and machinery exhaust during large-scale grading activities and roadway construction. Under limited circumstances, large- scale construction activities could result in emissions of fugitive dust, nitrogen oxides, and other criteria pollutants that could exceed SCAQMD daily thresholds of significance and thereby could result in a significant impact. Emissions of fugitive dust near sensitive receptors are a primary concern because, unlike gaseous pollutants that quickly rise and affect the upper atmosphere, particulate matter tends to remain close to the ground. $LU4XDOLW\ 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW 27 Future construction activities will be subject to routine control measures as required by SCAQMD (Rules 402, 403, 1108, and 1113). It should be noted that SCAQMD guidance indicates that analysis of localized criteria pollutant impacts is voluntary; therefore, future construction projects will be assessed for localized criteria pollutant impacts on a case-by-case basis under the purview of the City. Impacts related to local criteria pollutant emissions will not be significant with implementation of existing regulations and the General Plan policies. According to the Air Quality and Land Use Handbook, ARB recommends that sensitive land uses not be located within 500 feet of highways or major arterials having average annual daily traffic (AADT) that exceeds 100,000 vehicles. This is due to the concentration of pollutants that accumulate in this proximity to freeways and other major arterials. No non-freeway roadways within the planning area either currently or over the long term are projected to have an AADT that exceeds 100,000 vehicles. Interstate 10 and Interstate 215 currently and will likely continue to both have an AADT that exceeds 100,000. Based on ARB guidelines, a significant impact could occur if the General Plan would permit new residential or other sensitive uses within 500 feet of I-710, I-5, or US-101. Today, residential land uses do not exist within 500 feet of I-710, I-5, or US-101. Therefore; significant impacts to residents from heavy traffic roadway criteria pollutants would not occur. Toxic Air Contaminants Some industrial land uses have the potential to generate substantial toxic air contaminant (TAC) concentrations that could adversely affect sensitive receptors. Such emissions could be produced by a variety of interior processes and outdoor activities that generate emissions of TACs. TACs are air pollutants that may cause or contribute to an increase in deaths or serious illnesses or that may pose a present or potential hazard to human health. Unlike criteria pollutants, there are no levels of exposure to TACs that do not produce adverse health effects. The Tanner Bill requires implementation of risk reduction measures for toxic contaminant releases with cancer risks that are equal to or greater than 25 per million and the SCAQMD has established a TAC emissions cancer risk threshold of equal to or greater than ten per million. For example, common facilities within the District that have a cancer risk of approximately ten per million include forges, refineries, fuel distribution and storage facilities, and heavy plating facilities. Common facilities with a cancer risk of approximately 25 per million or more include aircraft manufacturing, large plating and machining facilities, and chemical manufacturing. The proposed General Plan and Zoning Ordinance update includes the expansion of commercial and trucking uses and the addition of housing and emergency shelter overlays. Future uses that may be developed within the designated commercial and trucking areas could result in emissions of a variety of toxic air contaminants. $LU4XDOLW\ 4.1-28 )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH ARB research has documented increased potential health risks for sensitive receptors as the distance to sources of hazardous emissions is reduced. Based on these findings, they have developed guidelines to assist local government agencies in siting new land uses that could be occupied by “sensitive individuals” at a safe distance from such sources. Sensitive individuals refer to those segments of the population most susceptible to poor air quality (i.e., children, the elderly, and those with pre-existing serious health problems affected by air quality). Land uses where sensitive individuals are most likely to spend time include schools and schoolyards, parks and playgrounds, daycare centers, nursing homes, hospitals and residential communities (also known as sensitive sites or sensitive land uses). Since existing and planned industrial land uses that exist make up a majority of the planning area, the City may be affected by any potential substantial industrial emission source that currently exists or may be developed in the future regardless of wind direction. Actual levels of risk can only be determined through site-specific analysis and specialized air pollutant modeling, based on an actual relationship between an industrial emission source and a specific residential site. Such assessments might determine that there are less than significant health risks, or that there could be some significant level of exposure to pollutants that need to be mitigated through siting, site design, or operational restrictions. With implementation of existing regulations that regulate and monitor toxic emitters, potential health impacts to sensitive receptors due to exposure to toxic air contaminants will be less than significant. Carbon Monoxide Hotspots A carbon monoxide (CO) hotspot is an area of localized CO pollution that is caused by severe vehicle congestion on major roadways, typically near intersections. CO hotspots have the potential to violate state and federal CO standards at intersections, even if the broader Basin is in attainment for federal and state levels. In general, the California Department of Transportation Project-Level Carbon Monoxide Protocol (CO Protocol) recommend analysis of CO hotspots when a project increases the number of vehicles operating in cold start mode by more than two percent, increases traffic volumes by more than five percent, or worsens average traffic speeds. In addition, CO hotspots are typically associated with intersections with lower ratings of Level of Services (LOS), such as LOS E or F, which indicate high congestion and high amounts of idling vehicles that have the potential to generate a CO hotspot. The following intersections operate at LOS E or F under current General Plan 2030 Conditions without improvements which was analyzed in the certified Program EIR: x Alameda Street at Vernon Avenue – West (LOS F in morning and evening peak hours) x Alameda Street at Vernon Avenue – East (LOS F in morning and evening peak hours) x Alameda Street at 55th Street – West (LOS F in morning and evening peak hours) x Alameda Street at 55th Street – East (LOS F in evening peak hour) $LU4XDOLW\ 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW 29 x Santa Fe Avenue at 25th/26th Street (LOS E in morning and LOS F in evening peak hours) x Santa Fe Avenue at 38th Street (LOS F in morning and evening peak hours) x Santa Fe Avenue at Vernon Avenue (LOS F in morning and evening peak hours) x Santa Fe Avenue at Vernon Avenue/Pacific Boulevard (LOS F in morning and evening peak hours) x Soto Street at 26th Street (LOS F in morning and evening peak hours) x Soto Street at Bandini Boulevard (LOS F in morning and evening peak hours) x Soto Street at Vernon Avenue (LOS E in morning and LOS F in evening peak hours) x Soto Street at Leonis Boulevard (LOS E in morning peak hour) x Soto Street at Fruitland Avenue (LOS E in evening peak hour) x Boyle Avenue at Slauson Avenue (LOS F in morning and evening peak hours) x Downey Road at Washington Boulevard (LOS E in morning and LOS F in evening peak hours) x Downey Road at Bandini Boulevard (LOS E in morning and LOS F in evening peak hour) x Downey Road at Slauson Avenue (LOS F in morning and evening peak hours) x Atlantic Boulevard at Bandini Boulevard (LOS F in morning and evening peak hours) x Atlantic Boulevard at District Boulevard (LOS E in morning and LOS F in evening peak hours) The following intersections are anticipated to operate at LOS E or F in either or both of the morning or evening peak hours with the proposed General Plan update and revised Zoning Ordinance without improvements. x Alameda Street at Vernon Avenue – West (LOS F in morning and evening peak hours) x Alameda Street at Vernon Avenue – East (LOS F in morning and evening peak hours) x Alameda Street at 55th Street – West (LOS F in morning and evening peak hours) x Alameda Street at 55th Street – East (LOS F in evening peak hour) x Santa Fe Avenue at 25th/26th Street (LOS E in morning and LOS F in evening peak hours) x Santa Fe Avenue at 38th Street (LOS F in morning and evening peak hours) x Santa Fe Avenue at Vernon Avenue (LOS F in morning and evening peak hours) x Santa Fe Avenue at Vernon Avenue/Pacific Boulevard (LOS F in morning and evening peak hours) x Soto Street at 26th Street (LOS F in morning and evening peak hours) x Soto Street at Bandini Boulevard (LOS F in morning and evening peak hours) x Soto Street at Vernon Avenue (LOS E in morning and LOS F in evening peak hours) x Soto Street at Leonis Boulevard (LOS E in morning peak hour) x Soto Street at Fruitland Avenue (LOS E in evening peak hour) $LU4XDOLW\ 4.1-30 )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH x Boyle Avenue at Slauson Avenue (LOS F in morning and evening peak hours) x Downey Road at Washington Boulevard (LOS E in morning and LOS F in evening peak hours) x Downey Road at Bandini Boulevard (LOS F in morning and evening peak hours) x Downey Road at Slauson Avenue (LOS F in morning and evening peak hours) x Atlantic Boulevard at Bandini Boulevard (LOS F in morning and evening peak hours) x Atlantic Boulevard at District Boulevard (LOS E in morning and LOS F in evening peak hours) All intersections determined to operate at LOS E or F in the certified Program EIR still operate at the same LOS except for one. Downey Road at Bandini Boulevard was projected to operate at LOS E in the morning peak hour in the certified Program EIR. With the proposed General Plan update and the revised Zoning Ordinance, Downey Road at Bandini Boulevard is projected to operate at LOS F in the morning peak hour. As discussed in the traffic analysis prepared by Kunzman Associates, the above intersections are not significantly impacted by the proposed General Plan update and revised Zoning Ordinance. Future development projects will be screened and analyzed pursuant to the CO Protocol to determine if a CO hotspot may occur at congested intersections. Mitigation may be required, if necessary, to alleviate traffic congestion and minimize the hotspot potential. Other mitigation could include operational restrictions on future development. Greenhouse Gases Greenhouse gas emissions were analyzed in the Program EIR and found to reduce with implementation of the 2030 General Plan. As noted in the air quality analysis above, the Program EIR analyzed a baseline year of 2007 and proposed General Plan build out year 2030. The analysis reflects the change in GHG emissions from existing 2012 baseline conditions and the proposed 2035 General Plan buildout. The analysis utilizes guidance provided in the South Coast Air Quality Management District (SCAQMD) 1993 California Environmental Quality Act (CEQA) Air Quality handbook as amended and supplemented. The California Emissions Estimator Model (CalEEMod) v 2013.2.2 was used to forecast emissions levels for baseline and project operational activity. CalEEMod default rates for general light industrial use were used to model air quality and greenhouse gas emissions with the exception of vehicle fleet mix. The recommended fleet mix (78.6 percent passenger cars, 8 percent light-duty trucks, 3.9 percent medium heavy-duty trucks, and 9.5 percent heavy heavy-duty trucks) in the Fontana Truck Trip Study was used.xi Development that occurs as a result of the implementation of the proposed General Plan and zoning ordinance update will include activities that emit greenhouse gas emissions over the short and long term. While one project could not be said to $LU4XDOLW\ 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW 31 cause global climate change, individual projects contribute cumulatively to greenhouse gas emissions that result in climate change. Individual projects will have prepared a greenhouse gas emissions inventory, to determine if individual projects exceed applicable screening or impact thresholds and would thus potentially contribute substantially to climate change and associated impacts. A summary of short- and long-term emissions and the analysis for each are included below. Short-Term Emissions Future development projects will result in short-term greenhouse gas emissions from construction. Greenhouse gas emissions will be released by equipment used for demolition, grading, paving, and other building construction activities. GHG emissions will also result from worker and vendor trips to and from project sites and from demolition and soil hauling trips. Construction activities are short-term and cease to emit greenhouse gases upon completion, unlike operational emissions that are continuous year after year until operation of the use ceases. Because of this difference, SCAQMD recommends in its draft threshold to amortize construction emissions over a 30-year operational lifetime. This normalizes construction emissions so that they can be grouped with operational emissions in order to generate a precise project GHG inventory. Typically, construction-related GHG emissions contribute unsubstantially (less than one percent) to a project’s annual greenhouse gas emissions inventory and mitigation is not effective in reducing a project’s overall contribution to climate change. Implementation of AB32 and SB375 through California Air Resources Board’s (ARB) Scoping Plan and SCAG’s RTP/SCS are designed to achieve the required reduction in greenhouse gas emissions. Analysis of the General Plan’s non-interference and support of these plans is presented below. With implementation of existing policies and regulations, short-term climate change impacts due to future construction activities will not be significant. Long-Term Emissions Future development projects will result in continuous GHG emissions from mobile, area, and operational sources. Mobile sources, including vehicle trips to and from development projects, will result primarily in emissions of CO2, with minor emissions of CH4 and N2O. The most significant GHG emission from natural gas usage will be methane. Electricity usage by future development and indirect usage of electricity for water and wastewater conveyance will result primarily in emissions of carbon dioxide. Disposal of solid waste will result in emissions of methane from the decomposition of waste at landfills coupled with CO2 emission from the handling and transport of solid waste. These sources combine to define the long- term greenhouse gas inventory for typical development projects. Table 4.1-11 (Existing 2012 Land Use Baseline Greenhouse Gas Emissions) summarizes current operational annual greenhouse gas emissions for an entirely light industrial city except the vacant parcels. Table 4.1-12 (2035 General Plan Buildout Total Greenhouse Gas Emissions) summarizes the anticipated total $LU4XDOLW\ 4.1-32 )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH operational annual GHG emissions based on light industrial buildout of the City including the vacant parcels. This represents a worst-case complete build-out pursuant to the General Plan based on the proposed land use plan. Table 4.1-13 (Net Greenhouse Gas Emissions) summarizes net annual greenhouse gas emissions. As shown in Table 4.1-13, total greenhouse gas emissions will decrease with implementation of the proposed project. Table 4.1-11 Existing 2012 Land Use Baseline Greenhouse Gas Emissions Source GHG Emissions (MT/YR) CO2 CH4 N2O TOTAL* Area 2.82 0.008 0.00 3.00 Energy 506,746.38 20.23 5.83 508,977.73 Mobile 1,217,929.89 55.37 0.00 1,219,092.58 Waste 28,649.99 1,693.17 0.00 64,206.49 Water 106,428.56 862.19 21.18 131,101.73 Total 1,859,757.65 2,630.96 27.01 1,923,381.54 Table 4.1-12 2035 General Plan Buildout Total Greenhouse Gas Emissions Source GHG Emissions (MT/YR) CO2 CH4 N2O TOTAL* Area 3.00 0.008 0.00 3.16 Energy 538,163.49 21.49 6.19 540,533.18 Mobile 1,049,535.68 27.08 0.00 1,050,104.35 Waste 30,426.31 1,798.14 0.00 68,187.32 Water 113,027.17 915.65 22.50 139,230.08 Total 1,731,155.64 2,762.36 28.69 1,798,058.09 Table 4.1-13 Net Greenhouse Gas Emissions Source GHG Emissions (MT/YR) CO2 CH4 N2O TOTAL* Existing 1,859,757.65 2,630.96 27.01 1,923,381.54 Proposed 1,731,155.64 2,762.36 28.69 1,798,058.09 Net Emissions -128,602.01 -131.40 -1.68 -125,323.45 California Air Resources Board Scoping Plan (AB32) CARB’s Scoping Plan identifies strategies to reduce California’s greenhouse gas emissions in support of AB32. Many of the strategies identified in the Scoping Plan are not applicable at the General Plan or project-level, such as long-term technological improvements to reduce emissions from vehicles. Some measures are applicable and supported by the project. Finally, while some measures are not $LU4XDOLW\ 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW 33 directly applicable, the project would not conflict with their implementation. Reduction measures are grouped into 18 action categories, as follows: 1. California Cap-and-Trade Program Linked to Western Climate Initiative Partner Jurisdictions. Implement a broad-based California cap-and-trade program to provide a firm limit on emissions. Link the California cap–and- trade program with other Western Climate Initiative Partner programs to create a regional market system to achieve greater environmental and economic benefits for California. Ensure California’s program meets all applicable AB 32 requirements for market-based mechanisms. These programs involve capping emissions from electricity generation, industrial facilities, and broad scoped fuels. The City of Vernon has 150 qualifying heavy industrial facilitiesthat are be subject to these state requirements, and the proposed General Plan and zoning ordinance Update would not interfere with their implementation. 2. California Light-Duty Vehicle Greenhouse Gas Standards. Implement adopted Pavley standards and planned second phase of the program. Align zero-emission vehicle, alternative and renewable fuel and vehicle technology programs with long-term climate change goals. This is not applicable as this is a statewide measure establishing vehicle emissions standards. 3. Energy Efficiency. Maximize energy efficiency building and appliance standards, and pursue additional efficiency efforts including new technologies, and new policy and implementation mechanisms. Pursue comparable investment in energy efficiency from all retail providers of electricity in California (including both investor-owned and publicly owned utilities). The General Plan promotes energy efficient building design, as well as implementation of existing building and other codes regulating minimum energy, and water efficiency consistent with 2011 CALGREEN requirements and would thus be consistent and not interfere with this program. 4. Renewables Portfolio Standards. Achieve 33 percent renewable energy mix statewide by 2020. This establishes the minimum statewide renewable energy mix and is not applicable at a City level or below for implementation. The proposed General Plan and zoning ordinance update would not interfere with the implementation of this program. 5. Low Carbon Fuel Standard. Develop and adopt the Low Carbon Fuel Standard. This is not applicable to a City as this establishes reduced carbon intensity of transportation fuels. 6. Regional Transportation-Related Greenhouse Gas Targets. Develop regional greenhouse gas emissions reduction targets for passenger vehicles. As is detailed following, the proposed General Plan and zoning ordinance update would potentially conflict with and would not support the implementation of SCAG’s RTP/SCS to achieve the required GHG reduction goals by 2020 and 2035 based on an inconsistency with growth projections. $LU4XDOLW\ 4.1-34 )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH The proposed General Plan and zoning ordinance update includes policies to reduce vehicle miles traveled by encouraging alternative modes of transportation. 7. Vehicle Efficiency Measures. Implement light-duty vehicle efficiency measures. This is not applicable to a City as this identifies measures such as minimum tire-fuel efficiency, lower friction oil, and reduction in air conditioning use. 8. Goods Movement. Implement adopted regulations for the use of shore power for ships at berth. Improve efficiency in goods movement activities. Identifies measures to improve goods movement efficiencies such as advanced combustion strategies, friction reduction, waste heat recovery, and electrification of accessories. While the proposed General Plan and zoning ordinance update may result in facilities such as distribution warehouses that are associated with goods movement, these measures are yet to be implemented and will be voluntary. The proposed General Plan and zoning ordinance update would not interfere with their eventual implementation. 9. Million Solar Roofs Program. Install 3,000 megawatts of solar-electric capacity under California’s existing solar programs. Sets goal for use of solar systems throughout the state. The proposed General Plan and zoning ordinance update would not interfere with but instead would directly support installation of alternative energy sources through its policies and programs. 10. Medium- and Heavy-Duty Vehicles. Adopt medium-duty (MD) and heavy- duty (HD) vehicle efficiencies. Aerodynamic efficiency measures for HD trucks pulling trailers 53-feet or longer that include improvements in trailer aerodynamics and use of rolling resistance tires were adopted in 2008 and went into effect in 2010. Future, yet to be determined improvements, includes hybridization of MD and HD trucks. The proposed General Plan and zoning ordinance update may result in development of industrial uses that utilize large MD and HD truck fleets. These potential future developments would be required to have their fleet equipment be consistent with the current applicable efficiency measures at the time of operation. The proposed General Plan and zoning ordinance update would not interfere with implementation of this program. 11. Industrial Emissions. Require assessment of large industrial sources to determine whether individual sources within a facility can cost-effectively reduce greenhouse gas emissions and provide other pollution reduction co- benefits. Reduce greenhouse gas emissions from fugitive emissions from oil and gas extraction and gas transmission. Adopt and implement regulations to control fugitive methane emissions and reduce flaring at refineries. These measures are applicable to large industrial facilities (> 500,000 MTCO2E/YR) and other intensive uses such as refineries. If a qualifying heavy industrial facility would be located in the City, it would be subject to these state $LU4XDOLW\ 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW 35 requirements; the proposed General Plan and zoning ordinance update would not interfere with their implementation. 12. High Speed Rail. Support implementation of a high speed rail system. The proposed General Plan and zoning ordinance update would not interfere with implementation of this program. 13. Green Building Strategy. Expand the use of green building practices to reduce the carbon footprint of California’s new and existing inventory of buildings. The General Plan promotes energy efficient building design as well as implementation of existing building and other codes regulating minimum energy, and water efficiency consistent with 2011 CALGREEN requirements and would thus be consistent and not interfere with this program. 14. High Global Warming Potential Gases. Adopt measures to reduce high global warming potential gases. The proposed General Plan and zoning ordinance update would not directly result in generation of high global warming potential gases, and would not interfere with implementation of any future changes in air conditioning, fire protection suppressant, and other emission requirements. 15. Recycling and Waste. Reduce methane emissions at landfills. Increase waste diversion, composting and other beneficial uses of organic materials, and mandate commercial recycling to move toward zero-waste. The proposed General Plan and zoning ordinance update is consistent since implementing development will be required to recycle a minimum of 50 percent from construction activities and warehouse operations per state requirements. 16. Sustainable Forests. Preserve forest sequestration and encourage the use of forest biomass for sustainable energy generation. The 2020 target for carbon sequestration is 5 million MTCO2E/YR. This is not applicable as the City does not contain any areas defined as forest. 17. Water. Continue efficiency programs and use cleaner energy sources to move and treat water. The proposed General Plan and zoning ordinance update is consistent since implementing development will include use of low-flow fixtures and water efficient landscaping per state requirements. 18. Agriculture. In the near-term, encourage investment in manure digesters and at the five-year Scoping Plan update determine if the program should be made mandatory by 2020. The proposed General Plan and zoning ordinance update does not contain any agricultural land use designations, and any policies related to agriculture land uses would not be applicable. As summarized above, the proposed General Plan and zoning ordinance update would not conflict with any of the other provisions of the Scoping Plan. The proposed General Plan and zoning ordinance update in fact supports four of the $LU4XDOLW\ 4.1-36 )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH action categories through energy efficiency, green building, and water conservation through these proposed and current policies: GOAL R-1 Conserve and protect the region’s water and energy resources. POLICY R-1.1: Encourage water conservation and the use of recycled water in new developments and by all industries. POLICY R-1.2: Support the use of energy-saving designs and equipment in all new development and reconstruction projects. Consistency with Applicable Plans, Policies, or Regulations The underlying land use designations of the city will remain industrial as analyzed in the certified General Plan EIR. The proposed Overlay Zones merely provide opportunities for more flexible uses as the city evolves, and does not change the underlying land use or intent of the General Plan. As the underlying land use designation remains industrial and has not changed, the proposed project will remain consistent with regional plans, including efforts to reduce regional and statewide greenhouse gas emissions considering current land use plans are considered during preparation of regional plans such as the RTP/SCS. In addition, as discussed above, total greenhouse gas emissions would decrease with implementation of the proposed project. Therefore, compliance with SCAQMD regulations is consistent with the findings of the certified General Plan EIR and no additional impacts will result. Mitigation Measures Impact will be less than significant at the programmatic level and no mitigation is required. References i Data are measured at SCAQMD monitoring station 087, Central Los Angeles, located at 1630 N. Main Street, Building 3, Los Angeles, California ii California Natural Resources Agency. 2009 California Climate Adaptation Strategy iii Global warming potential (GWP) is a measure of how much a given mass of greenhouse gas is estimated to contribute to global warming. It is a relative scale which compares the gas being measured to carbon dioxide (whose GWP is by definition 1). GWP is based on a number of factors, including the heat-absorbing ability of each gas and the decay rate of each gas relative to that of carbon dioxide. The higher the GWP, the more impact the gas has on global warming. The GWP measures in this report are based on a 100- year time horizon iv California Air Resources Board. Climate Change Scoping Plan. December 2008 v California Air Resources Board. AB 32 Climate Change, Scoping Plan Progress Report. September 2010 vi California Air Resources Board. Cap-and-Trade. http://www.arb.ca.gov/cc/capandtrade/capandtrade.htm [June 2013] $LU4XDOLW\ 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW 37 vii California Climate Action Team. Biennial Report. April 2010 viii Southern California Association of Governments. Senate Bill 3.75 Fact Sheet. http://www.scag.ca.gov/factsheets/pdf/2009/SCAG_SB375_Factsheet.pdf [June 2013] ix California Building Standards Commission. California Code of Regulations Title 24. California Green Building Standards Code. 2010 x City of Vernon. Green Vernon. http://cityofvernon.org/green-vernon. June 2013 xi Transportation Engineering and Planning, Inc. City of Fontana Truck Trip Generation Study. August 2003. 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW Hazards and Hazardous Materials 4.2 7KLVVHFWLRQRIWKH6XSSOHPHQWDO(,5H[DPLQHVSRWHQWLDOLPSDFWVDVVRFLDWHGZLWK WKHFRQWLQXHGSUHVHQFHRIKD]DUGRXVPDWHULDOVLQ9HUQRQDQGZKHWKHUDQ\H[LVWLQJ KD]DUGRXV PDWHULDOV VLWHVSR VH DQ\S RWHQWLDOO\ VLJQLILFDQW LPSDFWV WRIXWXU H GHYHORSPHQWSHUPLWWHGGXHWR FKDQJHVWRWKH*HQHUDO3OD QDQGWKH=RQLQJ&RG H DQGDVVRFLDWHGFKDQJHVWRWKHFHUWLILHG3URJUDP(,57KH,QLWLDO6WXG\$SSHQGL[$ LQGLFDWHG WKDW SRWHQWLDO LPSDFWV UHODWLYH WRD LUSRUWV HPHUJHQF\ UHVSRQVH DQG ZLOGILUHVDUHOHVVWKDQVLJQLILFDQW Environmental Setting $V DQ H[FOXVLYHO\LQ GXVWULDO FLW\ 9HUQRQ LVKRPH WR PDQ\ EXVLQHVVHV WKDWX VH PDQXIDFWXUHVWRUHUHF\FOHDQGWUDQVSRUWKD]DUGRXVPDWHULDOV$FFRUGLQJWRWKH /RV$QJHOHV&RXQW\)LUH'HSDUWPHQWWKHWHUP³KD]DUGRXVPDWHULDOV´LQFOXGHVDQ\ PDWHULDOODEHOHGDVWR[LFSRLVRQRXVFRUURVLYHIODPPDEOHFRPEXVWLEOHRUDVDQ LUULWDQWL Monitoring Hazardous Materials in Vernon 7KH FHUWLILHG 3URJUDP (,5VX PPDUL]HV 9HUQRQ (QYLURQPHQWDO +HDOWK 'HSDUWPHQW SURFHGXUHVDQGUHVSRQVLELOLWLHVUHODWHGWRKD]DUGRXVPDWHULDOV+HDOWK'HSDUWPHQW VWDIIGHWHUPLQHVZKHWKHUKD]DUGRXVPDWHULDOVDUHWREHVWRUHGRQVLWHDQGWDNHV WKH DSSURSULDWH PHDVXUHV LI DSSOLFDEOH 7KH'HSDUWPHQ W DOVRFRQG XFWV DQQXDO LQVSHFWLRQVWRHQVXUHWKDWEXVLQHVVHVDUHFRPSO\LQJZLWKWKHLUSHUPLWWHUPVDQG UHTXLUHV WKHVHEXVLQHVVH V WR SODFH YLVLEOH SODFDUGV LGHQWLI\LQJFDWHJRULH V RI PDWHULDOVVWRUHG (QYLURQPHQWDO+HDOWK'HSDUWPHQWDQG)LUH'HSDUWPHQW 7KH(QYLURQPHQWDO+HDOWK'HSDUWPHQWRSHUDWHVVHYHUDOSURJUDPVWRJXDUGDJDLQVW WKH SXEOLFKHDOWKULVNVDVVRFLDWHGZLWK WKHXVHPDQXIDFWXUHDQGVWRULQJRI KD]DUGRXVPDWHULDOVE\EXVLQHVVHVLQ9HUQRQDVLGHQWLILHGLQWKH3URJUD P(,5,Q DGGLWLRQ WKH9HUQRQ )LUH'HS DUWPHQW PDLQWDLQV IRXUVWDW LRQV LQWK H &LW\ZLW K HTXLSPHQWDQGVWDIILQJDVLGHQWLILHGLQWKH3URJUDP(,5 Regulatory Framework 5HJXODWRU\IUDPHZRUNZDVGLVFXVVHGLQWKH FHUWLILHG3URJUDP(,57KHIROORZL QJ LQFOXGHVDGGLWLRQDOEDFNJURXQGDQGUHJXODWRU\LQIRUPDWLRQUHOHYDQWWRWKH3ODQQLQJ $UHD Known Hazardous Wastes and Substances Sites 7KH6WDWHRI&DOLIRUQLD'HSDUWPHQWRI7R[LF6XEVWDQFHV&RQWURO'76&PDLQWDLQVD OLVW RI NQRZQ KD]DUGRXVZDVWHVDQGKD]D UGRXV VXEVWDQFHV VLWHVWKURX JKRXW WKH VWDWH 7KLVOLVWFR PPRQO\ UHIHUUHGWR DV WKH &RUWHVH /LVWGRFXPH QWV RQJRLQJ DFWLRQVWRUHPHGLDWHFRQWDPLQDWHGVLWHV$FFRUGLQJWRWKHYHUVLRQRIWKHOLVWSRVWHG RQ'76&¶VZHEVLWHZKHQWKHFHUWLILHG3URJUDP(,5ZDVSUHSDUHGLQWZRVLWHV LQ9HUQRQZHUHLGHQWLILHGDVNQRZQKD]DUGRXVZDVWHVDQGVXEVWDQFHVVLWHV$VRI +D]DUGVDQG+D]DUGRXV0DWHULDOV )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH 0D\ VL[ VLWHV LQ 9HUQRQ ZHUHLG HQWLILHG DV NQRZQ KD]DUGRXV ZDVWHV DQG VXEVWDQFHVVLWHVVXEMHFWWRUHPHGLDWLRQZLWKWKHIROORZLQJVWDWXVLL Table 4.2-5 Cortese List Sites Name Location Site Type Status $'' ( WK6WU +D]DUGRXV:DVWH 5&5$ 8QGHUJRLQJ&ORVXUH &DOLIRUQLD(QYLURQPHQWDO 6HUYLFHV %DQGLQL%OYG +D]DUGRXV:DVWH 5&5$ &ORVHG &KHP&OHDURI/RV $QJHOHV (6ODXVRQ $YHQXH +D]DUGRXV:DVWH 5&5$ &ORVHG '.(QYLURQPHQWDO ( WK6WUHHW +D]DUGRXV:DVWH 5&5$ 2SHUDWLQJ3HUPLW '&,QGXVWULDO6HUYLFHV ( WK6WUHHW +D]DUGRXV:DVWH 3URWHFWLYH)LOHU ([LGH7HFKQRORJLHV 6,QGLDQD6WUHHW +D]DUGRXV:DVWH 5&5$ ,QWHULP2SHUDWLQJ 3HUPLW &(5&/,6DQGWKH1DWLRQDO3ULRULWLHV/LVW 7KH (3$ DOVR PDLQWDLQV WKH &(5&/,6 &RPSUHKHQVLYH (QYLURQPHQWDO5HVSRQVH &RPSHQVDWLRQDQG/LDELOLW\,QIRUPDWLRQ6\VWHPOLVW7KLVOLVWFRQWDLQVVLWHVWKDWDUH HLWKHUSURSRVHGWREHRUDUHRQWKH1DWLRQDO3ULRULWLHV/LVW13/DVZHOODVVLWHVWKDW DUHLQWKHVFUHHQLQJDQGDVVHVVPHQWSKDVHIRUSRVVLEOHLQFOXVLRQRQWKH13/7K H 13/ LVDOLVWRIWKH ZRUVWKD]DUGRX V ZDVWHVLWHVWKDWKDYHEHHQLGHQWLILHGE \ 6XSHUIXQG6LWHVDUHRQO\SXWRQWKHOLVWDIWHUWKH \KDYHEHHQVFRUHGXVLQJWKH +D]DUG5DQNLQJ6\VWHP+56DQGKDYHEHHQVXEMHFWHGWRSXEOLFFRPPHQW$Q\ VLWHRQWKH13/LVHOLJLEOHIRUFOHDQXSXVLQJ6XSHUIXQG7UXVWPRQH\7KH+56XVHV DVWUXFWXUHGDQDO\VLVDSSURDFKWRVFRULQJVLWHV7KLVDSSURDFKDVVLJQVQXPHULFDO YDOXHVWRIDFWRUVWKDWUHODWHWRULVNEDVHGRQFRQGLWLRQVDWWKHVLWH7KHIDFWRUVDUH JURXSHGLQWRWKUHHFDWHJRULHV OLNHOLKRRGWKDWDVLWHKDVUHOHDVHGRUKDVWKHSRWHQWLDOWRUHOHDVHKD]DUGRXV VXEVWDQFHVLQWRWKHHQYLURQPHQW FKDUDFWHULVWLFVRIWKHZDVWHHJWR[LFLW\DQGZDVWHTXDQWLW\DQG SHRSOHRUVHQVLWLYHHQYLURQPHQWVWDUJHWVDIIHFWHGE\WKHUHOHDVH )RXUSDWKZD\VFDQEHVFRUHGXQGHUWKH+56 JURXQGZDWHUPLJUDWLRQGULQNLQJZDWHU VXUIDFHZDWHUPLJUDWLRQGULQNLQJZDWHUKXPDQIRRGFKDLQVHQVLWLYH HQYLURQPHQWV VRLOH[SRVXUHUHVLGHQWSRSXODWLRQQHDUE\SRSXODWLRQVHQVLWLYH HQYLURQPHQWVDQG DLUPLJUDWLRQSRSXODWLRQVHQVLWLYHHQYLURQPHQWV $IWHUVFRUHVDUH FDOFXODWHGIRURQHR UPRUHSDWKZD\VWKH\DUHFRPELQHGXVLQJD URRWPHDQVTXDUHHTXDWLRQWRGHWHUPLQHWKHRYHUDOOVLWHVFRUH/LVWLQJRQWKH13/ PDNHV DVLWHHO LJLEOH IRUIXQ GLQJ RIO RQJWHUP VLWHUH PHGLDWLRQ 7KH86 +D]DUGVDQG+D]DUGRXV0DWHULDOV 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW (QYLURQPHQWDO 3URWHFWLRQ $JHQF\ 86(3$ LVUH VSRQVLEOH IRULG HQWLI\LQJ DQG SXUVXLQJ UHPHGLDWLRQ RIKLJK O\ FRQWDPLQDWHG KD]DUGRXV ZDVWH VLWHV 8QGHU WKH DXWKRULW\ RI WKH &RPSUHKHQVLYH (QYLURQPHQWDO 5HVSRQVH &RPSHQVDWLRQ DQG /LDELOLW\ $FW RI &(5&/ $ DQGDOVRUH IHUUHG WRD V 6XSHUIXQG WKH86( 3$ LQYHVWLJDWHVDEDQGRQHGKD]DUGRXVZDVWHVLWHVSXUVXHVDSSURSULDWHFOHDQXSDQG FRPSHOVUHVSRQVLEOHSDUWLHVWRSHUIRUPFOHDQXSVRUUHLPEXUVHWKHJRYHUQPHQWIRU (3$OHGUHPHGLDWLRQ7KH3URJUDP(,5LGHQWLILHGILYHVLWHVWKDWZHUHFRQVLGHUHGIRU WKH86(3$¶V6XSHUIXQG1DWLRQDO3ULRULWLHV/LVWEXWQRWDGGHG$VRI-XQHVL[ VLWHVLQ9HUQRQZHUHUHIHUHQFHGRQWKH86(3$¶V6XSHUIXQG1DWLRQDO3ULRULWLHV/LVW 13/ZHEVLWHDUHDVIROORZVLLL Table 4.2-6 Listed CERCLA Sites Name NPL (National Priorities List) Status $''7UXFN6LWH 1RQ13/ $'')DFLOLW\6LWH 1RQ13/ 0RGHUQ3DWWHUQDQG)RXQGU\&R,QF 1RQ13/ 1,,QGXVWULHV 1RQ13/ 6WDXIIHU&KHPLFDO&RPSDQ\ 1RQ13/ *OREH8QLRQ,QFRUSRUDWHG 1RQ13/ 7KH1RQ13/VWDWXVLQGLFDWHVWKDWWKHVLWHVZHUHLQYHVWLJDWHGIRUSODFHPHQWRQWKH 1DWLRQDO3ULRULWLHV/LVWRIWKHPRVWKD]DUGRXVVLWHVLGHQWLILHGIRUORQJWHUPFOHDQXS EXWGLGQRWZDUUDQWVXFKOLVWLQJ 5&5$DQG+D]DUGRXV:DVWH*HQHUDWRUV 7KH 5HVRXUFHV &RQVHUYDWLRQ DQG 5HFRYHU\ $FW 5&5$ LVDIHGHUD OODZWKDW UHJXODWHV WKH JHQHUDWLRQPD QDJHPHQW DQGWUDQ VSRUWDWLRQ RIZDVWH PDWHULDO +D]DUGRXVZDVWHPDQDJHPHQWVSHFLILFDOO\LQFOXGLQJWKHIROORZLQJ 7UHDWPHQW$Q\SURFHVVWKDWFKDQJHVWKHSK\VLFDORUFKHPLFDOFRPSRVLWLRQRI WKHZDVWHWRPDNHLWOHVVKDUPIXOWRWKHHQYLURQPHQW 6WRUDJH7KHKROGLQJRIKD]DUGRXVZDVWHIRUDWHPSRUDU\SHULRGRIWLPH 'LVSRVDO7KHSHUPDQHQWILQDOORFDWLRQRIWKHKD]DUGRXVZDVWHLQWRRURQWKH ODQG 5&5$DSSURDFKHVKD]DUGRXVZDVWHVIURPDFUDGOHWRJUDYHDSSURDFKPHDQLQJWKDW DOOKD]DUGRXVZDVWHVDUHWUDFNHGDQGVWULFWO\UHJXODWHGIURPJHQHUDWLRQWRGLVSRVDO +D]DUGRXVZDVWHJHQHUDWRUVDUHUHTXLUHGWRUHSRUWXVH RUWUDQVSRUWRIKD]DUGRX V ZDVWHVWRWKH(3$ Thresholds for Determining Significance )RUWKHSXUSRVHRIWKLV(,5DVLJQLILFDQWLPSDFWZLOORFFXULI LPSOHPHQWDWLRQRIWKH XSGDWHG*HQHUDO3ODQDQGUHYLVHG=RQLQJ2UGLQDQFHZRXOG +D]DUGVDQG+D]DUGRXV0DWHULDOV )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH $ &UHDWH DVLJQLILFDQW KD]DUGWRWKHSXEOLFRUWKH HQYLURQPHQWWKURXJK WKH URXWLQHWUDQVSRUWDWLRQXVHRUGLVSRVDORIKD]DUGRXVPDWHULDOV % &UHDWH D VLJQLILFDQW KD]DUG WRWKH SXEOLF RUWK H HQYLURQPHQWWKURXJK UHDVRQDEO\IRUHVHHDEOHXSVHWDQGDFFLGHQWFRQGLWLRQVLQYROYLQJWKHUHOHDVHRI KD]DUGRXVPDWHULDOVLQWRWKHHQYLURQPHQW & (PLW KD]DUGRXVHPLVVLRQVRUKDQGOH KD]DUGRXV RUDFXWHO\KD]DUGRXV PDWHULDOVVXEVWDQFHVRUDFXWHO\KD]DUGRXVPDWHULDOVVXEVWDQFHVRUZDVWH ZLWKLQRQHTXDUWHUPLOHRIDQH[LVWLQJRUSURSRVHGVFKRRODQGRU ' %HORFDWHGRQDV LWHZKLFKLVLQFOXGHGRQDOLVWRIKD]DUGRXVPDWHULDOVVLWHV FRPSLOHG SXUVXDQW WR *RYHUQPHQW &RGH 6HFWLRQ DQG DVD UHVXOW ZRXOGFUHDWHDVLJQLILFDQWKD]DUGWRWKHSXEOLFRUWKHHQYLURQPHQW Environmental Impact Impacts 4.2.A and 4.2.B Use, Transport, and Disposal of Hazardous Materials and Wastes :LWKWKHH[FHSWLRQRIDOLPLWHGQXPEHURIYDFDQWORWV9HUQRQLVFRPSOHWHO\EXLOW RXW9LUWXDOO\DOOH[LVWLQJGHYHORSPHQWFRQVLVWVRILQGXVWULDOEXVLQHVVHV$FFRUGLQJ WR&LW\RI9HUQRQ(QYLURQPHQWDO+HDOWK'HSDUWPHQWVWDIILQDQ\RQH\HDUEHWZHHQ DQGSHUFHQWR IDOOEXVLQHVVHVLQ9HUQRQHLWK HUVWRUHXVHRUPDQXIDFWXUH KD]DUGRXV PDWHULDOV WRWKHH [WHQW WKDW D&LW\K D]DUGRXV PDWHULDOV SHUPLW LV UHTXLUHG 7KH XSGDWHG*HQHUD O 3ODQDQG UHYLVHG =RQLQJ2 UGLQDQFH SURYLGH IRU 9HUQRQWR UHPDLQ D SULPDULO\ LQGXVWULDO FLW\ ZLWK OLPLWHG KRXVLQJ $OOQHZ EXVLQHVVHV HVWDEOLVKHGLQWKH&LW\R YHUWKHOLIHWLPHRIWKH*HQHUDO3ODQX SGDWHDUHDQWLFLSDWHG WR EHVLP LODU WRWK RVH ZKLFK H[LVW WRGD\ 7KHSURSRVH G H[SDQGHG& RPPHUFLDO 2YHUOD\'LVWULFWDORQJ6DQWD)H$YHQXH3DFLILF%RXOHYDUG$WODQWLF%RXOHYDUGDQG 6ODXVRQ$YHQXHDQGSRUWLRQVRI6RWR6WUHHWZLOODOORZIRUOLPLWHGFRPPHUFLDOXVHV ,IWKHVHDUHDVEHJLQWRWUDQVLWLRQLQWRFRPPHUFLDODUHDVWKHXVHWUDQVSRUWDQG GLVSRVDOLQWKHDUHDZRXOGOLNHO\UHGXFHEHFDXVHFRPPHUFLDOXVHVJHQHUDOO\XVHIHZ DQGOHVVKD]DUGRXVPDWHULDOVWKDQLQGXVWULDOXVHVWKXVUHGXFLQJSRWHQWLDOLPSDFWV ZKHQ FRPSDUHG WR WKRVH DQDO\]HG LQWKHFHUWLILH G 3URJUDP (,5,Q JHQHUDO KRZHYHUWKHW\SHVDQGPL[RIXVHVZLOOUHPDLQUHODWLYHO\WKHVDPHLQWKH3ODQQLQJ $UHDDVWKRVHDQWLFLSDWHGXQGHUWKHFHUWLILHG3URJUDP(,57KHSURSR VHGSURMHFW ZLOODOVRHVWDEOLVKDQGDSSO\DQHZ7UXFNDQG)UHLJKW7HUPLQDO2YHUOD\7KH7UXFN DQG)UHLJKW7HUPLQDO2YHUOD\LVGHVLJQHGWRIRFXVWUXFNDQGIUHLJKWWHUPLQDOVLQWR DUHDV WR PLQLPL]H LPSDFWV RQ RWKHUXVHV7 \SLFDO IUHLJKW WHUPLQDOV GLVWULEXWH FRQVXPHU JRRGVDQGZRXOGQRWLQFUHDVHWKH DPRXQW RIKD]DUGRX V PDWHULDOV WUDQVSRUWHGEH\RQGWKRVHVXSSRUWHGE\WKHEURDGHU,QGXVWULDOODQGXVHGHVLJQDWLRQ RUWKH*HQHUDO,QGX VWULDO,]RQLQJGLVWULFWDQDO\]H GLQWKHFHUWLILHG3URJUDP(,5 7UXFNWHUPLQDOVDUHXWLOL]HGIRUWKHVWRUDJHPDLQWHQDQFHUHSDLUDQGRUVHUYLFLQJ RIKHDY\GXW\YHKLFOHVVXFKDVWUXFNVDQGEXVHV+ D]DUGRXVPDWHULDOVDVVRFLDWHG ZLWK WKHVH RSHUDWLRQV DUH FRPPRQ VXFK DV PRWRU RLO GLHVHO IXHODQGRWKHU +D]DUGVDQG+D]DUGRXV0DWHULDOV 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW DXWRPRWLYHFKHPLFDOVDQGZLOOQRWEHRXWVLGHWKHVFRSHRIWKHDQDO\VLVSURYLGHGLQ WKHFHUWLILHG3URJUDP(,5 3XUVXDQW WR &LW\UH JXODWLRQV DOOQHZ EXVLQHVVHV ZLOOEHVXEMHFWW R WKH &LW\¶V PDQGDWRU\RFFXSDQF\LQVSHFWLRQSURFHVVDVGHWDLOHGLQWKH FHUWLILHG3URJUDP(,5 WKDWLQFOXGHVGRFXPHQWDWLRQRIFXUUHQWRUSURSRVHGKD]DUGRXVPDWHULDOVVWRUDJH WKH UHTXLUHPHQW RI KD]DUGRXV PDWHULDOVSHUPLWV DV DSSOLFDEOH DQGLQVSHFWLRQE \ (QYLURQPHQWDO+HDOWK'HSDUWPHQWVWDIIWRHQVXUH FRPSOLDQFH7KHVH UHJXODWLRQV HQVXUHWKDWDOOXVHVDUHDVVHVVHGIRUWKH SRWHQWLDOULVNRIXSVHWUHODWHGWRWKHXVH WUDQVSRUWDQGGLVSRVDORIKD]DUGRXV PDWHULDOVDQGDUHDSSOLFDEOHWRWKHSURSRVHG *HQHUDO3ODQDQG=RQLQJ2UGLQDQFHXSGDWHVLQWKHVDPHPDQQHUDVZDVDSSOLFDEOH XQGHUWKHDQDO\VLVSURYLGHGLQWKHFHUWLILHG3URJUDP(,5 7KHIROORZLQJSROLFLHVDQGDFWLRQVDUHLQFOXGHGLQWK H*HQHUDO3ODQ6DIHW\(OHPHQW DQG,PSOHPHQWDWLRQ3URJUDPDQGOLVWHGLQWKHFHUWLILHG3URJUDP(,5DVUHGXFLQJ LPSDFWVUHODWHGWRKD]DUGRXVPDWHULDOV POLICY S-2.2: &RQWLQXH WR UHTXLUH HYHU\E XVLQHVV WR PDLQWDLQ RQVLWH D PDWHULDOVDIHW\GDWDVKHHWIRUHDFKFKHPLFDORURWKHUKD]DUGRXVPDWHULDOVWRUHGDW WKHEXVLQHVVDQGWRSURYLGHDOLVWRIWKHFKHPLFDOVRURWKHUKD]DUGRXVPDWHULDOV DQGWKHORFDWLRQVZKHUHWKH\DUHVWRUHGWRWKH(QYLURQPHQWDO+HDOWK'HSDUWPHQW IRULQFRUSRUDWLQJLQWR(QYLURQPHQWDO+HDOWKDQG)LUH'HSDUWPHQWUHFRUGV7KH)LUH 'HSDUWPHQWDQGWKH(QYLURQPHQWDO+HDOWK'HSDUWPHQWZLOOPDLQWDLQWKHOLVWVIRUDOO 9HUQRQEXVLQHVVHVLQVXFKDP DQQHUWKDWWKH\DUHUHDGLO\DYDLODEOHWR HPHUJHQF\ UHVSRQVHSHUVRQQHOWRUHYLHZGXULQJHPHUJHQFLHV Action S-7: Hazardous Materials Monitoring Program (Ordinance 961). &RQWLQXH WRLPSOHPHQWWKH+D]DUG RXV 0DWHULDOV 0RQLWRULQJ 3URJUDP WKDW PRQLWRUV HVWDEOLVKPHQWV ZKHUH KD]DUGRXV PDWHULDOVDUH SURGXFHGVWRUHGKDQGOHGGLVSRVHGR IWUHDWHGHPLWWHGGLVFKDUJHG RU UHF\FOHG 7KHS URJUDP DOVRG LUHFWV DQGFRRUGLQDWH V HPHUJHQF\ UHVSRQVHLQWKHHYHQWRIUHOHDVHVRIKD]DUGRXVPDWHULDOV $JHQF\'HSDUWPHQW (QYLURQPHQWDO+HDOWKDQG)LUH'HSDUWPHQW )XQGLQJ6RXUFH *HQHUDO)XQG3URJUDP)HHV 7LPH)UDPH 2QJRLQJ 5HODWHG3ROLFLHV 666 Action S-8: Hazardous Waste. &RQWLQXH WRLPS OHPHQW DFWLYLWLHV WRD VVXUH WKDW KD]DUGRXV ZDVWHV JHQHUDWHG E\ 9HUQRQ EXVLQHVVHV DUH KDQGOHG DQG GLVSRVHG DFFRUGLQJ WR IHGHUDO VWDWHDQ G ORFDO UHJXODWLRQV $VVLVW EXVLQHVVHV DQGFRQ VXOWDQWV LQ SUHSDUDWLRQ DQG RYHUVLJKW RI VLWH DVVHVVPHQWV DQG PLWLJDWLRQ DFWLYLWLHV ,Q RUGHU WR PLQLPL]H SUHVHQW DQGIXWXUHWKUHDWVWRKXPDQKHDOWKDQGWKHHQYLURQPHQWWKHSURJUDP DFWLYHO\ SURPRWHV ZDVWH UHGXFWLRQ RSWLRQV IRU KD]DUGRXV ZDVWH JHQHUDWRUV $JHQF\'HSDUWPHQW (QYLURQPHQWDO+HDOWK'HSDUWPHQW +D]DUGVDQG+D]DUGRXV0DWHULDOV )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH )XQGLQJ6RXUFH 3HUPLW)HHV 7LPH)UDPH 2QJRLQJ 5HODWHG3ROLFLHV 666 $GRSWLRQDQGORQJWHUPLPSOHPHQWDWLRQRIWKHXSGDWHG*HQHUDO3ODQDQGUHYLVHG =RQLQJ 2UGLQDQFH ZLOO QRWFKDQJHFXU UHQW ODQG XVHSUDFWL FHV RUUHJXODWRU\ UHTXLUHPHQWV DVDQ DO\]HG XQGHUWKHFH UWLILHG 3URJUDP (,5LQGXVWULDOEXVLQH VVHV WKDW PDLQWDLQ KD]DUGRXV PDWHULDOV RQ VLWH ZLOOFRQWLQXH WR UHSUHVHQW DKLJK SHUFHQWDJHRIWKHEXVLQHVVDFWLYLW\LQ9HUQRQDQGZLOOEHVXEMHFWWRORFDOVWDWHDQG IHGHUDOUHJXODWLRQV)XUWKHUPRUHWKH&LW\ZLOOFRQWLQXHWKHHVWDEOLVKHGSUDFWLFHRI LVVXLQJSHUPLWVIRUDQGPRQLWRULQJWKH XVHRIKD]DUGRXVPD WHULDOVSHU2UGLQDQFH 1R DVLGHQW LILHG LQWKH FHUWLILHG 3URJUDP (,57KH&LW\RI 9HUQRQ )LUH 'HSDUWPHQWZLOOPDLQWDLQLWVKD]DUGRXVPDWHULDOVUHVSRQVHXQLWDQGFDSDELOLWLHVWR SURYLGHDKLJKGHJUHHRIUHVSRQVHDQGSURWHFWLRQ7KXVWKHSURMHFWZLOOQRWFUHDWH D VLJQLILFDQW KD]DUG WRWKH SXEOLF RUWKHHQYLURQPHQWWKURXJKWKHURXWLQH WUDQVSRUWDWLRQXVHRUGLVSRVDORIKD]DUGRXVPDWHULDOVQRUZLOOWKHSURMHFWFUHDWHD VLJQLILFDQWKD]DUGWRWKHSXEOLFRUWKHHQYLURQPHQWWKURXJKUHDVRQDEO\IRUHVHHDEOH XSVHWDQGDFFLGHQWFRQGLWLRQVLQYROYLQJWKHUHOHDVHRIKD]DUGRXVPDWHULDOVLQWRWKH HQYLURQPHQWEH\RQGWKDWDQDO\]HG LQWKHFHUWLILHG3URJUDP(,57KLVLVE HFDXVH XVHWUDQVSRUWDQGGLVSRVDORIKD]DUGRXVPDWHULDOVZLOOQRWDSSUHFLDEO\LQFUHDVHDQG WKH VDPH PDQGDWRU\ UHTXLUHPHQWV QRWHG LQWKH FHUWLILHG 3URJUDP(,5 UHODWHG WR KD]DUGRXV PDWHULDOVUHPDLQD SSOLFDEOH )XUWKHUPRUH WKHFHUWLILHG 3URJUDP (,5 LQFOXGHG 0LWLJDWLRQ 0HDVXUHV +DQ G +WR HQVXUH WKH FRQWLQXHG UHYLHZ SHUPLWWLQJDQGEXGJHWLQJIRUEXVLQHVVLQYROYHPHQWZLWKKD]DUGRXVPDWHULDOVDQG ZDVWHV , PSDFWV ZLOO EH HTXDO WRR U OHVV WKDQ WKRVH GHWHUPLQHG LQ WKH FHUWLILHG 3URJUDP(,5UHPDLQLQJless than significant with mitigation incorporated DQG LPSOHPHQWDWLRQRIUHJXODWRU\UHTXLUHPHQWVDQGWKHSROLFLHVRIWKH*HQHUDO3ODQ Impact 4.2.C Hazardous Materials near Sensitive Receptors 6FKRROVKRVSLWDOVDQGUHVLGHQWLDODVVLVWHGFDUHIDFLOLWLHVFDQEHGLIILFXOWWRHYDFXDWH GXULQJDKD]DUGRXVPDWHULDOVHPHUJHQF\)XUWKHUPRUHWKH\RXQJHOGHUO\DQGVLFN DUH PRUH VXVFHSWLEOH WR KHDOWK FRQGLWLRQV UHODWHG WRH [SRVXUH WR KD]DUGRXV PDWHULDOV $VVXFK WKHVHXVHVFRX OG SRWHQWLDOO\ EHLPSDFWHGE\D KD]DUGRXV PDWHULDOVUHOHDVH$VLQJOHVFKRROH[LVWVLQ9HUQRQ9HUQRQ&LW\(OHPHQWDU\6FKRRO /RV$QJHOHV8QLILHG6FKRRO'LVWULFWORFDWHGDW(9HUQRQ$YHQXH7KLVSXEOLF VFKRROSURYLGHVHOHPHQWDU\HGXFDWLRQIRUVWXGHQWVLQJUDGHVNLQGHUJDUWHQWKURXJK DQGRSHUDWHVRQDWUDGLWLRQDO 6HSWHPEHUWKURXJK-XQHVFKRR O\HDU9HUQRQ&LW\ (OHPHQWDU\LVRQHRIWKHROGHVWVFKRROVLQWKH GLVWULFWKDYLQJRSHQHGLWVGRRUVLQ \HDUV DIWHU 9HUQRQ LQFRUSRUDWHG DV DQL QGXVWULDO FLW\ 7K H VFKRRO LV VXUURXQGHGE\LQGXVWULDOEXVLQHVVHVDQGKDVEHHQIRUDOPRVW\HDUV'XULQJWKLV WLPHODQGXVHSROLF\DQG]RQLQJUHJXODWLRQVKDYHDOORZHGEXVLQHVVHVWKDWVWRUHRU XVH KD]DUGRXV PDWHULDOV WRO RFDWH ZLWKLQ RQHTXDUWHU PLOH RIW KH VFKRRO $GGLWLRQDOO\ RWKHUVFKRROVDUH ORFDWHG LQFORVHSU R[LPLW\ WR WKH&LW\ RI 9HUQRQ¶V ERXQGDULHVLQDGMDFHQWFLWLHV +D]DUGVDQG+D]DUGRXV0DWHULDOV 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW 7KHXSGDWHG*HQHUDO3ODQDQGUHYLVHG=RQLQJ2UGLQDQFHZLOOLQFUHDVHWKHSRWHQWLDO IRUFRPPHUFLDOGHYHORSPHQWDQGWUXFNDQGIUHLJKWIDFLOLWLHVZKHQFRPSDUHGWRWKH H[LVWLQJ*HQHUDO3ODQ:KLOHWKLVSURM HFWZLOOQRWG LUHFWO\LQYROYHDQ\DFWLYLW\WKDW HPLWVKD]DUGRXVHPLVVLRQVRUKDQGOHVKD]DUGRXVRUDFXWHO\KD]DUGRXVPDWHULDOV VXEVWDQFHVRUZDVWHSROLFLHVDQGODQGXVHUHJXODWLRQVZLOODOORZEXVLQHVVHVZKLFK FRXOG KDYH VXFK FKDUDFWHULVWLFV WR ORFDWH ZLWKLQ RQHTXDUWHU PLOH RI VFKRROV KRVSLWDOVUHVLGHQWLDODQGUHVLGHQWLDODVVLVWHGFDUHIDFLOLWLHV7KHVHVHQVLWLYHXVHV DUHORFDWHGERWKZLWKLQWKH&LW\DQGQHDUWKH&LW\¶VERXQGDULHVLQDGMDFHQWFLWLHV ,Q DGGLWLRQ WRVWDWHDQGIH GHUDO UHTXLUHPHQWV IRU PDQDJHPHQW RI KD]DUGRXV PDWHULDOV DQG ZDVWHV WKHIROORZLQJ*HQ HUDO 3ODQ 6DIHW\ (OHPHQW SROLFLHVIXUWKHU VXSSRUWWKHSURWHFWLRQRIUHVLGHQWVDQGZRUNHUVIURPULVNRIXSVHW Policy S-2.1:&RQWLQXHWRVXSSRUWDQGHQFRXUDJH6WDWHHIIRUWVWRLGHQWLI\H[LVWLQJ RUSUHYLRXVO\H[LVWLQJKD]DUGRXVZDVWHJHQHUDWRUVRUGLVSRVDOVLWHV LQWKH&LW\ RI 9HUQRQ Policy S-2.2:&RQWLQXHWRUHTXLUHHYHU\EXVLQHVVWRPDLQWDLQDOLVWRIWKHFKHPLFDOV DQG RWKHU KD]DUGRXV PDWHULDOV XVHG RU VWRUHG RQ VLWH LQ DFFRUGDQFH ZLWK DSSURSULDWHPDWHULDOVDIHW\GDWDVKHHWVDQGRWKHUZLVHLQDFFRUGDQFHZLWKODZDQG WRSURYLGHWKDWOLVWWRWKH)LUH'HSDUWPH QWDQG(QYLURQPHQWDO+HDOWK'HSDUWPHQW 5HTXLUHWKDWWKH)LUH'HSDUWPHQWDQG(QYLURQPHQWDO+HDOWK'HSDUWPHQWPDLQWDLQD OLVW RI VXFK PDWHULDOV DQGWKH ORFDWLRQZKHUHWKH \ DUHVWR UHG RUXVH G WRSHUP LW HPHUJHQF\SHUVRQQHOWRUHVSRQGDSSURSULDWHO\LIUHTXLUHG $OWKRXJKWKHSURMHFWLQFOXGH VFKDQJHVLQ SRWHQWLDOODQGXVHGHYHOR SPHQWRYHUWKH ORQJWHUP WKHVHFK DQJHV GR QRWLQFOX GH DVXEVWDQWLDOLQFUHD VHLQWKHXVH WUDQVSRUWRUGLVSRVDORIKD]DUGRXVPDWHULDOVDQGWKXVZLOOQRWLQFUHDVHULVNRIXSVHW LQ YLFLQLW\ RI VFKRROV DQG RWKHU VHQVLWLYH UHFHSWRUV EH\RQG WKDW DQDO\]HGLQ WKH FHUWLILHG3URJUDP(,5/RFDOVWDWHDQG IHGHUDOUHJXODWLRQVUHODWHGWR KD]DUGRXV PDWHULDOVDVQRWHGLQWKHFHUWLILHG3URJUDP(,5UHPDLQDSSOLFDEOHWRWKHSURMHFWDQG ZLOOPLQLPL]HLPSDFWVWRVHQVLWLYHUHFHSWRUVE\UHTXLULQJSURSHUKDQGOLQJWUDFNLQJ DQGGLVSRVDORIKD]DUGRXVPDWHULDOVDQGZDVWHV7KH&LW\RI9HUQRQ(QYLURQPHQWDO +HDOWK'HSDUWPHQWZLOOFRQWLQXHWRUHJXODWHEXVLQHVVHVWKDWVWRUHRUXVHKD]DUGRXV PDWHULDOV )XUWKHU PRUH WKH FHUWLILHG 3URJUDP (,5 LQFOXGHG 0LWLJDWLRQ 0HDVXUHV +DQG+WRHQVXUHWKHFRQWLQXHGUHYLHZSHUPLWWLQJDQGEXGJHWLQJIRUEXVLQHVV LQYROYHPHQWZLWKKD]DUGRXVPDWHULDOVDQGZDVWHV,PSDFWVZLOOEHHTXDOWRRUOHVV WKDQWKRVHGHWHUPLQHGLQWKHFHUWLILHG3URJUDP(,5UHPDLQLQJless than significant with mitigation incorporation DQG LPSOHPHQWDWLRQ RIUHJXODWR U\ UHTXLUHPHQWVDQGWKHSROLFLHVRIWKH*HQHUDO3ODQ Impact 4.2.D Hazardous Materials Sites %HFDXVH WKH *HQHUDO 3ODQXSG DWH DOORZV IRUEXWG RHV QRWD XWKRUL]H DQ\VSH FLILF GHYHORSPHQWSURMHFWRUDQ\RWKHUODQGXVHDOWHULQJSURSRVDOLWZRXOGQRWUHVXOWLQ DQ\ GLUHFW LPSDFWV LQYROYLQJ D GHYHORSPHQW SURMHFW RQD VLWHNQRZQWREH FRQWDPLQDWHGDQGUHSRUWHGDVVXFKXQGHU&DOLIRUQLD*RYHUQPHQW&RGH$V QRWHGDERYHWKH&RUWHVH/LVWLGHQWLILHVVL[VLWHV LQ9HUQRQDVFRQWDPLQDWHG7KH +D]DUGVDQG+D]DUGRXV0DWHULDOV )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH MITIGATION H-1 MITIGATION H-2 SURSRVHGSURMHFWGRHVQRWLQYROYHDQ\GHYHORSPHQWDFWLYLW\7KXVQRGLUHFWLPSDFW ZLWK UHJDUG WR WKHVH VLWHV ZLOOUHVX OW IURP WKH SURMHFW $Q\ IXWXUH GHYHORSPHQW DSSOLFDWLRQ SXUVXDQW WR ODQGXVHSROLF\ FRXOG SURSRVH UHXVH RIHLWKHU RQH RIWKH LGHQWLILHG VLWHV +RZHYHUDQ \ VXFKD FWLYLW\ ZLOOUHTXLUH HQYLURQPHQWDO UHYLHZ SXUVXDQW WR&(4$LQFOXGLQ J DVVHVVPHQW IRU VLWHFRQWDPLQD WLRQ DQGSR VVLEOH VLWH UHPHGLDWLRQSULRUWRUHXVH7KHSURSRVHGSURMHFWGRHVQRWLQFOXGHDQ\SROLFLHVWKDW ZLOO FKDQJH H[LVWLQJ UHYLHZ SURFHGXUHV RUUHJX ODWRU\ UHTXLUHPHQWV LQYROYLQJ FRQWDPLQDWHGVLWHV,PSDFWVZLOOEHHTXDOWRRUOHVVWKDQWKRVHGHWHUPLQHGLQWKH FHUWLILHG 3URJUDP(, 5 UHPDLQLQJless than significant ZLWK LPSOHPHQWDWLRQ RI UHJXODWRU\UHTXLUHPHQWVDQGWKHSROLFLHVRIWKH*HQHUDO3ODQ Mitigation Measures :LWKUHJDUGWRSRWHQ WLDOGHYHORSPHQWRQDFRQWDPLQDWHGVLWHLPSDFWZLOOEHOH VV WKDQVLJQLILFDQWDQGQRPLWLJDWLRQLVUHTXLUHGDVVWDWHGLQWKH3URJUDP(,5 :LWK UHJDUG WRWK H XVH DQGW UDQVSRUW RI KD]DUGRXV PDWHULDOV DQGWKHVLWLQJRI DFWLYLWLHV LQYROYLQJ WKH XVH RI KD]DUGRXV PDWHULDOV LQ FORVH SUR[LPLW\ WR VFKRROV KRVSLWDOVUHVLGHQWLDODVVLVWHGFDUHIDFLOLWLHVRUVLPLODUXVHVWKHIROORZLQJPLWLJDWLRQ ZDVUHTXLUHGE\WKHFHUWLILHG3URJUDP(,5DQGUHPDLQVDSSOLFDEOHWRWKHSURSRVHG SURMHFW 7KH &LW\ ZLOO FRQWLQXH WRLPS OHPHQW WKH SURYLVLRQV RI&LW \ RUGLQDQFHV WRSURYLG H IRUWKH EXVLQHVV RFFXSDQF\LQ VSHFWLRQ SURJUDP DQG WKH UHJXODU LQVSHFWLRQ RI EXVLQHVVHV LQYROYHG LQ WKH SURGXFWLRQ VWRUDJH KDQGOLQJ GLVSRVDO WUHDWPHQW HPLVVLRQGLVFKDUJHRUUHF\FOLQJRIKD]D UGRXVPDWHULDOV6XFK DFWLYLW\ ZLOOEHIXQGHGDVSDUW RI WKH&LW\¶VDQQXD O EXGJHWLQJ SURFHVVVSHFLDOWD[DQGRUZLOOEHIXQGHGDVDIHHSURJUDP $W WKH WLPH DQ\QH Z RUUH YLVHG +D]DUGRXV 0DWHULDO %XVLQHVV DSSOLFDWLRQ IRUDQHZEXVLQ HVV RU DFWLYLW\ LV UHFHLYHG IRU D ORFDWLRQ ZLWKLQ RQHTXDUWHU PLOH RI DQ\ UHVLGHQFH VFKRRO KRVSLWDO UHVLGHQWLDO DVVLVWHG FDUH IDFLOLW\ RU VLPLODU XVH VHQVLWLYH XVHV PD\ EHORFDWH G ZLWKLQ WKH&LW\RURXWVLGH LWV ERXQGDULHVRUJUHDWHUGLVWDQFHDVPD\ EHGHWHUPLQHGE\WKH 'LUHFWRU RI (QYLURQPHQWDO +HDOWK 'HSDUWPHQW IRU SDUWLFXODU EXVLQHVV W\SHV WKH&LW\Z LOO UHYLHZ WKHDSSOLFDW LRQ DQG GHWHUPLQHZKHWKHUD+HDOWK5LVN$VVHVVPHQW+5$LVUHTXLUHG SXUVXDQWWR6WDWHODZDQGRU&LW\2UGLQDQFHWRDGGUHVVDQ\ SRWHQWLDO LPSDFWV WRWKHVH XVHV ,I DQ +5$LVGHHP HG DSSURSULDWH DQG IXUWKHU LIWK H +5$LG HQWLILHV SRWHQWLDO ULVNV DVVRFLDWHGZLWKWKHEXVLQHVVDFWLYLW\UHODWLYHWRSUR[LPLW\WRWKH UHVLGHQFH VFKRRO KRVSLWDO UHVLGHQWLDO DVVLVWHG FDUH IDFLOLW\RU VLPLODUXVHWKH&LW\VKDOOHQVXUHWKDWDFWLRQLVWDNHQWRDGGUHVV VXFKULVN7KHDFWLRQPD\FRQVLVWRI +D]DUGVDQG+D]DUGRXV0DWHULDOV 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW 'HQ\LQJWKHDSSOLFDWLRQZLWKLQWKHOLPLWVRIWKH&RGHRIWKH &LW\RI9HUQRQRU 5HTXLULQJWKHEXVLQHVVRSHUDWRUWRLQFRUSRUDWHSUHYHQWDWLYH RU DPHOLRUDWLYH PHDVXUHV LQWR WKHEX VLQHVV SURFHVVHV RU DFWLYLWLHVWRORZHUWKHULVNWRDFFHSWDEOHOHYHOVDVVHWIRUWK E\IHGHUDORUVWDWHUHJXODWLRQVDQGSROLFLHV Level of Impact after Mitigation ,PSDFWVZLOOEHOHVVWKDQVLJQLILFDQWDWWKHSURJUDPPDWLFOHYHOZLWKLPSOHPHQWDWLRQ RIPLWLJDWLRQ*HQHUDO3ODQSROLFLHVDQGUHJXODWRU\UHTXLUHPHQWV References LKWWSILUHODFRXQW\RUJ-XO\ LL KWWSZZZHQYLURVWRUGWVFFDJRYSXEOLFVHDUFKDVS"&0' VHDUFK FLW\ 9HUQRQ ]LS FRXQW\ /RV$ QJHOHV FDVHBQXPEHU EXVLQHVVBQDPH RSHUDWLQJ 7UXH SRVWBFORVXUH 7UXH QRQBRSHUDWLQJ 7UXH 0D\ LLL 8QLWHG 6WDWHV (QYLURQPHQWDO 3URWHFWLRQ $JHQF\ 6X SHUIXQG 6LWH ,QIRUPDWLRQ 9HUQRQ KWWSFISXEHSDJRYVXSHUFSDGFXUVLWHVVUFKVLWHVFIP>-XQH@ 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW Noise 4.3 This section of the Supplemental EIR examines potential impacts associated with noise in Vernon and whether future development permitted due to changes to the General Plan and Zoning Code would increase those impacts analyzed in the certified General Plan EIR. The Initial Study (Appendix A) indicated that there are potential impacts related to permanent and temporary noise and vibration. Environmental Setting Noise within the Vernon planning area is comprised of cumulative noise generated by transportation activities and stationary sources. Transportation noise refers to noise from automobile use, trucking, and rail operations. Non-transportation noise typically refers to noise from stationary sources such as industrial machinery, air conditioning systems, compressors, and outdoor industrial activities. Regardless of the type of noise, noise levels are highest near their source and decrease with distance. Noise Metrics and Standards Noise is most often defined as unwanted, excessive, or irksome sound. Sound - and noise – consists of energy waves that people receive and interpret. There are three properties of noise: the amplitude and amplitude variation of the acoustical wave (loudness), the frequency (pitch), and the duration of the noise. Despite the ability to measure sound, human perceptibility is subjective, and the physical response to sound complicates the analysis of its impact on people. People judge the relative magnitude of sound sensation in subjective terms such as “noisiness” or “loudness.” Sound pressure magnitude is measured and quantified using a logarithmic ratio of pressures, the scale of which gives the level of sound in decibels (dB). In order to factor in the subjectivity of sound to the human ear and the variation of sensitivity to different frequencies of sound, the A-weighted sound pressure level, or dB(A), is the scale of measurement that is most useful in community noise measurement. This sound level is measured in decibels to provide a scale with the range and characteristics most consistent with that of peoples' sensitivity to sounds. The A-weighted sound level of traffic and other long-term noise-producing activities within and around a community varies considerably with time. Measurements of this varying noise level are accomplished by recording values of the A-weighted level during representative periods within a specified portion of the day. Because a given level of noise may be more or less tolerable depending on the duration of exposure, other measures of noise exposure have been developed. Federal and state agencies have established noise and land use compatibility guidelines that use averaging approaches to noise measurement. The State Department of Aeronautics and the California Commission on Housing and Community Development have adopted the community noise equivalent level (CNEL). To account for increased human sensitivity at night, this measure weights the average noise level at night by adding five dB to the measurement during the 1RLVH 4.3-2 )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH 7:00 P.M. to 10:00 P.M. time period and an additional ten dB on noise measured during the 10:00 P.M. to 7:00 A.M. time period. The City of Vernon utilizes the CNEL measurement scale for its community noise/land use compatibility standards. In recognition of the industrial nature of the community, the current General Plan establishes 75 CNEL as the acceptable exterior ambient noise level for land use planning purposes. The current Zoning Ordinance establishes allowable exterior noise for all lots in the City of 75 dBA, except for lots located within one tenth (1/10) of a mile on any residence or school located in Vernon or abutting communities, which lots are limited to 65 dBA between 7:00 A.M. and 10:00 P.M. and 60 dBA between 10:00 P.M. and 7:00 A.M.. Existing Noise Conditions Generalized ambient 24-hour community noise conditions frequently are illustrated using noise contour maps. Similar to a topographic map, a noise contour map shows variations in conditions within a specific geographic area. In Vernon, the most significant noise-producing activity involves the transportation systems. This noise source consists of several elements: arterial roadways, Interstate 710, and train operations on rail lines and at rail yards. Hence, the noise contours show higher levels along these transportation routes and near the rail yards. Exhibit 4.3- 1 (2007 Noise Contours) depicts the noise contours within the planning area during preparation of the certified EIR. No part of Vernon is located within an area covered by an airport land use plan. The nearest airport is in the city of Compton, approximately eight miles to the south. The certified EIR determined that the adoption and implementation of the General Plan update would not result in airport noise impacts on people residing or working within the Planning Area. Adoption and implementation of the focused General Plan and zoning code update would be consistent with the determination made in the certified EIR. The City is also subject to noise resulting from occasional aircraft overflights from regional airports, even though Vernon is outside of any specific airport noise contour. To identify baseline community noise conditions during preparation of the certified EIR, a total of three 24-hour noise measurements and eight limited noise measurements were obtained within the planning area. The locations are shown in Exhibit 4.3-2 (Noise Measurement Locations), and the results of these measurements are summarized in Table 4.3-1 (Noise Measurement Summary). Traffic Noise The eight limited-period noise measurements revealed that ambient noise was most often due to traffic on the surface streets in Vernon. Traffic in Vernon consists of local traffic serving local businesses, as well as a substantial amount of through traffic (that is, no trip ends in Vernon) along arterials such as Bandini Boulevard, Soto Avenue, Santa Fe Avenue, and Slauson Avenue. The results from these measurements indicated an Leq (average noise level during the measurement period) of between 66 dB(A) and 75 dB(A). 1RLVH 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW - Table 4.3-1 Noise Measurement Summary No. Location Time Measured Noise Levels, dB(A) Leq Lmax CNEL 1 W. Alameda St at 42 St 11:55 A.M. to 12:23 P.M. 67.1 84.3 N/A 2 Rear yard of 4330 Furlong Place 24 hours -- -- 69.3 3 Vernon City Elementary School 3:36 P.M. to 3:56 P.M. 73.3 87.4 N/A 4 Leonis Blvd at Soto St 1:43 P.M. to 2:04 P.M. 67.6 85.7 N/A 5 Vernon Avenue 5:10 P.M. to 5:31 P.M. 66.2 76.0 N/A 6 E. 26th Street (without rail yard noise) 10:20 A.M. to 11:20 A.M. 69.9 83.7 N/A 6 E. 26th Street (with rail yard noise) 10:20 A.M. to 11:20 A.M. 74.4 89.3 N/A 7 Opposite 4408 Bandini Blvd 1:49 P.M. to 2:10 P.M. 74.7 88.0 N/A 8 Rear yard of 2638 53rd St, Huntington Park 24 hours -- -- 61.5 9 Adjacent to 3345 Fruitland Ave 4:18 P.M. to 4:39 P.M. 66.4 76.5 N/A 10 Rear yard of 4217 52nd St, Maywood 24 hours -- -- 64.0 11 State St at 60th Pl, Huntington Park 12:56 P.M. to 1:16 P.M. 70.2 83.0 N/A Notes: Leq is the equivalent (i.e. average) noise level during the measurement period. Lmax is the maximum noise level during the measurement period. CNEL is the community noise equivalent level, a weighted 24-hour measure of noise exposure that considers people’s lower tolerance to noise during the evening and nighttime hours. Railroad Noise Vernon is exposed to noise from train operations on six rail lines, spur lines, and activities at the Burlington, Northern & Santa Fe (BNSF) rail yard, as well as at the Union Pacific (UPRR) rail yard in the adjacent city of Commerce. Table 4.3-2 (Existing Train Movement Data within City of Vernon) identifies the six rail lines affecting Vernon. 1RLVH 4.3-4 )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH Table 4.3-2 Existing Train Movement Data within City of Vernon Average Daily Operations Rail Line Day (7 am - 7 pm) Evening (7 pm - 10 pm) Night (10 pm - 7 am) Speed BNSF line adjacent to 26th St. Freight 16 4 12 40 mph Amtrak 19 3 4 65 mph Metrolink 34 2 11 65 mph BNSF line east of Santa Fe Ave. Freight 7 2 5 15 mph UP line on Alameda St. Freight 28 7 21 40 mph UP line on Downey Rd. Freight 22 6 17 20 mph UP line on Randolph St. Freight 8 2 6 20 mph UP LA subdivision line Freight 20 5 15 40 mph Metrolink 15 1 5 65 mph Referring to the noise contour map in Exhibit 4.3-1, the CNEL generated in the City of Vernon by train movements reaches levels as high as 80 dB. However, the land uses exposed to train noise are largely industrial in nature and are not noise sensitive. The primary source of annoyance to residents in the vicinity of the UPRR line adjacent to S. Downey Road is train horn soundings at crossings. Industrial Noise Due to the industrial nature of the City, manufacturing businesses in Vernon create noise, including noise generated by loading dock operations, trucks entering and leaving the area, and mechanical equipment located both inside and outside the building. The certified EIR determined that industrial noise at a residence adjacent to an industrial property was 69.3 CNEL. In addition, noise measurements were taken in the rear yards of two residences located in the neighboring Huntington Park and Maywood. The results indicated a CNEL of approximately 62 dB in Huntington Park and 64 dB in Maywood. The location at the site of measurement in Huntington Park is a residence abutting an industrial property in the City of Vernon. As such, the primary noise source affecting this residence is noise from the industrial property, with the average noise level ranging from 51.0 to 66.7 dB(A), and the maximum noise level ranged from 66.9 to 87.6 dB(A) during the daytime hours of 7:00 A.M. to 10:00 P.M. During the nighttime hours, the average noise level ranged from 44.0 to 51.5 dB(A), and the maximum noise level ranged from 54.0 to 73.7 dB(A). The calculated CNEL of 61.5 dB at this residence is less than the exterior CNEL guideline of 65 dB for residential properties in Vernon. This level also does not exceed the City of Huntington Park’s CNEL standard of 65 dB. 1RLVH 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW - In the city of Maywood, a noise measurement was obtained at a residence abutting an industrial property in Vernon. This residence is affected by noise from industrial ventilation equipment, traffic on Fruitland Avenue, and aircraft flyovers. At this location, the average noise level ranged from 57.1 to 60.9 dB(A), and the maximum noise level ranged from 72.3 to 84.8 dB(A) during the daytime hours of 7:00 A.M. to 10:00 P.M. During the nighttime hours, the average noise level ranged from 55.1 to 58.5 dB(A), and the maximum noise level ranged from 71.1 to 84.7 dB(A). The City of Maywood zoning code lists the following noise standards for residential areas: 55 dB(A) during nighttime hours of 10:00 P.M. to 7:00 A.M. and 60 dB(A) during daytime hours of 7:00 A.M. to 10:00 P.M. Noise-sensitive Land Uses Noise is particularly problematic when noise-sensitive land uses are proximate to the noise. Because Vernon predominantly consists of industrial uses and because policy set forth in the Housing Element prohibits the construction of any new housing in Vernon in recognition of the hazards – including high noise levels associated with widespread industrial activity – these standards discourage any new noise-sensitive use that would be incompatible with the City’s industrial focus. However, the adopted 2014-2021 Housing Element included the addition of Housing and Emergency Shelter Overlays. The Housing Overlay supports development of residential units on approximately two acres in the eastern portion of the Planning Area and the Emergency Shelter Overlay supports development of emergency shelters on approximately 1.61 acres in the northwest portion of the Planning Area. The only noise-sensitive land uses currently existing within the City are 31 residential units (as of 2007) and the Vernon City Elementary School. These residences are primarily clustered in three areas: (1) on East Vernon Avenue at Furlong Place, (2) on East Vernon Avenue between Downey Road and Alcoa Avenue, and (3) on Fruitland Avenue west of Downey Road. In addition, there are a few mixed-use residential/commercial land uses on Leonis Boulevard at Soto Street. Vernon City Elementary School is located at the southwest corner of East Vernon Avenue and South Santa Fe Avenue. As noted above, residential neighborhoods in Maywood and Huntington Park abut Vernon. Schools are located near the City boundary as well. According to Figure 4.3-1 (Noise/Land Use Compatibility Matrix (noise standards), exterior noise levels are normally compatible up to 75 dB CNEL for residential use and 65 dB CNEL for school use. Threshold for Determining Significance In the adopted General Plan, the City establishes CNEL standards for noise/land use compatibility. The CNEL standard is up to 65 CNEL for schools and churches, up to 75 CNEL for residences and office uses, and generally up to 80 CNEL or higher for the predominate industrial uses as shown in Figure 4.3-1 (Noise/Land Use Compatibility Matrix (noise standards)). In the Zoning Ordinance, the City sets forth one-hour standards for point-source noise as follows: x 75 dB(A) citywide, except within one-tenth of a mile from any residence or public school; 1RLVH 4.3-6 )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH x Within one-tenth of a mile of residences and schools, 65 dB(A) during day- time hours; and x Within one-tenth of a mile of residences, 60 dB(A) during night-time hours. Any noise source in excess of the standards specified may only be permitted with a Conditional Use Permit, which may only be permitted with a finding that the proposed use will not adversely affect the general welfare as a result of noise. 1RLVH 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW - Figure 4.3-1 Noise/Land Use Compatibility Matrix (noise standards) Environmental Impact As discussed in Section 3.0 (Project Description) of this Supplemental EIR, updated General Plan land use policy permits the establishment of housing on 52nd Place between King Avenue and Mayflower Avenue in the southeastern portion of the 1RLVH 4.3-8 )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH City. With regard to the future establishment of other noise-sensitive uses such as hospitals, day-care facilities, and private schools, the Zoning Ordinance specifically prohibits these uses. The City has no jurisdiction regarding the placement of public schools within Vernon, but generally the City discourages such uses due to the industrial nature of the community. The certified EIR indicated that long-term implementation of land use policy is anticipated to result in a decline in the amount of industrial building space citywide by approximately 1.2 million square feet over the life of the General Plan. The decline will occur generally because new development will be required to meet current parking and loading standards. Older buildings that currently cover entire lots will be replaced with more modern development projects that provide sufficient off-street parking and loading facilities. The General Plan Noise Element includes the noise/land use compatibility criteria that will guide decisions regarding the siting of new land uses and protecting existing noise-sensitive uses from excessive noise. Future development projects pursuant to updated General Plan land use policy will be considered compatible with the existing noise environment if the project is deemed to be normally acceptable or conditionally acceptable. Those projects which are determined to be normally acceptable are likely to require no mitigation measures, and those which are conditionally acceptable may be required to incorporate mitigation measures to achieve City standards. Measures may include, for example, noise insulation internal or external to the building, including sound walls or building insulation. To address point-source noise associated with industrial activity, the Zoning Ordinance establishes the following standards: x 75 dB(A) citywide, except near any residence or public school; x Within one-tenth of a mile of residences and schools, 65 dB(A) between 7:00 A.M. and 10:00 P.M.; and x Within one-tenth of a mile of residences, 60 dB(A) between 10:00 P.M. and 7:00 A.M. Per the Zoning Ordinance, any noise source in excess of the standards specified may only be permitted with a Conditional Use Permit, which may only be permitted with a finding that the proposed use will not adversely affect the general welfare as a result of noise. Land Use Compatibility and Projected Future Noise Levels Noise contour modeling was performed during preparation of the certified General Plan EIR based on projected future regional traffic volumes and rail activity to determine future noise conditions. Exhibit 4.3-3 (Future CNEL Contours) illustrates the projected future noise contours for Vernon. As the Exhibit shows, the highest noise levels í up to 80 CNEL í are anticipated to occur around the Hobart rail yard, along Alameda Street, along Santa Fe Avenue between Vernon Avenue and 37th Street, along Soto Street north of Vernon Avenue, and along Bandini Avenue and 1RLVH 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW - Atlantic Boulevard north of the Los Angeles River. These increases are anticipated due to the anticipated increase in regional truck and vehicle traffic utilizing these surface streets. The focused General Plan and Zoning Ordinance update establishes a new Truck and Freight Terminal Overlay and replaces and expands the existing Commercial Overlay with the new C-1 and C-2 Commercial Overlays. Development pursuant to focused update will result in continued industrial use throughout the community, with provision for commercial uses along Santa Fe Avenue, Pacific Boulevard, Soto Street north of Fruitland Avenue, East Slauson Avenue, and select areas at the eastern boundary of the Vernon to meet the needs of the daytime employee population. The noise/land use compatibility criteria indicate that such uses are classified as normally compatible in environments with a CNEL of up to 80. Vernon General Plan land use policy and Zoning Ordinance strictly limit any new noise- sensitive uses (for example, residences, schools, day-care facilities, hospitals) into the City, except for residences in the Housing Overlay, which are subject to a Development Agreement. A Development Agreement will allow tailored development standards to be applied to proposed residential projects, thereby providing flexibility in responding to the unique land use conditions in Vernon. In addition, the certified EIR established Mitigation Measures N-1 and N-2. Mitigation Measure N-1 requires that the City continue to enforce noise regulations and to periodically evaluate regulations for adequacy and revision as needed. Mitigation Measure N-2 requires the review of all development proposals and building permits to determine whether the proposed use has the potential to exceed City noise standards. An acoustical analysis is required for all developments with the potential to exceed noise standards and for uses near existing residences and schools. All mitigation measures included in the certified EIR are applicable to the proposed focused General Plan and Zoning Ordinance update. Thus, consistent with the certified EIR, the City does not anticipate that any new noise/land use conflicts within Vernon will arise over the life of this General Plan update. In this regard, impact will be less than significant and consistent with the findings of the certified EIR. Industrial Noise and Ground-borne Vibrations In general, existing noise and vibration conditions associated with industrial activity within Vernon are not considered excessive because of the predominantly industrial nature of the City. As stated in the certified EIR, implementation of land use policy and zoning regulations will allow potentially noise-intensive industrial businesses to locate adjacent or in close proximity to existing residences in Vernon, Vernon City Elementary School, and residences and public schools in adjacent jurisdictions. Impact would primarily result from noise generated by loading dock operations, trucks entering and leaving the area, mechanical equipment located both inside and outside the building(s), and outdoor industrial activity. Implementation of zoning regulations that establishes one-hour standard of 65 dB(A) between 7:00 A.M. and 10:00 P.M. within one-tenth mile of any residence or public school in Vernon or adjacent communities. In addition, a conditional use permit for any use that has the potential to generate excessive noise is required for any use within one-tenth 1RLVH 4.3-10 )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH MITIGATION N-1 MITIGATION N-2 mile of a residence or public school. The certified EIR determined that implementation of these regulations will allow the City to mitigate any potential impacts associated with individual projects on a case-by-case basis and reduce impact to level considered less than significant. The focused General Plan and Zoning Ordinance update establishes a new Truck and Freight Terminal Overlay and replaces and expands the existing Commercial Overlay with the new C-1 and C-2 Commercial Overlays. Potential new commercial uses along Santa Fe Avenue, Pacific Boulevard, Soto Street, and East Slauson Avenue will be located in close proximity to existing industrial, residential, and school use. Consistent with the certified EIR, implementation of zoning regulations will require potential impacts to be evaluated on a case-by-case basis. In addition, implementation of certified EIR Mitigation Measures N-1 and N-2 will reduce impacts to less than significant levels. With regard to ground-borne vibrations, Vernon is a predominately industrial city with uses that involve industrial processes that produce vibrations measurable beyond the property line. As stated in the certified EIR, Article IV, Section 26.4.1-6 of the Zoning Ordinance addresses such vibrations and guards against one business adversely impacting another. The certified EIR determined that impacts related to ground-borne vibrations will be less than significant. Consistent with the certified EIR, Article IV, Section 26.4.1-6 of the Zoning Ordinance will apply to future use pursuant to the focused General Plan and Zoning Ordinance update. Thus, impact will be less than significant and consistent with the findings of the certified EIR. Mitigation Measures The following mitigation measures were incorporated with the certified General Plan EIR and remain applicable to the proposed General Plan update. Noise Regulations. Continue to enforce City noise regulations contained in the Zoning Ordinance to protect residents and school children from excessive noise levels associated with stationary noise sources. Periodically evaluate regulations for adequacy and revise, as needed, to address community needs and changes in legislation and technology. Siting of New Businesses and Activities near Sensitive Land Uses. Review all development proposals and building permits within the City to determine whether the proposed use has the potential to exceed City one-hour noise standards. The City’s standards are lower at locations near existing residences and schools. As appropriate, require acoustical analyses for all such development and activities near such uses, and determine if mitigation measures are required. Require property and 1RLVH 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW - business owners to implement mitigation to achieve City noise standards. Level of Impact after Mitigation Incorporation Consistent with the certified EIR, impacts will be less than significant at the program level with implementation of mitigation, General Plan policies, and regulatory requirements. 1RLVH 4.3-12 )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH 2007 Noise Contours Noise Measurement Locations - Future Noise Contours 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW Transportation and Traffic 4.4 7KH,QLWLDO6WXG\LQGLFDWHGWKDWLPSDFWVUHODWHGWRFLUFXODWLRQV\VWHPSHUIRUPDQFH DQGWKH&RQJHVWLRQ0DQDJHPHQW3URJUDP&03FRXOGEHSRWHQWLDOO\VLJQLILFDQWDQG KDYH EHHQ DQDO\]HG KHUHLQ 7KH ,QLWLDO6WXG\ FRQFOXGHG WKDW DGRSWLRQ DQG ORQJ WHUPLPSOHPHQWDWLRQRIWKH9HUQRQ*HQHUDO3ODQXSGDWHGRHVQRWKDYHWKHSRWHQWLDO WRUHVXOWLQDFKDQJHLQDLUWUDIILFSDWWHUQVVXEVWDQWLDOO\LQFUHDVHKD]DUGVGXHWRD GHVLJQ IHDWXUH RU LQFRPSDWLEOH XVHVUHVXOWLQLQD GHTXDWH HPHUJHQF\ DFFHVV RU FRQIOLFWZLWKDOWHUQDWLYHWUDQVSRUWDWLRQVWUDWHJLHV 7KHWUDIILFDQDO\VLV SUHSDUHGE\.XQ]PDQ$VVRFLDWHV$SSHQGL[&IRFXVHVRQWKH DELOLW\RIWKH&LW\¶VURDGZD\VWRDFFRPPRGDWHORQJWHUPWUDIILFYROXPHVDVVRFLDWHG ZLWKJURZWKGXHWRWKHDGRSWLR QRIWKH7UXFN2YHUOD \DQGWKHSUHYLRXVO\DGRSWHG 5HVLGHQWLDO2YHUOD\DVFRPSDUHGWRWKHDQDO\VLVSURYLGHGLQW KHFHUWLILHG*HQHUDO 3ODQ (,57KHLPSDFWGLVFX VVLRQ SURYLGHG KHUHLQ DOVRLQFOXGHVDQDO\VLVRIWK H DGGLWLRQRIWKHH[SDQGHG&RPPHUFLDO2YHUOD\GLVWULFW 7KH DSSURDFK WRWKH WUDIILFDQ DO\VLV ILUVW LQYROYHG LGHQWLI\LQJ FRQGLWLRQV RQOR FDO URDGZD\VEDVHGRQH[WHQVLYHFLW\ZLGHWUDIILFFRXQWVREWDLQHGLQ)HEUXDU\DQG 2FWREHU)XWXUHURDGZD\YROXPHVIRUWKHKRUL]RQ\HDUZHUHSURMHFWHG XVLQJDQDQQXDOJURZWKIDFWRU RISHUFHQWSHU\HDU7KRVHLQWHUVHFWLRQ VWKDW ZHUHLGHQWLILHGLQWKHFHUWLILHG*HQHUDO3ODQ(,5DVRSHUDWLQJDWXQDFFHSWDEOHOHYHOV ZHUHDQDO\]HGWRG HWHUPLQHLIWKHDGG LWLRQRIWKHYDULRXVRYHUOD\VZRXOGIXUWKHU GHJUDGHSHUIRUPDQFHLQWKHVHDUHDV 7ZRSULPDU\PHDVXUHVZHUHXVHGWRHYDOXDWHWKHH[LVWLQJDQGSODQQHGFDSDFLW\RI WKH H[LVWLQJ DQGSODQQHGURDG ZD\ V\VWHP ZLWKLQWKH3ODQQLQ J $UHDYROXPHDQG FDSDFLW\$VQRWHGFXUUHQWYROXPHVZHUHHVWDEOLVKHGYLDWUDIILFFRXQWVDQGIXWXUH YROXPHV UHIOHFW SURMHFWLRQV &DSDFLW\ UHIHUV WR WKH YHKLFOHFDUU\LQJ DELOLW\ RID URDGZD\DWIUHHIORZVSHHG7KHUDWLRE HWZHHQYROXPHDQGFDSDFLW\9&LVXVH G WR HVWDEOLVK DO HYHO RI VHUYLFH /26 IRU URDGZD\ IDFLOLWLHV /26 LVD TXDOLWDWLYH GHVFULSWLRQ RIWUDIILF RSHUDWLRQV IRU URDGZD\ IDFLOLWLHV /26$ LQGLFDWHV IUHH IORZ FRQGLWLRQVZLWKOLWWOHRUQRGHOD\/26)LQGLFDWHVDKLJKOHYHORIGHOD\ZLWKVHYHUH FRQJHVWLRQ /26&LQGLFD WHV PRGHUDWH GHOD\ /26' LQGLFDWHV PDUJLQDOO\ DFFHSWDEOH WUDIILFR SHUDWLRQV LQ XUEDQDUHDV7KHWKUHVK ROG RI/2 6 (LVWKH WKHRUHWLFDOFDSDFLW\RIWKHVWUHHWRULQWHUVHFWLRQ $QDO\VLVRIWKHDUWHULDOURDGV\VWHPZD VFRQGXFWHGXVLQJWKHLQWHUVHFWLRQFDSDFLW\ DSSURDFK VLQFH LQWHUVHFWLRQV DUH WKHSULP DU\ OLPLWLQJ IDFWRU ZLWKLQWK H URDGZD\ V\VWHP/HYHOVRIVHUYLFHIRUDUWHULDOURDGZD\LQWHUVHFWLRQVDUHGHWHUPLQHGEDVHG RQ RSHUDWLQJ FRQGLWLRQV GXULQJ WKH$0 DQG30 SHDN KRXUV 7KHLQW HUVHFWLRQ FDSDFLW\ XWLOL]DWLRQ ,&8 PHWKRGRORJ\ LV DSSOLHG XVLQJSH DNKRXU YROXPHV DQG FRQVLGHUV WKH JHRPHWULF FRQILJXUDWLRQ RI LQWHUVHFWLRQV ZKHQ PHDVXULQJ FDSDFLW\ 7KH,&8PHWKRGVXP VWKH9&UDWLR VIRUWKHFULWLFDOPRYHPHQWVRIDQLQW HUVHFWLRQ DQG LVJH QHUDOO\ FRPSDWLEOH ZLWK WKH LQWHUVHFWLRQ FDSDFLW\ DQDO\VLV PHWKRGRORJ\ RXWOLQHG LQWKH +LJKZD\&DSDFLW \ 0DQXDO Table 4.4-1 VXPPDUL]HV ,&8 UDQJHVDQGFRUUHVSRQGLQJ/26GHVFULSWLRQV 7UDQVSRUWDWLRQDQG7UDIILF )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH Table 4.4-1 Arterial Intersection Performance Criteria ICU Level of Service (LOS) ± & ± ' ± () 6RXUFH.XQ]PDQ$VVRFLDWHV Environmental Setting Roadway System 9HUQRQLV FHQWUDOO\ORFDWHGZLWKLQWKH/RV$QJHOH V PHWURSROLWDQ DUHDZLWKUHDG\ DFFHVVWRWKHIUHHZD\QHWZRUNDQGUHJLRQDOUDLOOLQHV,QWHUVWDWH,UXQV DORQJ WKH &LW\¶V HDVWHUQ ERXQGDU\ SURYLGLQJ GLUHFWDFFHVVWRWKHSR UWV RI/ RQJ %HDFKDQG/RV$QJHOHV$SSUR [LPDWHO\RQHPLOHQRUWKRI9HUQRQLVWKH, , 6WDWH5RXWH65LQWHUFKDQJH,LVDSSUR[LPDWHO\WZRDQGRQHKDOIPLOHV WR WKHZH VW DQG,LVD SSUR[LPDWHO\ IRXU PLOHV VRXWK RI WKH&LW\7KHVH IUHHZD\VFRQQHFWWRQXPHURXVRWKHUIUHHZD\VLQWKHUHJLRQLQFOXGLQJWKH,, 6565DQG86 9HUQRQ¶V VWUHHWV\VWHPLVGLIIHUHQWLD WHG E\ URDGZD\ VL]HIX QFWLRQ DQG FDSDFLW\ 7KHIRXUEDVLFW\SHVRIURDGZD\VLQ9HUQRQDUHIUHHZD\VDUWHULDOVWUHHWVFROOHFWRU VWUHHWVDQGORFDOVWUHHWV7KHDVVLJQPHQWRIWKHVHFODVVLILFDWLRQVWRVWUHHWVLQWKH &LW\ LVVK RZQ RQ WKH &LUFXODWLRQ 3ODQL Q ([KLELW &LUFXODWLRQ 3ODQ 0DMRU DUWHULDOV WUDYHUVLQJ WKH&LW\LQ FOXGH $ODPHGD 6WUHHW $WODQWLF%RXOH YDUG %DQGLQL %RXOHYDUGWK6WUHHW3DFLILF%RXOHYDUG6DQWD)H$YHQXH 6ODXVRQ$YHQXHDQG 6RWR 6WUHHW &ROOH FWRU VWUHHWV LQ WKH &LW\ LQFOXGH )UXLWODQG $YHQXH /HRQLV %RXOHYDUG'LVWULFW %RXOHYDUG 9HUQRQ $YHQXH VW 6WUHHW DQG WK6WUHHW &XPXODWLYHO\ WKHVH URDGZD\V FDUU\ WKH PDMRULW\ RI WUDIILF LQWKH&LW \ PXFKRI ZKLFKLVWKURXJKWUDIILF $VQRWHG,SURYLGHVDQLPSRUWDQWGLUHFWFRQQHFWLRQIURPUHJLRQDOUDLOIDFLOLWLHV WRWKHSRUWVRI/RQJ%HD FKDQG/RV$QJHOHV$OWKRXJKOHVVWKDQKDOIDPLOHRIWKL V IUHHZD\ WUDYHUVHV 9HUQRQWKDWSRUWLRQFRQWD LQV WKH YHU\ EXV\ $WODQWLF %RXOHYDUG%DQGLQL%RXOHYDUGLQWHUFKDQJH7KLVIUHTXHQWO\FRQJHVWHGLQ WHUFKDQJH FDUULHV D VXEVWDQWLDO DPRXQW RI WUXFN WUDIILF IURP 9HUQRQ SDUWLFXODUO\ IURP WKH DGMDFHQW +REDUW 5DLO <DUG, Q $XJXVW RI WKH*DWHZ D\ &LWLHV &RXQFLO RI *RYHUQPHQWVPDGHSUHOLPLQDU\UHFRPPHQGDWLRQVWRLPSURYHWKH$WODQWLF%DQGLQL LQWHUFKDQJH DVZHOODVWREXLOGWUX FN UDPSV GLUHFWO\ IURP WKHUDLO\D UGV WRWKH IUHHZD\(QJLQHHULQJSODQVDQGVWXGLHVIRUWKLVLQWHUFKDQJHZLOOFRQWLQXHLQFRQFHUW ZLWKEURDGHUSODQVIRULPSURYHPHQWVWR,ZLWKH[SHFWHGLPSURYHPHQWVWRWKH LQWHUFKDQJHWREHDFFRPSOLVKHGSULRUWR7KHWLPLQJZLOOGHSHQGXSRQ6WDWH DSSURYDOV DQGIXQG LQJ 2QFH LPSOHPHQWHG WKH LQWHUFKDQJH LPSURYHPHQWV DUH H[SHFWHG WRUHOLHYH D PDMRUWUDIILFE RWWOHQHFN DQG LPSURYH VDIHW\ E\ VHSDUDWLQJ DXWRVIURPKHDY\WUXFNWUDIILF 7UDQVSRUWDWLRQDQG7UDIILF 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW Railroads 5DLOURDGV LQDQGWKURXJK9HUQ RQ LQFOXGH VHYHUDO UDLO OLQHV PDQ\ZLWK DWJUDGH UDLOURDGFURVVLQJVORFDWHGWKURXJKRXWWKH&LW\WKDWDIIHFWWUDIILFIORZ6HYHUDOUDLO \DUGVDUH DOVR ORFDWHGZLWKLQ WKH&LW\OLPLWV7KH ODUJHVWLV WKH+REDUW5DLO<D UG ORFDWHGWRWKHQRUWKHDVWEHWZHHQ(DVWWK6WUHHWDQG(DVW:DVKLQJWRQ%RXOHYDUG 7ZRRWKHUVPDOOHU\DUGVDUHWKH0DODEDU<DUGORFDWHGQRUWKRI)UXLWODQGDQGHDVWRI 3DFLILF%RXOHYDUGDQGWKH /RV$QJHOHV-XQFWLRQ<DUGORFDWH GEHWZHHQ([FKDQJH %RXOHYDUGDQGWKH/RV$QJHOHV5LYHU$SR UWLRQRIWKH8QLRQ3DFLI LF(DVW<DUGLV DOVR ORFDWHG LQ9H UQRQ ZLWK RWKHU UDLO \DUGV QHDUE\ EXW RXWVLGH RI 9HUQRQ FLW\ OLPLWV Public Transit 3XEOLFWUDQVLWSULPDULO\IXQFWLRQLQJDVDQDOWHUQDWLYHPRGHRIWUDQVSRUWDWLRQWRDQG IURPWKHZRUNSODFHLVDYDLODEOHLQ9HUQRQ7KH&LW\LVVHUYH GE\DQXPEHURIE XV URXWHVRSHUDWHGE\WKH/RV$QJHOHV&RXQW\0HWURSROLWDQ7UDQVSRUWDWLRQ$XWKRULW\ 0HWUR7KHVHEXVURXWHVUXQRQ6RWR6WUHHW9HUQRQ3DFLILF6DQWD)H$YHQXH DQG 9HUQRQ/HRQLV DQGDOVR 'RZQH\9HUQRQ%R\OH ,QDGG LWLRQWKH 0RQWHEHOOR 0XQLFLSDO%XV/LQHSURYLGHVDURXWHWKDW UXQVRQ:DVKLQJWRQ%RXOHYDUGZLWKVWRSV DW$WODQWLFDQGDW'RZQH\ 7KH0HWUR5DLO%OXH/LQHOLJKWUDLOV\VWHPKDVDVWDWLRQDW 9HUQRQDQG$ODPHGD ZKLFKLVORFDWHGDSSUR[LPDWHO\RQHTXDUWHUPLOHZHVWRIWKH&LW\ERXQGDU\ Existing Traffic Conditions ,QDQH[WHQVLYHWXUQLQJPRYHPHQWDQGWUDIILFFRXQWFROOHFWLRQSURJUDPZDV XQGHUWDNHQDWNH\LQWHUVHFWLRQVLQWKH&LW\RI9HUQRQ,QWHUVHFWLRQFDSDFLW\ZDV VWXGLHGDWSHDNKRXUV7RDVVHVVLQWHUVHFWLRQFDSDFLW\WXUQLQJPRYHPHQWYROXPHV DWDWRWDORILQWHUVHFWLRQVLQWKH&LW\ZHUHFRXQWHGGXULQJPRUQLQJ$0WR $0DQGHYHQLQJSHDNSHULRGV30WR30 $ SDVVHQJHU FDUHT XLYDOHQW 3&( IDFWRU RIZDVDSSOLHGWRWUX FN WXUQLQJ PRYHPHQWV7KH3&(IDFWRUUHIOHFWVWKHIDFWWKDWKHDY\WUXFNVQRWRQO\RFFXS\WZR WRWKUHHWLPHVDVPXFKSK\VLFDOVSDFHDVSDVVHQJHUFDUVDQGSLFNXSWUXFNVEXW WKH\DOVRWDNHWZRWRWKUHHWLPHVDVORQJDVSDVVHQJHUYHKLFOHVWRDFFHOHUDWHDQG WKHUHIRUHKDYHDJUHDWHULPSDFWRQWKHURDGZD\FDSDFLW\7KH3&(IDFWRUXVHGLQ WKHWUDIILFDQDO\VLVZDVGHULYHGIURPLQGXVWU\VWDQGDUGVRI3&(IRU ODUJHWZR D[OHWUXFNVDQG3&(IRUWKUHHRUPRUHD[OHWUXFNV 3HDNKRXULQWHUVHFWLRQFDSDFLW\XWLOL]DWLRQ,&8YDOXHVIR UH[LVWLQJFRQGLWLRQVDUH VXPPDUL]HGLQ7DEOH3HDNKRXUWXUQLQJPRYHPHQWYROXPHVDUHLOOXVWUDWHG DQG,&8FDOFXODWLRQZRUNVKHHWVDUHVKRZQLQWKHWUDIILFVWXG\LQ$SSHQGL[&$VWKH WDEOHLQGLFDWHVILIWHHQVWXG\LQWHUVHFWLRQVRSHUDWHDW/26(RU )DQGWKHUHPDLQLQJ WZRRSHUDWHDWDFFHSWDEOHOHYHOVGXULQJWKH$0DQG30SHDNKRXUV 7UDQVSRUWDWLRQDQG7UDIILF )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH Table 4.4-2 Existing (2012) Intersection Capacity Utilization (ICU) Summary ID #Intersection AM Peak Hour PM Peak Hour Existing V/C Ratio Existing LOS Existing V/C Ratio Existing LOS $ODPHGD6WUHHW16DW D9HUQRQ$YHQXH̺:HVW(: ) ) E9HUQRQ$YHQXH̺(DVW(: ) ) DWK6WUHHW̺:HVW(: ) ) EWK6WUHHW̺(DVW(: ' & 6DQWD)H$YHQXH16DW WKWK6WUHHW(: ) ) WK6WUHHW(: ( ) 9HUQRQ$YHQXH(: ( ( 9HUQRQ$YHQXH3DFLILF %RXOHYDUG(: ( ( 6RWR6WUHHW16DW WK6WUHHW(: ) ) %DQGLQL%RXOHYDUG(: ( ) 9HUQRQ$YHQXH(: ' ( /HRQLV%RXOHYDUG(: ' ' )UXLWODQG$YHQXH(: ' ' %R\OH$YHQXH16DW 6ODXVRQ$YHQXH(: ) ) 'RZQH\5RDG16DW :DVKLQJWRQ%RXOHYDUG(: ' ( %DQGLQL%RXOHYDUG(: ( ( 6ODXVRQ$YHQXH(: ( ( $WODQWLF%RXOHYDUG16DW %DQGLQL%RXOHYDUG(: ) ) 'LVWULFW%RXOHYDUG(: ' ( Threshold for Determining Significance )RU WKH SXUSRVH RI WKLV6X SSOHPHQWDO (,5DVLJQL ILFDQW LPSDFWZLOO RFFXU LI LPSOHPHQWDWLRQRIWKHSURMHFWZRXOG $ &RQIOLFWZLWKDQDSSOLFDEOHSODQRUGLQDQFHRUSROLF\HVWDEOLVKLQJPHDVXUHVRI HIIHFWLYHQHVV IRU WKH SHUIRUPDQFH RI WKH FLUFXODWLRQ V\VWHP WDNLQJ LQWR DFFRXQWDOOPRGHVRIWUDQVSRUWDWLRQLQFOXGLQJPDVVWUDQVLWDQGQRQPRWRUL]HG WUDYHODQGUHOHYDQWFRPSRQHQWVRIWKH FLUFXODWLRQV\VWHPLQFOXGLQJEXWQRW OLPLWHG WR LQWHUVHFWLRQV VWUHHWV KLJKZD\V DQGIUHHZD\V SHGHVWULDQ DQG ELF\FOHSDWKVDQGPDVVWUDQVLW % &RQIOLFWZLWKDQDSSOLFDEOHFRQJHVWLRQPDQDJHPHQWSURJUDPLQFOXGLQJEXW QRW OLPLWHG WROH YHO RIVH UYLFH VWDQGDUGV DQGWUDYHOG HPDQG PHDVXUHV RU 7UDQVSRUWDWLRQDQG7UDIILF 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW RWKHUVWDQGDUGVHVWDEOLVKHGE\WKHFRXQW\FRQJHVWLRQPDQDJHPHQWDJHQF\ IRUGHVLJQDWHGURDGVRUKLJKZD\V 7KH&LW\RI9HUQRQKDVHVWDEOLVKHGDQLQWHUVHFWLRQFDSDFLW\SHUIRUPDQFHVWDQGDUG RIIRUSHDNKRXULQWHUVHFWLRQRSHUDWLRQLPSDFWV7KLVVWDQGDUGPHDQVWKDWDQ LQWHUVHFWLRQLVRSHUDWLQJDWSHUFHQW RILWVFDSDFLW\FRUUHVSRQGLQJWR/26'LV DFFHSWDEOH,IWKHSURMHFWZH UHWRFDXVHDQLQWHUVHFWLRQWRRS HUDWHDW/26(RU) WKDWZRXOGEHFRQVLGHUHGDVLJQLILFDQWLPSDFW,QDGGLWLRQEDVHGRQWKH/RV$QJHOHV 'HSDUWPHQW RI7UDQ VSRUWDWLRQ 3ROLFLHV DQG 3URFHGXUHV DQ LPSDFW LVFRQVLGHUH G VLJQLILFDQWLIWKHSURMHFWUHODWHGLQFUHDVHLQWKH9&UDWLRLQ FUHDVHVE\RUPRUH IRU/26&LQWHUVHFWLRQVE\IRU/26'LQWHUVHFWLRQVDQGIRU/26(DQG) LQWHUVHFWLRQV Environmental Impacts Impacts 4.4.A and 4.4.B Circulation System Performance 7KH FHUWLILHG*HQH UDO 3ODQ( ,5 IRXQG WKDW LPSDFWV WR WKH ORFDODQG UHJLRQDO FLUFXODWLRQV\VWHPZRXOGEHVLJQLILFDQWDQGXQDYRLGDEOH7KHFHUWLILHG*HQHUDO3ODQ (,5 DQDO\VLVLGHQW LILHV SK\VLFDO LPSURYHPHQWV WR D QXPEHU RIURDGZ D\V WKDW ZLOO LPSURYH ORFDODQG UHJLRQDO WUDIILFIORZ LQFOXGLQJ WKH WK 6WUHHWH[WHQ VLRQ WKH $WODQWLF%RXOHYDUG%ULGJHZLGHQLQJWKH6RWR6WUHHWZLGHQLQJDQG,QWHUVWDWH LPSURYHPHQWV 7KHFHUWLILH G *HQHUDO 3ODQ (,5 DOVR UHIHUHQFHV &LUFXODWLRQDQ G ,QIUDVWUXFWXUH(OHPHQW3ROLF\&,DQG0LWLJDWLRQ0HDVXUH7WKDWUHFRPPHQGV LQVWDOODWLRQDQGPDLQWHQDQFHRIDQ,QWHOOLJHQW7UDQVSRUWDWLRQ6\VWHP,76VXFKDV WKH/RV$QJHOHV&RXQW\$XWRPDWHG7UDIILF6XUYHLOODQFHDQG&RQWURO$76$&V\VWHP WKDWZLOOLPSURYHWUDIILFIORZ,PSOHPHQWDWLRQRIWKHVHLPSURYHPHQWVLVDQWLFLSDWHG WR LQFUHDVH FLUFXODWLRQ V\VWHP SHUIRUPDQFH DW WKHPDM RULW\ RIL QWHUVHFWLRQV H[FOXGLQJ6DQWD)HDW WK6RWRDW)UXLWODQGDQG$WODQWLFDW%DQGLQL0LWLJDWLRQ ZDVDOVRLQFRUSRUDWHGWRIXUWKHUUHGXFHSRWHQWLDOFLUFXODWLRQV\VWHPLPSDFWVUHODWHG WRFRRUGLQDWLQJZLWKDGMDFHQWMXULVGLFWLRQVDJHQFLHVDQGUDLOFRPSDQLHVPLQLPL]LQJ SDUNLQJLQWHUIHUHQFH'XHWRWKHODFNR IULJKWRIZD\WRPDNHDGGLWLRQ DOSK\VLFDO LPSURYHPHQWVODFNRIORFDOFRQWURORYHUUHJLRQDOV\VWHPHOHPHQWVDQGXQFHUWDLQW\ LQIXQGLQJLPSDFWVWRWKHORFD ODQGUHJLRQDOFLUFXODWLRQV\VWHPUHPDLQVLJQLILFDQW DQGXQDYRLGDEOHDIWHUFRQVLGHUDWLRQRI*HQHUDO 3ODQSROLFLHVDQGLQFR USRUDWLRQ RI PLWLJDWLRQ 7KHWUDIILFVWXG\SUH SDUHGIRUWKLV6XSSOHPHQWDO(,5LQFOXGHVXSGDWHGDQDO\VLVRI WKHH[LVWLQJ*HQHUDO3ODQDQGWKH*HQHUDO3ODQXSGDWHEDVHGRQH[LVWLQJFRQGLWLRQV WKURXJK ,PSDFWVIUR P WKH LQFOXVLRQ RIWKHSURSR VHG 7UXFN DQG )UHLJKW 2YHUOD\DQG WKHUHFHQ WO\ DGRSWHG +RXVLQJ (OHPHQW5HVLGHQWLDO2YHUOD \ FDQWKHQEHFRPSDUHGWRWKHDQDO\VLVSURYLGHGLQWKHFHUWLILHG*HQHUDO3ODQ(,5WR GHWHUPLQHLILPSDFWVZLOOEHHTXDOWRRUOHVVWKDQWKRVHGHWHUPLQHGLQWKHDQDO\VLV $GGLWLRQDOO\DTXDOLWDWLYHGLVFXVVLRQRIWKHH[SDQGHG&RPPHUFLDO2YHUOD\KDVEHHQ LQFOXGHG7KH6ODXJKWHULQJDQG5HQGHULQJ2YHUOD\VDUHQRWGLVFXVVHGEHFDXVHWULS JHQHUDWLRQ IURPWKH VH XVHVLVWKHVDPH DV WKHXQGHUO\LQJ ,QGXVWULDO ODQGXVH GHVLJQDWLRQ 7UDQVSRUWDWLRQDQG7UDIILF )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH 7UXFNDQG)UHLJKW2YHUOD\ 7DEOH<HDU,QWHUVHFWLRQ&DSDFLW\8WLOL]DWLRQ,&86XPPDU\LQFOXGHV XSGDWHG SURMHFWLRQV IRUEDVHGRQFX UUHQW *HQ HUDO 3ODQD QG =RQLQJ GHYHORSPHQW DVVXPSWLRQV WRX SGDWH ZKDW LQWHUVHFWLRQV DUH DOUHDG\ SURMHFWHG WR RSHUDWHDWXQDFFHSWDEOHOHYHOVZLWKRXWWKH SURSRVHGXSGDWHV2ISDUWLFXODUQR WH RQHLQWHUVHFWLRQ$ODPHGDDQG9HUQRQZHVWZRXOGEHSURMHFWHGWRRSHUDWHDW/26 (RU)LQDWRQHRUPRUHSHDNKRXUSHULRGVWKDWZDVQRWSUHYLRXVO\SURMHFWHG WR RSHUDWHDW/26 ( RU ) LQ DW DQ\ SHULRG $W VRPH LQWHUVHFWLRQV WKH SURSRVHGXSGDWHZLOOLPSURYHSHDNKRXUWU DIILFFRQGLWLRQVLQZKHQFRPSDUHG WRWKHFXUUHQW*HQHUDO3ODQWUDIILFIRU 7KHWUDIILFDQDO\VLVLQGLFDWHVWKDWWKHSU RSRVHG7UXFNDQG)UHLJKW2 YHUOD\ZLOOQRW VLJQLILFDQWO\LQFUHDVHLPSDFWVDWDQ\RIWKHVWXG\LQWHUVHFWLRQVEHFDXVHWKHYROXPH FDSDFLW\UDWLRZLOOQRWLQFUHDVHE\DWDQ\/26'LQWHUVHFWLRQVRUE\DWDQ\ /26(RU/26)LQWHUVHFWLRQV7KHUHIRUHLPSDFWVZLOOUHPDLQFRQVLVWHQWZLWKWKH DQDO\VLVSURYLGHGLQWKHFHUWLILHG*HQHUDO3ODQ(,5DVsignificant and unavoidable DIWHUFRQVLGHUDWLRQRI*HQHUDO3ODQSROLF\DQGPLWLJDWLRQLQFRUSRUDWLRQ 7UDQVSRUWDWLRQDQG7UDIILF6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUWTable 4.4-3 Year 2035 Intersection Capacity Utilization (ICU) Summary ID#Intersection Peak Hour Current General Plan Proposed General PlanProjectImpactfrom Current GP2035 V/C 2035 LOS2035 V/C 2035 LOS$ODPHGD6WUHHW16D9HUQRQ$YHQXH̺:HVW(:0RUQLQJ) ) (YHQLQJ) ) E9HUQRQ$YHQXH̺(DVW(:0RUQLQJ) ) (YHQLQJ) ) DWK6WUHHW̺:HVW(:0RUQLQJ) ) (YHQLQJ) ) EWK6WUHHW̺(DVW(:0RUQLQJ' ' (YHQLQJ' ' 6DQWD)H$YHQXH16WKWK6WUHHW(: 0RUQLQJ( ( (YHQLQJ) ) WK6WUHHW(: 0RUQLQJ) ) (YHQLQJ) ) 9HUQRQ$YHQXH(: 0RUQLQJ) ) (YHQLQJ) ) 7UDQVSRUWDWLRQDQG7UDIILF)RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWHID#Intersection Peak Hour Current General Plan Proposed General PlanProjectImpactfrom Current GP2035 V/C 2035 LOS2035 V/C 2035 LOS9HUQRQ$YHQXH3DFLILF%RXOHYDUG(: 0RUQLQJ) ) (YHQLQJ) ) 6RWR6WUHHW16WK6WUHHW(: 0RUQLQJ) ) (YHQLQJ) ) %DQGLQL%RXOHYDUG(: 0RUQLQJ) ) (YHQLQJ) ) 9HUQRQ$YHQXH(: 0RUQLQJ( ) (YHQLQJ) ) /HRQLV%RXOHYDUG(: 0RUQLQJ( ( (YHQLQJ' ' )UXLWODQG$YHQXH(: 0RUQLQJ' ' (YHQLQJ( ( %R\OH$YHQXH166ODXVRQ$YHQXH(: 0RUQLQJ ) ) (YHQLQJ ) ) 'RZQH\5RDG16:DVKLQJWRQ%RXOHYDUG(: 0RUQLQJ( ( 7UDQVSRUWDWLRQDQG7UDIILF6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUWID#Intersection Peak Hour Current General Plan Proposed General PlanProjectImpactfrom Current GP2035 V/C 2035 LOS2035 V/C 2035 LOS(YHQLQJ) ) %DQGLQL%RXOHYDUG(: 0RUQLQJ( ) (YHQLQJ) ) 6ODXVRQ$YHQXH(: 0RUQLQJ) ) (YHQLQJ) ) $WODQWLF%RXOHYDUG16%DQGLQL%RXOHYDUG(: 0RUQLQJ) ) (YHQLQJ) ) 'LVWULFW%RXOHYDUG(: 0RUQLQJ( ( (YHQLQJ) ) 6RXUFH.XQ]PDQ$VVRFLDWHV 7UDQVSRUWDWLRQDQG7UDIILF)RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH 7UDQVSRUWDWLRQDQG7UDIILF 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW &RPPHUFLDO2YHUOD\ 7KHSURMHFWLQFOXGHVDQLQFUHDVHLQWKH&RPPHUFLDO2YHUOD\GLVWULFWIURPDFUHV WR DFUHV7KH&RPPHUFLDO2YH UOD\ GLVWULFW KDVDOVREHHQIXUWK HU UHILQHG WKURXJK WKH&D QG & 2YHUOD\ =RQHV 7KH &RPPHUFLDO 2YHUOD\GLVWULFW LV LQWHQGHG WR SURYLGH RSSRUWXQLWLHV IRUVHUYLFH DQG UHWDLOXVHVWK DW VXSSRUW VXUURXQGLQJLQGXVWULDOXVHV,WPXVWEH HPSKDVL]HGWKDWWKH&RPPHUFLDO2YHUOD\ GLVWULFWLV QRWLQWHQGHGQRUDQWLFLSDWHGWRVXEVWDQWLDOO\FRQYHUWLQGXVWULDOXVHV WR FRPPHUFLDO XVHV 7KH&RP PHUFLDO 2YHUOD\ GLVWULFWDQG DVVRFLDWHG ]RQLQJLV GHVLJQHG WR HVWDEOLVK XVHD QG GHYHORSPHQW VWDQGDUGV IRU IXWXUHFRPPHUFLDO GHYHORSPHQW EXWLVQRW GHVLJQHG WRHQFRX UDJH RU LQFUHDVH FRPPHUFLDO GHYHORSPHQW7KHHQWLUHW\RIWKH3ODQQLQJ$UHDLVSODQQHGWRUHPDLQLQGXVWULDORYHU WKHORQJWHUP &RPPHUFLDOXVHVJHQHUDWHVXEVWDQWLDOO\PRUHWUDIILFWKDQLQGXVWULDOXVHV%DVHGRQ WKH ,QVWLWXWHRI7UDQVSR UWDWLRQ (QJLQHHU¶V,7 (7ULS *HQHUDWLRQ PDQXDO ZDUHKRXVLQJDQGPDQXIDFWXULQJXVHVJHQHUDWHWRGDLO\WULSVSHU VTXDUHIHHWRIEXLOGLQJDUHDUHVSHFWLYHO\DQGZLWKRXWFRQVLGHUDWLRQRI3&(IDFWRUVLL &RPPRQ FRPPHUFLDO GHYHORSPHQW WKDWFR XOG EHFRQVWUXFWHGLQWKH&RPPHUFLDO 2YHUOD\GLVWULFWVXFKDVVWULSUHWDLOVKRSSLQJFHQWHUVJDVVWDWLRQVDQGIDVWIRRG HVWDEOLVKPHQWVJHQHUDWHEHWZHHQDQGGDLO\ WULSVSHUVTXDUH IHHW &RPPHUFLDO GHYHORSPHQW DFFRXQWVIR U DSSUR[LPDWHO\ SHUFHQ W RIWKH GHYHORSPHQW LQWKH3ODQQLQJ $UHD DFUHV DFUHV SHUFHQW &RPPHUFLDO GHYHORSPHQW RYHUWKHORQJWHUPLVD QWLFLSDWHG WR UHPDLQ DWVLPLODU OHYHOVFRQVLGHULQJWKHSURSRVHG*HQHUDO3ODQXSGDWHVXSSRUWVSULPDULO\ LQGXVWULDO XVHV7KHUHIRUHFRPPHUFLDOGHYHORSPHQWZLOOQRWJHQHUDWHDVXEVWDQWLDODPRXQW RIWUDIILFZKHQFRPSDUHGWRWKH3ODQQLQJ$UHDDVDZKROHHYHQDIWHUFRQVLGHUDWLRQ RI WKHLQ FUHDVH LQ WULSJHQ HUDWLRQ UDWHV )XUWKHUPR UH IXWXUHFRPPHUFLDO GHYHORSPHQWV ZLOOEH VXEMHFWWRHQYLURQ PHQWDO UHYLHZ SXUVXDQWWRWK H &DOLIRUQLD (QYLURQPHQWDO 4XDOLW\ $FW&( 4$ )XW XUH FRPPHUFLDO GHYHORSPHQW WKDW FRXOG VLJQLILFDQWO\DIIHFWWKHORFDODQGRUUHJLRQDOFLUFXODWLRQV\VWHPZLOOEHUHTXLUH GWR LQFRUSRUDWHPLWLJDWLRQZKHUHIHDVLEOHWRHOLPLQDWHUHGXFHR UPLQLPL]HSURMHFW OHYHO WUDIILF LPSDFWV &RQVLG HULQJ WKH UHODWLYHO\ VPDOOD PRXQW RIORQJWH UP FRPPHUFLDO GHYHORSPHQW DQWLFLSDWHG LQ WKH 3ODQQLQJ $UHD DQGWK H VWDQGDUG HQYLURQPHQWDOUHYLHZUHTXLUHPHQWVRIWKH&LW\LPSDFWVWR WKHORFDODQGUHJLRQDO FLUFXODWLRQV\VWHPGXHWRWKHH[SDQVLRQRIWKH&RPPHUFLDO2YHUOD\GLVWULFWZLOOQRW EHVXEVWDQWLDOZKHQFRPSDUHGWRWKHDQDO\VLVSURYLGHGLQWKHFHUWLILHG*HQHUDO3ODQ (,5,PSDFWVUHPDLQsignificant and unavoidable. 7UDQVSRUWDWLRQDQG7UDIILF )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH MITIGATION T-1 MITIGATION T-2 MITIGATION T-3 MITIGATION T-4 MITIGATION T-5 MITIGATION T-6 Mitigation Measures 7KHIROORZLQJPLWLJDWLRQPHDVXUHVZHUHLQFRUSRUDWHGZLWKWKHFHUWLILHG*HQHUDO3ODQ (,5DQGUHPDLQDSSOLFDEOHWRWKHSURSRVHG*HQHUDO3ODQXSGDWH Automated Traffic Surveillance and Control System (ATSAC). &RQGXFWDVWXG\WRGHWHUPLQHLI$76$&ZRXOGEHD EHQHILFLDODQGFRVWHIIHFWLYHV\VWHPIRUWKH&LW\WR RSHUDWHDQG PDLQWDLQ Coordinate with Adjacent Jurisdictions. &RQWLQXH WR FRRUGLQDWH LQWHUVHFWLRQ PDLQWHQDQFH DQG LPSURYHPHQWV ZLWK DGMDFHQW MXULVGLFWLRQV VR WKDW LQWHUVHFWLRQV DORQJ 6RWR 6WUHHW 3DFLILF %RXOHYDUG 6ODXVRQ $YHQXH $ODPHGD 6WUHHW $WODQWLF %RXOHYDUG%DQGLQL%RXOHYDUGDQG'RZQH\5RDGR SHUDWHDWDQ DFFHSWDEOH/HYHORI6HUYLFH Coordinate with Rail Companies. &RRUGLQDWH ZLWKUDLOU RDG FRPSDQLHVLQUHPRYLQJREVROHWHUDLOVSXUV:RUNWRPLQLPL]H WUDIILF LPSDFWV WR&LW\ VWUHHWV IURP WUXFNV XVLQJ +REDUW< DUG IDFLOLWLHVDQGRWKHUPXOWLPRGDOWUDQVSRUWDWLRQ\DUGV Coordination with Metropolitan Transportation Authority. :RUNZLWKWKH0HWURSROLWDQ7UDQVSRUWDWLRQ$XWKRULW\0HWURWR DFKLHYHWKHIROORZLQJ ,PSOHPHQWWKH0HWUR¶V&RQJHVWLRQ0DQDJHPHQW3ODQ&03 ZLWKLQWKH&LW\ &RQWLQXHWRSURYLGH ORFDODQGUHJLRQDOFRQQHFWLRQVWKURXJK 0HWURORFDODQGUDSLGEXVOLQHV ,PSURYHDFFHVVWRORFDO0HWURVWDWLRQV Minimize Parking Impacts. :RUNZLWKEXVLQHVVHVWRGHYHORS FUHDWLYHVWUDWHJLHVDQGVROXWLRQVWRDGGUHVVSDUNLQ JVKRUWDJHV 5HTXLUH QHZ GHYHORSPHQW SURMHFWV WR PHHWWK H PLQLPXP SDUNLQJVWDQGDUGVLQWKH=RQLQJ2UGLQDQFHIRUERWKWUXFNVDQG DXWRPRELOHVLQFOXGLQJWUXFNWUDLOHUVWRUDJHHPSOR\HHSDUNLQJ DQGYLVLWRUSDUNLQJ Soto Street Widening. $W WKH WLPH SURSHUWLHV DORQJ6R WR 6WUHHWDUHUHGHYHORSHGRUDVRWKHUZLVHGLFWDWHGE\&LW\SODQVIRU WKHZLGHQLQJRI6RWR6WUHHWUHTXLUHWKHGHGLFDWLRQRIULJKWVRI ZD\WRDFKLHYHWKHURDGVWDQGDUGIRU6RWR6WUHHWHVWDEOLVKHGLQ 7UDQVSRUWDWLRQDQG7UDIILF 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW MITIGATION T-7 MITIGATION T-8 WKH&LUFXODWLRQDQG,QIUDVWUXFWXUH(OHPHQW&RPSOHWHWKHURDG ZLGHQLQJSURMHFWDWWKHWLPHD GHTXDWHULJKWVRIZD\KDYHEHHQ DFTXLUHGDQGRUGHGLFDWHG Interstate 710 Freeway Improvements. :RUNZLWK&DOWUDQV RQ DOOSOD QV DFWLYLWLHVDQGS URMHFWV UHJDUGLQJ ,QWHUVWDWH WKDWPD\GLUHFWO\LPSDFW9HUQRQ¶VURDGZD\IDFLOLWLHVDQGWUDIILF SDWWHUQV &RRUGLQDWH ZLWKW KH *DWHZD\ &LWLHV&RXQFLOR I *RYHUQPHQWV DQG6RXWKHUQ&DOLIRUQLD$VVRFLDWLRQ RI *RYHUQPHQWV RQVWXGLH V DQG SURJUDPV UHJDUGLQJ WKH LPSURYHPHQWVWRWKH,IUHHZD\ Other Improvements. $W6DQWD)H$YHQXHDQGWK6WUHHW VWULSHDQHDVWERXQGOHIWWXUQODQHZLWKLQH[LVWLQJULJKWRIZD\WR SURYLGHDGGLWLRQDOLQWHUVHFWLRQFDSDFLW\ Level of Impact after Mitigation ,PSDFWV WRWKHOR FDO DQGUHJLRQDO&RQ JHVWLRQ 0DQDJHPHQW 3URJUDP FLUFXODWLRQ V\VWHPUHPDLQsignificant and unavoidableDIWHUPLWLJDWLRQLQFRUSRUDWLRQ References .XQ]PDQ$VVRFLDWHV &LW\RI 9HUQRQ*HQHUDO3 ODQ 8SGDWH 7UDIILF,PSDFW$QDO\VLV 'HFHPEHU LL,QVWLWXWHRI7UDQVSRUWDWLRQ(QJLQHHUV7ULS*HQHUDWLRQWK(GLWLRQ 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW Utilities and Service Systems 4.5 7KLV VHFWLRQ RI WKH 6XSSOHPHQWDO (,5 H[DPLQHV SRWHQWLDO LPSDFWV WR XWLOLWLHV DQG VHUYLFH V\VWHPV GXH WRFKD QJHV WRWKH*HQHUDO3ODQD QG =RQLQJ &RGHDQG DVVRFLDWHGFKDQJHVWRWKHFHUWLILHG3URJUDP(,57KH,QLWLDO6WXG\FR QFOXGHGWKDW WKHDGRSWLRQDQGORQJWHUPLPSOHPHQWDWLRQRIWKH9HUQRQ*HQHUDO3ODQXSGDWHGRHV QRWKDYHWKHSRWHQ WLDOWRH[FHHGZDVWHZDWHUWUHDWPHQWUHTXLUHPHQWVUHTXLUHWKH FRQVWUXFWLRQRUH[SDQVLRQRIZ DWHUZDVWHZDWHURUVWRUPZDWHUGUDLQDJHIDFLOLWLHV ,PSOHPHQWDWLRQ RIW KH *HQHUDO 3ODQXSG DWH ZLOODOVRKDYHD GHTXDWH FDSDFLW\ WR VHUYHWKHSURMHFWHGGHPDQGDQGFRPSO\ZLWKIHGHUDOVWDWHDQGORFDOVWDWXWHVDQG UHJXODWLRQVUHODWHGWRVROLGZDVWH7KH,Q LWLDO6WXG\LQGLFDWHGWKDWLPSDFWVUHODWHG WRZDWHUVXSSO\VXIILFLHQF\DQGODQGILOOFDSDFLW\FRXOGEHSRWHQWLDOO\VLJQLILFDQWDQG KDYHEHHQDQDO\]HGKHUHLQ Environmental Setting Water Supply 7KH FHUWLILHG*HQHUD O 3ODQ(, 5 UHIHUHQFHG 8 UEDQ :DWHU0DQDJHP HQW 3ODQV 8:03IRUZDWHUVXSSO\DQDO\VLV6LQFHWKHSUHSDUDWLRQRIWKHFHUWLILHG(,5WKH 8:03VKDYHEHFRPHDYDLODEOH 7KH IUHVK ZDWHU UHWDLOHU IRU PRVW RIWKH &LW\RI9 HUQRQ LVW KH&LW\¶V RZQ:DWH U 'HSDUWPHQW$SRUWLRQRIWKH QRUWKHDVWSDUWRIWKH &LW\KRZHYHUUHFHLYHVZDWH U VHUYLFHIURPWKH&DOLIRUQLD:DWHU6HUYLFH&RPSDQ\&DO:DWHUDQGDVPDOODUHDLQ WKH VRXWKHDVW SDUWRI9HUQR Q KDVZDWHUGHOLYHUHGE\0D \ZRRG 0XWXDO :DWHU &RPSDQ\1XPEHU 7KH :DWHU'HSDUWP HQW RIWKH &LW\ RI 9HUQRQ UHFHLYHV SHUFHQWRI LWVSULP DU\ SRWDEOH ZDWHUVXSS O\ IURP ORFDO ZDWHU ZLWKWKH EDODQFH FRQVLVWLQJ RILPSR UWHG ZDWHUDQGUHF\FOHGZDWHU$WWKHWLPHWKHFHUWLILHG*HQHUDO3ODQ(,5ZDVSUHSDUHG WKH 8UEDQ:DWHU0DQDJHPHQW3ODQZDV UHIHUHQFHG 6LQFHWKHQWKH 8UEDQ:DWHU0DQDJHPHQW3ODQIRU9HUQRQKDVEHHQSUHSDUHG$VRIWKH&LW\ UHFHLYHGDSSUR[LPDWHO\SHUFHQWRILWV ZDWHUVXSSO\IURPORFDOJURXQGZDWHUDQG DSSUR[LPDWHO\SHUFHQWIURPWKH&HQWUDO%DVLQ0XQLFLSDO:DWHU'LVWULFW&%0:' 3RWDEOHZDWHULVVROGDQGGLVWULEXWHGWR9HUQRQE\WKH&%0:'DSXEOLFDJHQF\WKDW DFWVDVDZKROHVDOHUWRUHWDLOZDWHUDJHQFLHVFRQVLVWLQJRIFLWLHVLQVRXWKHDVW/RV $QJHOHV&RXQW\7KH&%0:' LQWXUQS XUFKDVHVLWVZDWHUIU RPWKH0HWURSROLWDQ :DWHU 'LVWULFW RI 6RXWKHUQ &DOLIRUQLD 0:' ZKLFK LV WKH PDMRU VXSSOLHU IRU 6RXWKHUQ&DOLIRUQLD 7KH&LW\¶VZDWHUGLVWULEXWLRQV\VWH PFRQVLVWVRIOLQHDUIHHWRISLSHQLQH ZHOOV VHYHQJURXQG OHYHO UHVHUYRLUV RQH HOHYDWHG WDQN DQG DEHORZJURXQ G UHVHUYRLU 7KHWRW DO VWRUDJH FDSDFLW\ LV PLOOLRQ JDOORQV 9HUQRQ¶V GLUHFW LQWHUFRQQHFWLRQ WR WKH 0:' SURYLGHV ERWK DVX SSOHPHQWDO ZDWHU VRXUFH DQG DQ HPHUJHQF\VXSSO\LQ WKHHYHQWRIDPDMRUSRZHURXWDJH7KHDYHUDJ HSUHVVXUHLQ WKHGLVWULEXWLRQV\VWHPVLVDERXWSRXQGVSHUVTXDUHLQFKSVL 8WLOLWLHVDQG6HUYLFH6\VWHPV )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH &DO:DWHU¶V(DVW/RV$QJHOHV'LVWULFWVHUYHVUHVLGHQWLDOLQGXVWULDODQGFRPPHUFLDO FXVWRPHUVLQFOXGLQJDOORIXQLQFRUSRUDWHG(DVW/RV$QJHOHVDVZHOODVSRUWLRQVRI WKHFLWLHVRI&RPPHUFH0RQWHEHOOR0RQWHUH\3DUNDQG9HUQRQ7KDW SRUWLRQRI 9HUQRQZLWKLQ&DO:DWHU¶VMXULVGLFWLRQFRQVLVWVRIWKHDUHDQRUWKRIWKH/RV$QJHOHV 5LYHU DQG HDVWRID OLQH SDUDOOHO WRDQG DSSUR[LPDWHO\ IHHW ZHVW RI ,QGLDQD 6WUHHW7KLVDUHDLVGRPLQDWHGE\%XUOLQJWRQ1RUWKHUQ6DQWD)H¶V+REDUW5DLO<DUG ,QLQGXVWULDOXVHVDFFRXQWHGIRURQO\XVHUVRUSHUFHQWRI&DO:DWHU¶V (DVW /RV $QJHOHV 'LVWULFW VHUYLFH FRQQHFWLRQV DOWKRXJKEH FDXVH RI WKHKLJKHU GHPDQGSHUFRQQHFWLRQIRULQGXVWULDOFXVWRPHUVWKHVHLQGXVWULDOXVHVDFFRXQWHGIRU WRWDODFUHIHHWSHUFHQWXVHGGLVWULFWZLGHGXULQJWKH\HDU9HUQRQ¶V VKDUHRIZDWHUXVDJHLQWKH'LVWULFWFRQVWLWXWHVDQXQNQRZQEXWVLJQLILFDQWIUDFWLRQ RI WKHVHLQGXVWULDOFRQQHFWLRQV'XULQJ WKH WHQ\HDU SHULRG IURP WR WRWDOZDWHUGHPDQGLQWKH'LVWULFWUR VHDQDYHUDJHRISHUFHQWDQQXDOO\ZKLOH LQGXVWULDOZDWHUGHPDQGLQWKH'LVWULFWIHOODQDYHUDJHRISHUFHQWHDFK\HDU :DWHU IXUQLVKHG WR FXVWRPHUV RI&DO :DWHU¶V (DVW/RV$ QJHOHV 'LVWULFW LVD FRPELQDWLRQRIJURXQGZDWHUDQGSXUFKDVHGZDWHULPSRUWHGIURPWKH&HQWUDO%DVLQ 0XQLFLSDO:DWHU'LVWULFW2QDYHUDJHSXUFKDVHGZDWHUVDWLVILHVWRSHUFHQWRI WKH'LVWULFW¶VZDWHUUHTXLUHPHQWVZLWKWKHEDODQFHVXSSOLHGE \JURXQGZDWHUIURP &DO:DWHU¶VZHOOV &DO :DWHU¶V H[LVWLQJ VXSSOLHV DQG IDFLOLWLHV LQWKH (DVW/RV$QJHOH V 'LVWULFW DUH DGHTXDWHWRSURYLGHIRUSURMHFWHGGHPDQGWKURXJKWKH\HDU7KH8UEDQ :DWHU 0DQDJHPHQW 3ODQIRU&DO:DWHU¶V(DVW/RV$QJHOHV 'LVWULFW LQGLFDWHVWK DW H[LVWLQJ VXSSOLHV DQG IDFLOLWLHV ZLOOEH DGHTXDWH WRSUR YLGH IRU SURMHFWHG GHPDQG WKURXJK WKH \HDU ,Q DGGLWLRQ DFFRUGLQJ WR WKH 8:03 &DO:D WHU LQWHQGVWRFRQVWUXFWQHZZHOOVLQRUGHUWRPD[LPL]HJURXQGZDWHUSURGXFWLRQLQWKH IXWXUH7KH'LVWULFWUHFRJQL]HVWKDWLWVZHOOVDUHQRORQJHUVXIILFLHQWWRSURGXFHLWV HQWLUHDOORZHGSXPSLQJDOORFDWLRQVRLWLVDFWLYHO\SXUVXLQJSODQVWRUHVWRUHVHYHUDO ZHOOVWRWKHLUIXOOFDSDFLW\DQGGHYHORSLQJDQHZZHOOWRDGGFDSDFLW\ 7KH0D\ZRRG0XWXDO:DWHU&RPSDQ\FRYHUVRQO\VPDOOSRUWLRQVRIWKHFLWLHVRI 0D\ZRRG%HOODQG9HUQRQ,QWRWDO0D \ZRRG0XWXDOKDVDSSUR[LPDWHO\ VHUYLFH FRQQHFWLRQV VHUYLQJ DSSUR[LPDWHO\ UHVLGHQWV DORQJZLWKVRP H FRPPHUFLDO DQG LQGXVWULDO FXVWRPHUV 0D\ZRRG 0XWXDO KDV VHUYLFH FRQQHFWLRQVLQ9HUQRQDOOLQGXVWULDOZKLFKLQXVHGDSSUR[LPDWHO\DFUHIHHW RIZDWHU,Q0DWKHVRQ7UL*DVRSHQHGDSODQWLQWKLVDUHDWKDWZDVSURMHFWHG WRXVHDQDGGLWLRQDODFUHIHHWSHU\HDURIZDWHUEXWVLQFHRSHQLQJKDVDFWXDOO\ XVHGPXFKOHVV7KXVWKHGHPDQGLVSURMHFWHGWREHD FUHIHHWSHU\HDUEDVHG RQXVDJHIURPDFWXDOGDWDIURP ,QWRWDOWKHQWKHSDUWRI9HUQRQZLWKLQ 0D\ZRRG0XWXDO:DWHU&RPSDQ\LVSURMHFWHGWRXVHDFUHIHHWRIZDWHUSHU \HDU 0D\ZRRG0XWXDOREWDLQVDOORILWVZDWHUVXSSOLHVIURPWKUHHJURXQGZDWHUZHOOV ORFDWHGLQ0D\ZRRGDQG%HOO7RJHWKHUWKHVHWKUHHZHOOVSURGXFHDSSUR[LPDWHO\ DFUHIHHWRIZDWHUSHU\HDUDOWKRXJKWKHH[DFWDPRXQWIOXFWXDWHVEHWZHHQ DERXW DFUHIHHW DQG DFUHIHHW SHU\HDUGHSH QGLQJ RQ GHPDQG ,I 8WLOLWLHVDQG6HUYLFH6\VWHPV 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW QHFHVVDU\WKHVHZHOOVFRXOGSXPSDVPXFKDVDFUHIHHWSHU\HDU&XUUHQWO\ 0D\ZRRG 0XWXDO SXUFKDVHV QRZDWHUIUR P RXWVLGHVRXUFH V EXWKDVDQ DJUHHPHQWLQSODFHWKDWZRXOG DOORZLWWRSXUFKDVHXSWRDFUH IHHWRIZDWHU SHU\HDUIURP0:',I0D\ZRRG0XWXDOZHUHWRSURGXFHZDWHUDW WKH PD[LPXPUDWHDVZH OODVSXUFKDVHWKHPD[LPXPDPRXQWIURPRXWVLGHVRXUFHVLW FRXOGVXSSO\DVPXFKDVDFUHIHHWRIZDWHULQD\HDUPRUHWKDQIRXUWLPHV FXUUHQW GHPDQG*URXQGZDWHUSURGX FWLRQ LV DGHTXDWH WR PHHW WKH FXUUHQW DQG SURMHFWHGGHPDQGVRI0D\ZRRG0XWXDO:DWHU&RPSDQ\ Solid Waste 6ROLGZDVWHJHQHUDWHGZLWKLQ9HUQRQLVFROOHFWHGE\DYDULHW\RISULYDWHFRPSDQLHV 7KH&LW\GRHVQRWSURYLGHVROLGZDVWHFROOHFWLRQVHUYLFHVEXVLQHVVHVDQGUHVLGHQWV PXVW FRQWUDFW IRUW KHLU RZQ ZDVWHGLV SRVDO &LW\ VWDII PRQLWRUV VROLG ZDVWH JHQHUDWLRQ GLYHUVLRQ DQGGLVS RVDO WR KHOS WKH&LW\FR PSO\ ZLWK VWDWHPDQGDWHG ZDVWHUHGXFWLRQJRDOV&LW\VWDIIDOVRSURYLGHVDVVLVWDQFHWRFRPSDQLHVLQWHUHVWHG LQUHF\FOLQJRUUHGXFLQJZDVWH ,QWR WDOEXVLQHVVHVLQ9HUQRQJHQHUDWHG WRQV RI ZDVWH IRU GLVSRVDO LQ WKH YDULRXV ODQGILOOVLGHQWLILHGLQ 7DEOH 6ROLG :DVWH'LVSRVDO)DFLOLWLHV8VHGE\9HUQRQ:DVWH&RQWUDFWRUV$GGLWLRQDOO\ WKH5HIXVHWR(QHUJ\)DFLOLW\LQWKHFLW\RI&RPPHUFHUHFHLYHGWRQVRIZDVWH IURP9HUQRQWREHFRQYHUWHGLQWRHQHUJ\ Table 4.5-1 Solid Waste Disposal Facilities Used by Vernon Waste Contractors, 2005 Facility Name Location (City, County) Remaining Estimated Capacity (cubic yards; percentage of) Estimated Closure Date Permitted Maximum Disposal (tons/day) Permitted Maximum Disposal (kilo- tons/year) $QWHORSH9DOOH\ 3XEOLF/DQGILOO, 3DOPGDOH /RV$QJHOHV LQ 0LGWR/DWH %UDGOH\/DQGILOO :HVWDQG:HVW ([WHQVLRQ 6XQ9DOOH\ /RV$QJHOHV LQ &KLTXLWD&DQ\RQ 6DQLWDU\/DQGILOO 6DQWD&ODULWD /RV$QJHOHV LQ (O6REUDQWH/DQGILOO&RURQD 5LYHUVLGH LQ )UDQN5%RZHUPDQ 6DQLWDU\/DQGILOO ,UYLQH 2UDQJH LQ 2OLQGD$OSKD 6DQLWDU\/DQGILOO %UHD 2UDQJH LQ 3ULPD'HVKHFKD 6DQLWDU\/DQGILOO 6DQ-XDQ &DSLVWUDQR 2UDQJH LQ 3XHQWH+LOOV/DQGILOO,QGXVWU\ /RV$QJHOHV LQ 6LPL9DOOH\/DQGILOO DQG5HF\FOLQJ &HQWHU 6LPL9DOOH\ 9HQWXUD LQ 6XQVKLQH&DQ\RQ 6\OPDU LQ 8WLOLWLHVDQG6HUYLFH6\VWHPV )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH 6/)&RXQW\ ([WHQVLRQ /RV$QJHOHV 6XQVKLQH&DQ\RQ &LW\/DQGILOO8QLW 6\OPDU /RV$QJHOHV LQ 1$ /DQFDVWHU/DQGILOO DQG5HF\FOLQJ &HQWHU /DQFDVWHU /RV$QJHOHV 3ULPDU\6RXUFH'UDIW(,5$QWHORSH9DOOH\3XEOLF/DQGILOO&83&LW\RI3DOPGDOH'HFHPEHU 2WKHUVLWHV&DOLIRUQLD,QWHJUDWHG:DVWH0DQDJHPHQW%RDUG $VLQGLFDWHGLQWKHWDEOHDOOEXWWZRRIWKHODQGILOOVKDYHVFKHGXOHGFORVXUHGDWHV ZLWKLQ WKH WLPH IUDPH RIWKH *HQHUDO 3ODQ XSGDWH DOWKRXJK 2UDQJH &RXQW\ LV FXUUHQWO\PRYLQJIRUZDUGZLWKH[SDQVLRQSODQVIRUE RWKWKH%RZHUPDQDQG2OLQGD $OSKD ODQGILOOV ZKLFKZRXOG H[WHQG WKH FDSDFLWLHV DQG HIIHFWLYH OLYHV RI WKHVH IDFLOLWLHV 7KURXJKRXW&DOLIRUQLDDQGLQXUEDQDUHDVLQSDUWLFXODUGLPLQLVKLQJODQGILOOVSDFHLVD FRQWLQXLQJFRQFHUQ,QUHVSRQVHWKH&DOLIRUQLD,QWHJUDWHG:DVWH0DQDJHPHQW$FW RI$%ZDVSDVVHGPDQGDWLQJORFDOJRYHUQPHQWVWRGHYHORSDORQJWHUP VWUDWHJ\IRUWKHPDQDJHPHQWDQGGLYHUVLRQRIVROLGZDVWHDQGUHTXLULQJFLWLHVDQG FRXQWLHVWRGLYHUWSH UFHQWRIWKHLUVROLGZDVWHUHODWLYHWRWKHEDVHOLQH\HDU $FFRUGLQJWRWKH6WD WH,QWHJUDWHG:DVWH0DQDJHPHQW%RDUG9HUQRQGLYHUWH G SHUFHQWRILWVZDVWHLQ7KHHVWLPDWHGGLYHUVLRQUDWHIRULVSHUFHQW DQGSHUFHQWIRU Thresholds for Determining Significance )RU WKH SXUSRVH RI WKLV6X SSOHPHQWDO (,5DVLJQL ILFDQW LPSDFWZLOO RFFXU LI LPSOHPHQWDWLRQRIWKHSURMHFWZRXOG $ 1RWKDYHVXIILFLHQWZDWHUVXSSOLHVDYDLODEOHWRVHUYHWKHSURMHFWIURPH[LVWLQJ HQWLWOHPHQWVDQGUHVRXUFHVRUQHZRUH[SDQGHGHQWLWOHPHQWVQHHGHG % 1RWEHVHUYHGE\DODQGILOOZLWKVXIILFLHQWSHUPLWWHGFDSDFLW\WRDFFRPPRGDWH WKHSURMHFW¶VVROLGZDVWHGLVSRVDOQHHGV Environmental Impacts Impact 4.5.A Water Supply 7KHFHUWLILHG*HQHUDO3ODQ(,5IRXQGWKDWLPSDFWVUH ODWHGWRVX IILFLHQWZDWHUVXSSO\ ZLOOEHOHVVWKDQVLJQLILFDQW7KHFHUWLILHG*HQHUDO3ODQ(,5DQDO\VLVLQGLFDWHVWKDW QHZGHYHORSPHQWZLOOUHSODFHROGHUOHVVHIILFLHQWEXLOGLQJVLQWKHEXLOWRXWFLW\ZLWK PRGHUQ EXLOGLQJV XVLQJPRUHHIILFLHQWSOX PELQJ IL[WXUHV ,QDGGLWLR Q LPSOHPHQWDWLRQRIWKHSUHYLRXV*HQHUDO3ODQXSGDWHDQGUHYLVHG=RQLQJ2UGLQDQFH ZRXOGUHVXOWLQDGHFUHDVHLQRYHUDOOEXLOGLQJVTXDUHIRRWDJHFLW\ZLGHRIPLOOLRQ VTXDUHIHHW7KHFHUWLILHG*HQHUDO3ODQ(,5GHWHUPLQHGWKDWEHFDXVHWKHIXWXUHPL[ RIODQGXVHVZLOOEH VLPLODUROGHUEXLOGLQJVZLOOEHUHSODFHGE\QHZHUPRUHHIILFLHQW 8WLOLWLHVDQG6HUYLFH6\VWHPV 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW EXLOGLQJV DQGWKHUHLVDQ DQWLFLSDWHG PLOOLRQ VTXDUH IRRWGHFUHDVH LQ GHYHORSPHQW IXWXUH GHPDQG IRU GRPHVWLF ZDWHU LV QRW DQWLFLSDWHG WR LQFUHDVH EH\RQGFXUUHQWOHYHOV 7KHFHUWLILHG*HQHUDO3ODQ(,5UHIHUHQFHVWKH&LW\¶V8UEDQ:DWHU0DQDJHPHQW 3ODQ 8:03 $F FRUGLQJ WR WKH 8:03 E\ WKH QXPEHURIDFUH IHHW SURGXFHG IURP ZHOOV LVQRWH [SHFWHG WR LQFUHDVH VXEVWDQWLDOO\DQGWK H DPRXQW SXUFKDVHG IURP&%0:'LVH [SHFWHG WR LQFUHDVH IURP DFUHIHHW WR DFUHIHHW%\9HUQRQ¶VZDWHUVXSSO\SURILOHLVSURMHFWHGWREH SHUFHQW IURP JURXQGZDWHU SH UFHQW IURP &%0:' DQGS HUFHQW IURP UHF\FOHG VRXUFHV $FFRUGLQJWRWKH8:03E\9HUQRQ¶VZDWHUVXSSO\SURILOHLVSURMHFWWR EH SHUFHQW IURP JURXQGZDWHU SHUFHQ W IURP&%: 0' DQGSHUFH QW IURPUHF\FOHGVRXUFHV7RWDOSURMHFWHGVXSSO\LQWKHQRUPDO\HDUVLQJOHGU\\HDU DQG PXOWLSOHG U\ \HDU VFHQDULRV H[FHHG SURMHFWHG GHPDQG ZLWKLQ9HUQRQ 7KHUHIRUHLPSDFWVZLOOUHPDLQFRQVLVWHQWZLWKWKHDQDO\VLVSURYLGHGLQWKHFHUWLILHG *HQHUDO3ODQ(,5DVless than significant Impact 4.5.B Solid Waste 7KHFHUWLILHG*HQHUDO3ODQ(,5IRXQGWKDW LPSDFWVUHODWHGWRODQGILOOFDSDFLW\ZLOOEH OHVVWKDQVLJQLILFDQW2YHUDOOGHYHORSPHQWLQ9HUQRQZLOOGHFUHDVHE\DSSUR[LPDWHO\ PLOOLRQ VTXDUHIH HW RYHUWK H OLIHRIWKHFHUWLILH G *HQHUDO3ODQXSG DWH 7KH FHUWLILHG*HQHUDO3ODQ(,5GHWHUPLQHGWKDWWKHPL[RIIXWXUHX VHVLVH[SHFWHGWREH VLPLODUWRH[LVWLQJFRQGLWLRQV'XHWR WKHDQWLFLSDWHGGHFUHDVHLQWKHWRWDODPRXQW RIGHYHORSPHQWLQ9HUQRQVROLGZDVWHJHQHUDWLRQLVQRWH[SHFWHGWRFKDQJH $FFRUGLQJ WRWKH&DO5HF\FOH6R OLG :DVWH &KDUDFWHUL]DWLRQ 'DWDEDVH UHWDLOVHUYLFHFRPPHUFLDOXVHVFDQJHQHUDWHXSWRWRQVSHUHPSOR\HHSHU\HDU RIVROLGZDVWH0DQXIDFWXULQJXVHVFDQJHQHUDWHXSWRWRQVSHUHPSOR\HHSHU \HDU$OWKRXJKWKHGLVSRVDOUDWHIRUUHWDLOVHUYLFHFRPPHUFLDOXVHVLVKLJKHUWKD Q WKDWRIPDQXIDFWXULQJWKH6RXWKHUQ&DOLIRUQLD$VVRFLDWLRQRI*RYHUQPHQW¶V6&$* (PSOR\PHQW 'HQVLW\6WXG\ VKRZV WKDW IRU /RV $QJHOHV &RXQW\ WKHDYHUDJ H HPSOR\HHVSHUVTXDUHIRRWRIUHWDLOVHUYLFHDQGRIILFHXVHVDUHORZHUWKDQWKDWRI PDQXIDFWXULQJ XVHV 7KHUHIR UH ZLWKWKHDGGLWLR Q RIWK H FRPPHUFLDO RYHUOD\ IXWXUH FRPPHUFLDO GHYHORSPHQW ZLOOU HSODFH ROGHU PDQXIDFWXULQJDQG LQGXVWULDO XVHV UHGXFLQJ WKH DPRXQW RIVROLG ZDVWH JHQHUDWHG E\WKH &LW\DVDZKROH ,PSDFWVZLOOUHPDLQFRQVLVWHQWZLWKWKH DQDO\VLVSURYLGHGLQWKHFHUWLILHG*HQHUDO 3ODQ(,5DVless than significant Mitigation Measures ,PSDFWV ZLOO EHO HVV WKDQVLJQ LILFDQW DW WKH SURJUDPPDWLF DQG LQGLYLGXDO SURMHFW OHYHOVDQGQRPLWLJDWLRQLVUHTXLUHG 8WLOLWLHVDQG6HUYLFH6\VWHPV )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH Level of Significance after Mitigation 1RQH References 7KHVRXUFHVRILQIRUPDWLRQIRUWKLVVHFWLRQDUHDVIROORZV$QQXDO5HSRUWRIWKH&LW\ RI9HUQRQ±3XEOLF:RUNV :DWHU6HFWLRQV &LW\RI9HUQRQ8UEDQ:DWHU 0DQDJHPHQW3ODQ&LW\RI9HUQRQ'HFHPEHU &LYLOWHF(QJLQHHULQJ,QF&LW\RI9HUQRQ8UEDQ:DWHU0DQDJHPHQW3ODQ9ROXPH ±5HSRUW-XQH &DOLIRUQLD :DWHU 6HUYLFH &RPSDQ\ 8UEDQ:DWHU0DQDJHPHQW 3ODQ (DVW/RV $QJHOHV'LVWULFW-XQH &LYLOWHF(QJLQHHULQJ,QF&LW\RI9HUQRQ8UEDQ:DWHU0DQDJHPHQW3ODQ9ROXPH ±5HSRUW-XQH 7KH1DWHOVRQ&RPSDQ\,QF(PSOR\PHQW'HQVLW\6WXG\2FWREHU ,QWURGXFWLRQ ([HFXWLYH6XPPDU\ 3URMHFW'HVFULSWLRQ (QYLURQPHQWDO,PSDFW$QDO\VLV $OWHUQDWLYHV $QDO\VLVRI/RQJ7HUP(IIHFWV (IIHFWV)RXQG1RWWREH6LJQLILFDQW 3UHSDUDWLRQ7HDP 5HIHUHQFHV ,QWURGXFWLRQ ([HFXWLYH6XPPDU\ 3URMHFW'HVFULSWLRQ (QYLURQPHQWDO,PSDFW$QDO\VLV $OWHUQDWLYHV $QDO\VLVRI/RQJ7HUP(IIHFWV (IIHFWV)RXQG1RWWREH6LJQLILFDQW 3UHSDUDWLRQ7HDP 5HIHUHQFHV 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW Alternatives 5.0 6HFWLRQRIWKH&(4$*XLGHOLQHVUHTXLUHVWKDWDQ(,5GHVFULE HD³UDQJHRI UHDVRQDEOHDOWHUQDWLYHV´WRDSURMHFWZKLFKZRXOG³IHDVLEO\REWDLQPRVWRIWKHEDVLF REMHFWLYHV RIWKH SURMHFW EXWZRXOGD YRLG RU VXEVWDQWLDOO\ OHVVHQDQ\RIWKH VLJQLILFDQWHIIHFWVRIWKHSURMHFW´7KHLP SDFWVDVVRFLDWHGZLWKHDFKDOWHUQDWLYHDUH FRPSDUHG WRWKHLPSDFWVRIWKHSURS RVHG SURMHFW %HFDXVH WKHDQDO\VLVLQWK H FHUWLILHG(,5LQGLFDWHVWKDWSURMHFWUHODWHGVLJQLILFDQWLPSDFWVFDQEHIXOO\PLWLJDWHG DQG WKDW XQDYRLGDEOH VLJQLILFDQW LPSDFWV UHVXOW IURP FXPXODWLYH FRQVLGHUDWLRQV SURMHFW LPSDFWV FRPELQHG ZLWK JURZWK DFWLYLW\ LQWKH UHJLRQWKH UDQJH RI DOWHUQDWLYHVLVOLPLWHG7KHDQDO\VLVDQGFRQFOXVLRQVFRQWDLQHGLQWKLV6XSSOHPHQWDO (,5LVFRQVLVWHQWZLWKWKDWRIWKHFHUWLILHG(,57KHUHIRUHWKLVVHFWLRQZLOOHYDOXDWH WKHVDPHDOWHUQDWLYHV$OWHUQDWLYHVHYDOXDWHGLQWKLV(,5DUH x $OWHUQDWLYH 1R 3URMHFW([LVWLQJ *HQHUDO3ODQ UHTXLUHG E\ 6HFWLRQ >H@RIWKH&(4$*XLGHOLQHV x $OWHUQDWLYH $GGLWLRQDOUDLOZD\URDGZD\JUDGHVHSDUDWLRQV x $OWHUQDWLYH =RQLQJ2UGLQDQFHSURYLVLRQVWKDWDOORZZDUHKRXVLQJIDFLOLWLHV RIOHVVWKDQVTXDUHIHHWFLW\ZLGH x $OWHUQDWLYH 1RWUXFNDQGIUHLJKWWHUPLQDORYHUOD\ Alternative Project Location 6HFWLRQIVWDWHVWKDWDQ(,5 VKRXOGGHWHUPLQHZKHWKHUVRPHRUDOOR I WKHSURMHFWVLJQLILFDQWHIIHFWVFRXOGEHDYRLGHGRUVXEVWDQWLDOO\OHVVHQHGE\VLWLQJ WKHSURMHFWDWDQDOWHUQDWLYHORFDWLRQ%HFDXVHWKHVXEMHFWSURMHFWHQFRPSDVVHVWKH HQWLUH&LW\RI9HUQRQDQGXQLQFRUSRUDWHGSURSHUWLHVZLWKLQWKHSODQQLQJDUHDD Q DOWHUQDWLYHORFDWLRQGRHVQRWUHSUHVHQWDIHDVLEOHSURMHFWDOWHUQDWLYH WKLV DOWHUQDWLYHLVWKHUHIRUHGLVPLVVHGIURPIXUWKHUFRQVLGHUDWLRQ Alternatives Considered but Rejected ,QWKHFRXUVHRILGHQWLI\LQJSURMHFWDOWHUQDWLYHVGXULQJSUHSDUDWLRQRIWKHFHUWLILHG (,5 WKH&LW\FR QVLGHUHG EXWUHMHFWH G IURP IXUWKHU FRQVLGHUDWLRQWKH ZLGHQLQJ RI 6DQWD)H$YHQXHWKURXJKRXWWKH&LW\7 KH&LW\UHMHFWHGWKHZLGHQLQJRI6DQWD)H $YHQXHDVDIHDVLEOHDOWHUQDWLYHEHFDXVHDOPRVWDOOEXLOGLQJVDORQJWKLVNH\FRUULGRU KDYHEHHQFRQVWUXFWHGWRWKHIURQWSURSHUW\OLQH$FTXLVLWLRQRIDGGLWLRQDOULJKWVRI ZD\ZRXOGLQYROYHWKHUHPRYDORUVLJQLILFDQWQDUURZLQJRIVLGHZDONVD QGSRVVLEO\ UHPRYDORIEXLOGLQJV7KLVDFWLRQZRXOGFUHDWHXQVDIHFRQGLWLRQVDORQJRQHRIWKH URDGZD\VLQWKH&LW\ZKHUHFRPPHUFLDOEXVLQHVVDFWLYLW\LVWREHIRFXVHGWRVXSSRUW WKHQHHGVRIWKHZRUNHUSRSXODWLRQWKHDOWHUQDWLYHLVWKHUHIRUHUHMHFWHG $VHFRQGDOWHUQDWLYHFRQVLGHUHGEXWUHMHFWHGDVLQIHDVLEOHLVWKHZLGHQLQJRI6RWR 6WUHHWDORQJLWVHQWLUHVWUH WFKWKURXJK9HUQRQ7KH&LUFXODWLRQDQG,QIUDVWUXFWXUH (OHPHQWDOUHDG\SURYLGHVIRULQFUHDVHGURDGZLGWKDORQJ6RWR6WUHHWIURP%DQGLQL %RXOHYDUG WRWKH QRUWK &LW\OLPLW6SHF LILFDOO\ WKH6R WR 6WUHHWWK 6WUHHW LQWHUVHFWLRQZRXOGEHLPSUR YHGWRLQFUHDVHFDSDFLW\6LPLODUWR6DQWD)H$YHQX H SRUWLRQVRI6RWR6WUHHWVRXWKRI%DQGLQL%RXOHYDUGKDYHEXLOGLQJVFRQVWUXFWHGWRWKH $OWHUQDWLYHV )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH IURQW SURSHUW\ OLQH $FTXLVLWLRQRIDG GLWLRQDO ULJKWVRIZD\ ZRXOGLQYROYHWK H UHPRYDORUVLJQLILFDQWQDUURZLQJRIVLGHZDONVDQGSRVVLEO\UHPRYDORIEXLOGLQJV,Q DGGLWLRQ WKH IRFXVHG *HQHUDO 3ODQD QG =RQLQJ 2UGLQDQFH XSGDWHSURSRVHV H[SDQVLRQRIWKHFRPPHUFLDORYHUOD\WRHQFRPSDVV6RWR6WUHHWQR UWKRI)UXLWODQG $YHQXH 7KHUHIRUH WKLVD FWLRQ ZRXOG FUHDWH XQVDIH FRQGLWLRQVDORQJ D URDGZD\ ZKHUH FRPPHUFLDO DFWLYLW\ LVWRE H IRFXVHG DQG LQYROYHFR VWO\ ULJKWRIZD\ DFTXLVLWLRQDQGWKHUHIRUHLVUHMHFWHG 7KH&LW\DOVRFRQVLGHUHGWKHZLGHQLQJRIWKHWZREORFNVRI( 6ODXVRQ$YHQXHWKDW SDVVWKURXJK9HUQRQEHWZHHQ6%R\OH$YHQXHDQGWKH8QLRQ3DFLILF5DLOURDGOLQH WR ILYH RU VL[ ODQHV 6ODXVRQ $YHQXH LVDPD MRU UHJLRQDO URDGZD\ DQGDQ\ LPSURYHPHQWV WR HQKDQFH FDSDFLW\ DQG WUDIILFPRYHP HQW ZRXOGUHTXLUH FRRUGLQDWLRQDPRQJWKHPDQ\ FLWLHVDQG/RV$QJHOHV&RXQW\3XEOLF :RUNV:KLOH WKH&LW\VXSSRUWVDQ\UHJLRQDOSODQVGHYHORSHGWRLPSURYHWKLVURDGZD\WKHWUDIILF VWXG\ SUHSDUHG LQFRQMXQFWLR Q ZLWKWKH FHUWLILHG (,5FRQFOXGHGWKDWWKH&LW\¶V LVRODWHG DFWLRQ RID GGUHVVLQJ WKH WZR EORFNV ZLWKLQ 9HUQRQ ZRXOGQ RW DFKLHYH PHDVXUDEOHORFDOLPSURYHPHQWV,QDGGLWLRQWKHIRFXVHG*HQH UDO3ODQDQG=RQLQJ 2UGLQDQFHXSGDWHSURSRVHVH[SDQVLRQRIWKHFRPPHUFLDORYHUOD\WRHQFRPSDVVWKLV DUHD /DVWO\ WKH &LW\ FRQVLGHUHG UHRULHQWLQJ SDUDOOHO VWUHHWV DVRQHZD \ VWUHHWVWR LPSURYH WUDIILF IORZ +RZHY HU WKLV DOWHUQDWLYH ZDV UHMHFWHG EHFDXVH 9HUQRQ¶V VWUHHW V\VWHPODFNV DQ DGHTXDWH JULG VWUXFWXUH WRDOORZIRU VXFK WUDIILF IORZV WR IXQFWLRQSURSHUO\DQGHIILFLHQWO\ Alternative 1: No Project 7KLVDOWHUQDWLYHLVDQDO\]HGZLWKLQWKHFHUWLILHG(,5DQGWKLV6XSSOHPHQWDO(,5DVLW LV UHTXLUHG XQGHU &(4$ *XLGHOLQHV 6HFWLRQ H $FFRUGLQJ WR6 HFWLRQ HRIWKH&(4$*XLGHOLQHVWKHQRSURMHFWDQDO\VLVVKDOOGLVFXVV³ ZKDWLVUHDVRQDEO\H[SHFWHGWRRFFXULQWKHIRUH VHHDEOHIXWXUHLIWKHSURMHFWZHUH QRWDSSURYHGEDVHGRQFXUUHQWSODQVDQGFRQVLVWHQWZLWKDYDLODEOHLQIUDVWUXFWXUH DQGFRPPXQLW\VHUYLFHV´7KLVDOWHUQDWLYHDVVX PHVWKDWWKHIRFXVHG*HQHUDO3ODQ =RQLQJ 2UGLQDQFH XSGDWH ZRXOG QRWEH DGRSWHG DQG LPSOHPHQWHG ,QVWHDGWK H 9HUQRQSODQQLQJDUHDZRXOGFRQWLQXHWREHUHGHYHORSHGDFFRUGLQJWRWKHH[LVWLQ J ODQGXVHPDSDQGDSSO\ZLWKFXUUHQW]RQLQJUHJXODWLRQVDVGHVFULEHGLQWKHFHUWLILHG (,57KH*HQHUDO3ODQXSGDWHGDQDO\]HGLQWKHFHUWLILHG(,5LQFOXGHG WKH HVWDEOLVKPHQWRID&RPPHUFLDO2YHUOD\'LVWULFWDQGWKHHOLPLQDWLRQRIWKH5XOH UHTXLULQJDOOEXVLQHVVHVWKDWKDYHQRQFRQIRUPLQJSDUNLQJDQGRUORDGLQJIDFLOLWLHVWR DFKLHYHFRQIRUPLW\E\7KH1R3URMHFWDOWHUQDWLYHZRXOGKDYHUHVXOWHGLQWKH FRQWLQXHGLPSOHPHQWDWLRQRIWKH5XOHDQGWKH*HQHUDO3ODQODQGXVHVZLWKRXW WKH&RPPHUFLDO2YHUOD\ ,QSDUWLFXODUWKHFXUUHQW&RPPHUFLDO2YHUOD\ZRXOGUHPDLQLQHIIHFWWKHIR FXVHG *HQHUDO3ODQDQG=RQLQJ2UGLQDQFHXSGDWHZRXOGUHSODFHWKH FXUUHQW&RPPHUFLDO 2YHUOD\ZLWKWZRH[SDQGHG&DQG& 2YHUOD\VDORQJ6DQWD)H$YHQ XH3DFLILF %RXOHYDUG6RWR6WUHHWQRUWKRI)UXLWODQG$YHQXH(DVW6ODXVRQ$YHQXHDQGDORQ WKHHDVWHUQERXQGDU\RIWKH&LW\$OVRWKH1R3URMHFWDOWHUQDWLYHZRXOGQRWLQYROYH $OWHUQDWLYHV 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW HVWDEOLVKPHQWRID7UXFNDQG)UHLJKW7HUPLQDOQRUWKRIWK6WUHHWZHVWRI'RZQH\ 5RDGDQGQRUWKRIWKH/RV$QJHOHV5LYHUHDVWRI'RZQH\5RDG $VGLVFXVVHGLQ6HFWLRQ±3 URMHFW'HVFULSWLRQRIWKLV(,5WKHIRFX VHG*HQHUDO 3ODQ DQG =RQLQJ 2UGLQDQFH XSGDWH SURYLGHV IRU FRQWLQXDWLRQ RIORQ JHVWDEOLVKHG ODQGXVHSROLF\DQGPDLQWDLQLQJ9HUQRQDVDQH[FOXVLYHO\LQGXVWULDOFLW\ZLWKOLPLWHG KRXVLQJDQGWKHSRVVLELOLW\RIFRPPHUFLDO%HFDXVHWKHXSGDWHG*HQHUDO3ODQGRHV QRWSURYLGHIRUDQ\LQFUHDVHLQSHUPLWWHGODQGXVHLQWHQVLWLHVWKH&LW\DVVXPHVWKDW WUHQGV RYHU WKHOD VW WHQ\H DUV RIDQ DFWXDO GHFOLQH LQEXLOGLQJVTXD UH IRRWDJH FLW\ZLGH ZRXOG FRQWLQXHXQGHUHLWKHUFX UUHQW *HQHUDO 3ODQ SROLF\ RUWKHXSGDWH G *HQHUDO3ODQ)XWX UHGHYHORSPHQWZLOOUHVXOWLQQHZHUEXLOGLQJVZLWKUHGXFHGORW FRYHUDJHGXHWRVHWEDFNDQGSDUNLQJUHTXLUHPHQWVFRQVLVWHQWZLWKFXUUHFQW]RQLQJ UHJXODWLRQV Comparison of Impacts to Proposed Project 7KH 1R 3URMHFW DOWHUQDWLYH DQDO\]HG LQ WKH FHUWLILHG (,5 KDV WKH SRWHQWLDO WR DFFHOHUDWH SULYDWHO\ LQLWLDWHG UHXVHD QG UHGHYHORSPHQW DFWLYLW\GXHWRWKH DSSOLFDWLRQRIWKH5XOHDQGWKHUHE\SRVVLEO\WRUHGXFHRYHUDOOEXLOGLQJDUHDLQ 9HUQRQ7KHFHUWLILHG(,5GHWHUPLQHGWKDWGHSHQGLQJRQWKHW\SHVRIGHYHORSPHQW SURSRVHGRYHUWKHORQJWHUP UHGXFHGGHYHORSPHQWFLW\ZLGHZRXOGUHGXFHYHKLFOH WULSV DQG DVVRFLDWHG DLUHPL VVLRQV DQG GHFUHDVH GHPDQG IRUSRWD EOH ZDWHU ,QGXVWULDO XVH FRPSULVHV PXFK RI9HUQ RQ DQG WKH H[WHQW RI EXVLQHVVHV XVLQJ RU VWRULQJ KD]DUGRXV PDWHULDOV FRXOG EH H[SHFWHG WR UHPDLQ GHSHQGLQJ XSRQWKH LQGLYLGXDOQHZXVHVHVWDEOLVKHGRYHUWKHORQJWHUP7KHFHUWLILHG (,5GHWHUPLQHG WKDWWKHRYHUDOOOHYHORILPSDFWFRXOGEHVOLJKWO\ORZHUWKDQWKDWDVVRFLDWHGZLWKWKH SURSRVHGSURMHFW 7KHFRQWLQXHGDSSOLFDWLRQRIWKH5XOHKDVWKHSRWHQWLDOWRLPSURYHWUDIILFIORZ RQ&LW\VWUHHWVDVRQVWUHHWORDGLQJDFWLYLW\ZLOOEHSURKLELWHGDQGRQVWUHHWSDUNLQJ ZLOOEHPLQLPL]HGGXHWRWKH HQIRUFHPHQWRIRIIVWUHHWSDUNLQJUHTXLUHPHQWV,Q WKLVUHJDUGWKH1R3URMHFW$OWH UQDWLYHZDVFRQVLGHUHGHQYLURQPHQWDOO\VXSHULRUWR WKHSURSRVHGSURMHFW :LWKUHJDUGWRQRLVHLPSDFWVDOPRVWDOOORFDOLPSDFWVDUHDVVRFLDWHGZLWKUHJLRQDO WUDIILFQRLVHDQGUDLO WUDIILFQHLWKHURIZK LFKZRXOGEHH[SHFWHGWREHD IIHFWHGE\ WKH1R3URMHFWVFHQDULR1RFKDQJHLQLPSDFWZRXOGUHVXOW 7KH FHUWLILHG*HQHUD O 3ODQ/DQ G 8VHS ODQ GHVLJQDWHV WKHHQ WLUHFLW\D V ,QGXVWULDO ZLWKWKHSRVVLELOLW\RIFRPPHUFLDOZLWKLQWKHGHVLJQDWHG&RPPHUFLDO2YHUOD\7KH SURSRVHG SURMHFW LQFOXGHVWKH H[SDQVLRQ DQGLPSOHPHQWDWLR Q RIWZRFRPP HUFLDO RYHUOD\]RQHVDQGWKHHVWDEOLVKPHQWRID7UXFNDQG)UHLJKW7HUPLQDO2YHUOD\=RQH 7KH IRFXVHG *HQHUDO 3ODQ DQG =RQLQJ 2UGLQDQFH XSGDWH GRHV QRWSURSRVH DQ\ FKDQJHVLQXQGHUO\LQJODQGXVHGHVLJQDWLRQVRUEXLOGLQJLQWHQVLWLHV&RQVLVWHQWZLWK WKH FHUWLILHG*HQH UDO 3ODQSULYDWHO\ LQLWLDWHG UHXVH DQG UHGHYHORSPHQW DFWLYLW\ ZRXOG UHVXOW LQ RYHUDOO UHGXFHG EXLOGLQJ DUHDLQ 9HUQRQZLWK WKHHQ IRUFHPHQW RI SDUNLQJDQGVHWEDFNUHTXLUHPHQWV,PSDFWVUHODWHGWRDLU TXDOLW\KD]DUGVQRLVH $OWHUQDWLYHV )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH WUDIILFDQGXWLOLWLHVIRUWKH1R3URMHFWDOWHUQDWLYHZRXOGEHHTXLYDOHQWWRLPSDFWV DVVRFLDWHGZLWKWKHSURSRVHGSURMHFW Alternative 2: Additional Railway/Roadway Grade Separations 0DQ\UDLOOLQHVFURVVVWUHHWVLQ9HUQRQDWJUDGHZLWKIUHTXHQWWUDLQDFWLYLW\EHWZHHQ WKHSRUWVRI/RV$QJHOHVDQG/RQJ%HDFKODUJHO\VHUYLQJWKH+REDUW<DUGDQGRWKHU UHJLRQDOFDUJRUHGLVWULEXWLRQID FLOLWLHV,QWHQVHUDLODFWLYLW\KLVWRULFDOO\KDVFUHDWHG UDLOURDGZD\FRQIOLFWVLQ9HUQRQ+RZHYHUDVVWD WHGLQWKH FHUWLILHG(,5WKH&LW\ KDVH[SHULHQFHGDVXEVWDQWLDOGHFUHDVHLQUDLOWUDIILFDQGDVVRFLDWHGFRQJHVWLRQDVD UHVXOW RI WKH FRP SOHWLRQ RIWKH H[SUHVVZD\ $ODPHGD &RUULGRU 7KH NH\ HQYLURQPHQWDOLPSDFWLGHQWLILHGLQWKHFHUWLILHG(,5ZDVWUDIILF7KLVDOWHUQDWLYHDV DQDO\]HGLQWKHFHUWLILHG(,5FRQVLGHUVLQFOXGLQJVSHFLILFSROLFLHVLQWKH*HQHUDO3ODQ WRSXUVXH UDLOURDGJUDGHVHSDUDWLRQVDW%DQGLQL%RXOHYDUG'RZQH\5RDG3DFLILF $YHQXH9HUQRQ$YHQXHDQG'LVWULFW%RXOHYDUG'RZQH\5RDG 'XULQJ SUHSDUDWLRQ RIWKH FHUWLILHG (,5 DQG FXUUHQWO\ WKH& LUFXODWLRQ DQG ,QIUDVWUXFWXUH(OHPHQWLQFOXGHVWKHIROORZLQJSROLF\ZKLFKLVQRQVSHFLILFUHJDUGLQJ JUDGHVHSDUDWLRQVWREHSXUVXHG 32/,&< &,&RQWLQXHWR SXUVXH JUDGH VHSDUDWLRQ IRU UDLOURDG FURVVLQJVR Q GHVLJQDWHGVWUHHWV Comparison of Impacts to Proposed Project 7KH&LW\KDVQRWFRQGXFWHGDQDQDO\VLVRIWKHHIIHFWVRISURYLGLQJJUDGHVHSDUDWLRQV DWWKHDERYHORFDWLRQV+RZHYHUVXFKLPSURYHPHQWVZRXOGKDYHWKHSRWHQWLDOWR LPSURYHWUDIILFIORZDQGSRVVLEO\UHVXOWLQUHGXFHGDLUSROOXWDQWHP LVVLRQVGXHWR UHGXFHGYHKLFOHLGOLQJWLPHZKLOHZDLWLQJIRUWUDLQVWRFURVVURDGZD\V:LWKWKL V DVVXPSWLRQ WKHFHUWLILHG(,5GHWHUP LQHG WKDWWUDIILFDQG DLUTXDOLW\LPSD FWV DVVRFLDWHG ZLWK$OWH UQDWLYH ZRXOG EH H[SHFWHG WREHUHGX FHG UHODWLYHWRWK H *HQHUDO3ODQXSGDWH :LWK UHJDUG WR KD]DUGVLQ FUHDVHG JUDGH VHSDUDWLRQV ZRXOGUHGX FH WKH ULVNR I WUDLQURDGZD\ YHKLFOH DFFLGHQWV DWWKRV H ORFDWLRQV ZKHUH VHSDUDWLRQV ZRXOG EH SURYLGHG5LVNRIXSVHWZRXOGEHVOLJKWO\UHGXFHG :LWKUHJDUGWRZ DWHUXVHDQGODQGILOOFDSDFLW\JUDGHVHSDUDWLRQVZRXOGKDYHQR HIIHFW :LWK UHJDUG WRQRLVHLPSD FWV WKHUHODWLYHLPS DFW ZRXOG GHSHQGXSRQ WKH FRQILJXUDWLRQRIWKHJUDGHVHSDUDWLRQ%HFDXVHWKHJUDGHVHSDUDWLRQORFDWLRQVFLWHG DERYH DOO SDVV WKURXJK H[FOXVLYHO\ LQGXVWULDO DUHDV ZKHUH QRLVH LVQ RW D PDMRU FRQFHUQWKHUHODWLYHQRLVHLPSDFWVZ RXOGEHHTXLYDOHQWWRWK RVHDVVRFLDWHGZLWK WKH SURMHFW 7UDLQ KRUQ QRLVH ZRXOGEH UHGXFHG VLQFH WUDLQ FURVVLQJ ZRXOG EH HOLPLQDWHG $OWHUQDWLYHV 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW :LWKFRPSOHWLRQRIWKH$ODPHGD&RUULGRUWR/RV$QJHOHVDQGRQJRLQJSODQVIRUWKH $ODPHGD&RUULGRU(DVWZKLFKZLOOH[WHQGWKLVGHGLFDWHGIUHLJKWUDLOOLQHWKURXJKWKH 6DQ*DEULHO9DOOH\DOORZLQ JIRUIUHLJKWPRYHPHQWWRWKH,QODQG(PSLUHHPSKDVLV ZLOOFRQWLQXHWREHSODFHGRQXVLQJWKH$ODPHGD&RUULGRULQVWHDGRIORFDOUDLOOLQHV %DVHGRQLQIRUPDWLRQ&LW\RI9HUQRQVWDIIKDVUHFHLYHGIURPUHVSRQVLEOH UDLO DJHQFLHVJUDGHVHSDUDWLRQVLQ9HUQRQDUHQRORQJHUEHLQJFRQVLGHUHG7KXVWKLV DOWHUQDWLYHPD\QRWEHDFKLHYDEOHGXULQJWKHOLIHRIWKH*HQHUDO3ODQXSGDWH ,PSDFW FRPSDULVRQ RI $OWHUQDWLYH WR WKH SURSRVHG IRFXVHG *HQHUDO 3ODQDQ G =RQLQJ 2UGLQDQFHX SGDWH LVFRQVLVWHQW ZLWK WKDW RI WKHFH UWLILHG *HQHUDO 3ODQ XSGDWH$LUTXDOLW\KD]DUGDQGWUDIILFLPSDFWVDVVRFLDWHG$OWHUQDWLYHZRXOGEH UHGXFHGZLWKWKHLQFOXVLRQRIVSHFLILF SROLFLHVWRSXUVXHUDLOURDGJUDGHVHSDUDWLRQV FRPSDUHGWRWKHSURSRVHGSURMHFW,PSDFWVZLWKUHJDUGWRQRLVHDQGXWLOLWLHVZLOOEH HTXLYDOHQW$VGHWHUPLQHGE\WKHFHUWLILHG(,5HPSKDVLVZLOOEHSODFHGRQXVLQJWKH $ODPHGD &RUULGRU LQVWHDG RI ORFDO UDLO OLQHV 7 KHUHIRUH GXH WR WKH XQFHUWDLQW\ DVVRFLDWHGZLWKIXWXUHUDLOURDGJUDGHVHSDUDWLRQRSSRUWXQLWLHVWKLVDOWHUQDWLYHPD\ QRWEHDFKLHYDEOH Alternative 3: Zoning Provisions to Permit Warehousing Citywide $W WKHWLPHRISUH SDUDWLRQ RI WKHFHUWLILHG(, 5 WKH=RQLQ J &RGHGLGQRWDOOR Z ZDUHKRXVLQJ IDFLOLWLHVWRORFDWHWKURX JKRXW WKH &LW\ZLWKWKHVL] H RIQRQ UHIULJHUDWHGZDUHKRXVHVOLPLWHGWRVTXDUHIHHW7KHFHUWLILHG(,5GLVFXVVHG DOORZLQJZDUHKRXVHXVHOHVVWKDQVTXDUHIHHWWRORFDWHDQ\ZKHUHLQWKH&LW\ DV$OWHUQDWLYH+RZHYHUVLQ FHFHUWLILFDWLRQRIWKH3URJUDP(,5WKH]RQLQJFR GH KDV EHHQDPHQGHG WR DOORZZ DUHKRXVH XVHWRORFDWHZLWKLQ WKH,QGXVWULDO]RQ H ZKLFK HQFRPSDVVHV WKHHQWLUHFLW\7K HUHIRUH $OWHUQDWLYH DQDO\]HGLQWKH FHUWLILHG(,5LVQRORQJHUDSSOLFDEOHDQGZLOOQRWEHGLVFXVVHGIXUWKHU Alternative 4: No Truck and Freight Terminal Overlay 7KLV DOWHUQDWLYHZLOOFRQVLVWR I WKHUHP RYDO RIWK H 7UXFND QG )UHLJKW7HUPLQDO 2YHUOD\=RQHIURPWKHSURSRVHGSURMHFW7KHSURSRVHGIRFX VHG*HQHUDO3ODQDQG =RQLQJ2UGLQDQFHXSGDWHLQFOXGHVD7UXFNDQG)UHLJKW7HUPLQDO2YHUOD\=RQHLQWKH QRUWKHUQ SRUWLRQ RI 9HUQRQQ RUWK RI WK 6WUHHWD QG WKH/RV$QJHOH V 5LYHUWR HQFRPSDVVRYHUQHWDFUHV$FFRUGLQJWRWK H9HUQRQ =RQLQJ2UGLQDQFHD IUHLJKWWHUPLQDOLVZKHUHJRRGVRUIUHLJKWDUHWUDQVIHUUHGRUUHGLVWULEXWHGIURPRQH YHKLFOHWRDQRWKHUDQGDWUXFNWHUPLQDOLVXVHGSULPDULO\IRUVWRUDJHPDLQWHQDQFH RUVHUYLFLQJRIKLJKZD\W\SHYHKLFOHVQRWOLPLWHGWRWUXFNVDQGEXVHV Comparison of Impacts to Proposed Project (OLPLQDWLRQ RIWKH7UXFNDQG )UHLJKW 7HUPLQDO 2YHUOD\ =RQH IURPWK H SURSRVHG SURMHFWKDVWKHSRWHQWLDOWRUHGXFHLPSDFWVUHODWHGWRWUDIILFDLUTXDOLW\DQGQRLVH )UHLJKWWHUPLQDOVLQFOXGHKLJKWXUQRYHU RIWUDQVSRUWHGJRRGVUHVXOWLQJLQLQFUHDVHG DQGFRQWLQXRXVWUXFNWULSVLQWKHDUHD'LHVH OWUXFNVDUHD PDMRUFRQWULEXWRUWR 30FRQFHQWUDWLRQVDQGWUXFNDQGIUHLJKWWHUPLQDOXVHVFRXOGLQFUHDVHWKHQXPEHU RIGLHVHOWUXFNVRQORFDOURDGVWKHUHE\LQFUHD VLQJWKHDUHD¶V30 FRQFHQWUDWLRQV $OWHUQDWLYHV )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH 2YHUDOO ORFDODQG UHJLRQDO DLU TXDOLW\LPSDFWV ZRXOG EH UHGXFHG XQGHUWK LV DOWHUQDWLYH 7UXFN DQG IUHLJKWWH UPLQDO XVH LQ9HUQ RQ LV IDFLOLWDWHG E\ WKHXVHR I KHDY\GXW\ WUXFNVGHOLYHULQJSURGXFWVWR DQGIURPWKHIDFLOLW\%HFD XVHWKLVLVWKHIXQFWLRQDO QDWXUHRIWUXFNDQGIUHLJKWWHUPLQDOVDQGLQGXVWULDODQGZDUHKRXVHXVHVPD\QRW UHTXLUHDVPXFKGLUHFWWUX FNLQJWKHLPSDFWRQWKHWUDQVSRUWDWLRQV\VWHPPD\E H VOLJKWO\ UHGXFHG ZLWKRXWWKHDOORZDQ FH RI WUXFND QG IUHLJKW WHUPLQDO XVH LQWKH QRUWKHUQSRUWLRQRIWKHFLW\ 7KHODUJHVWFRQWULEXWRUWRDPELHQWQRLVHLQ9HUQRQLVYHKLFOHWUDIILFHVSHFLDOO\WKDW RIKHDY\GXW\WUXFNV$GGLWLRQDOQRLVHLVFU HDWHGDWPDQ\RIWKHLQGXVWULDOVLWHVLQ WKH&LW\7UXFNDQGIUHLJKWWHUPLQDOXVHVZLOOFRQWULEXWHWRQR LVHIURPWKHGHOLYHU\ V\VWHPLQKHUHQWLQWKHLURSHUDWLRQVZLWKODUJHWUXFNVHQWHULQJWKH&LW\IRUGHOLYHULHV DQGSLFNXSV2QVLWHPRVWQRLVHLVJHQHUDWHGE\ORDGLQJGRFNRSHUDWLRQVWUXFNV HQWHULQJDQGOHDYLQJWKHDUHDDQGPHFKDQLFDOHTXLSPHQWORFDWHGERWKLQVLGHDQG RXWVLGHWKHEXLOGLQJ$VWUXFNDQGIUHLJK WWHUPLQDOXVHVPD\KDYHKLJKHUOHYHOVRI QRLVHRQVLWHDVVRFLDWHGZLWKWK HFRQWLQXRXVORDGLQJDQGXQORDGLQJRIJRRGVQRLVH LPSDFWV ZRXOG EH VOLJKWO\UHG XFHG ZLWKRXW WKH DOORZDQFH RI WUXFN DQG IUHLJKW WHUPLQDOXVH 0DQ\LQGXVWULDOIDFLOLWLHVLQ9HUQRQXVHDQGVWRUHKD]DUGRXVPDWHULDOV%XVLQHVVHV DUHUHTXLUHGWRREWDLQKD]DUGRXVPDWHULDOVSHUPLWVIRUNHHSLQJWKRVHPDWHULDOVDW WKH EXVLQHVV ,QWKH ,QGXVWULDO ,]RQ LQJ GLVWULFW KD]DUGRXVZDVWH IDFLOLWLHV DUH SHUPLWWHG VXEMHFW WR DFRQGLWLRQDOXVH SHUPLW 7KHXVHVZ KHWKHU ZDUHKRXVLQJ PDQXIDFWXULQJRUWUXFNDQGIUHLJKWWHUP LQDOZRXOGEHVXEMHFWWRWKHVDPHORFDO VWDWH DQG IHGHUDOUHJXODWLRQVUHJDUG LQJ KD]DUGRXV PDWHULDOV%H FDXVH DVLPLOD U DPRXQWDQGW\SHRIKD]DUGRXVPDWHULDOVZRXOGOLNHO\ EHSUHVHQWLQWKHSODQQLQ J DUHDXQGHUWKLVDOWHUQDWLYHWKLVDOWHUQ DWLYHZRXOGUHVXOWLQDVLPLODULPSDFWUHODWHG WRKD]DUGVZKLFKLVOHVVWKDQVLJQLILFDQW 7UXFNLQJ DQG IUHLJKWWHUPLQD O XVHV DUH UHODWLYHO\ ORZL PSDFW RQZDWHUDQGV ROLG ZDVWH V\VWHPV LQ FRPSDULVRQ WRPDQ\ LQGXVWULDO XVHV ,QGXVWULDO XVHV KDYHWKH SRWHQWLDOWREHYHU\ZDWHULQWHQVLYHHVSHFLDOO\LIZDWHULVXVHGIRUFRROLQJLQDQ LQGXVWULDOSURFHVV7UXFNDQGIUHLJKWWH UPLQDOVLQFRPSDULVRQJHQHUDOO\XVHOH VV ZDWHU$GGLWLRQDOO\EHFDXVHPDQXIDFWXULQJGRHVQRWRFFXURQVLWHZLWKWUXFNDQG IUHLJKWWHUPLQDOXVHVWKHOHYHORIZD VWHJHQHUDWHGZRXOGEHFRPSDUDEO\OHVV7KH SULPDU\ ZDVWHSUR GXFW IURP WUXFNDQG IUHLJKW WHUPLQDODFWLYLWLHVLVOLNHO\WREH SDFNDJLQJ PDWHULDOV DQGZD VWH IURP WKHUHSD LU DQG PDLQWHQDQFH RI YHKLFOHV 2YHUDOOWKHLPSDFWRQXWLOLWLHVH[FOXGLQJURDGVZRXOGEHVOLJKWO\LQFUHDVHGLIWUXFN DQGWHUPLQDOXVHVDUHQRWDOORZHG Relative Comparison of Impacts 7DEOHVXPPDUL]HVWKHUHODWLYHLPSDFWVRIHDFKRIWKHIRXUSURMHFWDOWHUQDWLYHV FRPSDUHGWRWKHSURSRVHGSURMHFW $OWHUQDWLYHV 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW Table 5-1 Comparison of Alternatives to the Project Alternative Issue and Impact Relative to the Project Air Quality Hazards Traffic Water/Landfills Noise Alternative 1: No Project Impact equivalent Impact equivalent Impact equivalent Impact equivalent Impact equivalent Alternative 2: Grade Separations Impact slightly reduced Impact slightly reduced Impact slightly reduced Impact equivalent Impact equivalent Alternative 3: Allow Warehousing N/A N/A N/A N/A N/A Alternative 4: No Truck and Freight Terminal Zoning Overlay Impact slightly reduced Impact equivalent Impact slightly reduced Impact slightly reduced Impact slightly reduced $OWHUQDWLYHV )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH 7KLV3DJH,QWHQWLRQDOO\/HIW%ODQN ,QWURGXFWLRQ ([HFXWLYH6XPPDU\ 3URMHFW'HVFULSWLRQ (QYLURQPHQWDO,PSDFW$QDO\VLV $OWHUQDWLYHV $QDO\VLVRI/RQJ7HUP(IIHFWV (IIHFWV)RXQG1RWWREH6LJQLILFDQW 3UHSDUDWLRQ7HDP 5HIHUHQFHV ,QWURGXFWLRQ ([HFXWLYH6XPPDU\ 3URMHFW'HVFULSWLRQ (QYLURQPHQWDO,PSDFW$QDO\VLV $OWHUQDWLYHV $QDO\VLVRI/RQJ7HUP(IIHFWV (IIHFWV)RXQG1RWWREH6LJQLILFDQW 3UHSDUDWLRQ7HDP 5HIHUHQFHV 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW Analysis of Long Term Effects 6.0 &(4$UHTXLUHVWKHGLVFXVVLRQRIWKHFXPXODWLYHLPSDFWVJURZWKLQGXFLQJLPSDFWV DQGORQJWHUPLPSDFWVRISURSRVHGSURMHFWV7KHIROORZLQJVHFWLRQVDGGUHVVWKHVH LVVXHVDVWKH\UHODWH WRLPSOHPHQWDWLRQRIWKH&LW\RI9HUQRQ *HQHUDO3ODQXSGDWH DQGUHYLVHG=RQLQJ2UGLQDQFH Cumulative Impacts 7KH&(4$*XLGHOLQHVGHILQHFXPXODWLYH HIIHFWVDV³WZRRUPRUHLQGLYLGXDOHIIHFWV WKDWZKHQFRQVLGHUHGWRJHWKHUDUHFRQVLGHUDEOHRUZKLFKFRPSRXQGRULQFUHDVH RWKHU HQYLURQPHQWDO LPSDFWV´ 7KH& (4$ *XLGHOLQHV IXUWKHU VWDWH WKDWWK H LQGLYLGXDO HIIHFWV FDQ EH WKHYDULRX V FKDQJHV UHODWHG WR D VLQJOH SURMHFW RUWKH FKDQJHVLQYROYHGLQDQXPEHURIRWKHUFORVHO\UHODWHGSDVWSUHVHQWDQGUHDVRQDEO\ IRUHVHHDEOHIXWXUHSURMHFWV6HFWLRQ7KH&(4$*XLGHOLQHVDOORZIRUWKHXVH RIWZRDOWHUQDWLYHP HWKRGVWRGHWHUPLQHWKHVFRSHRISURMHFWVIRUWKHFXPXODWLYH LPSDFWDQDO\VLV List Method $ OLVWRISD VW SUHVHQW DQG SUREDEOH IXWXUH SURMHFWV SURGXFLQJ UHODWHGRUFXPXODWLYHLPSDFWVLQFOXGLQJLIQHFHVVDU\WKRVHSURMHFWVRXWVLGHWKH FRQWURORIWKHDJHQF\ Regional Growth Projections Method$VXPPDU\R ISURMHFWVFRQWDLQHGLQDQ DGRSWHG JHQHUDO SODQ RUUHODWHGSODQQLQ J GRFXPHQW RULQD SULRUHQ YLURQPHQWDO GRFXPHQW ZKLFKKDVEHHQDGRSWHGRUFH UWLILHG ZKLFKGHVFULEHGRUHYDOXDWH G UHJLRQDO RU DUHDZLGHFRQG LWLRQV FRQWULEXWLQJ WR WKH FXPXODWLYH LPSDFW 6HFWLRQ 7KH FHUWLILHG *HQHUDO 3ODQ(, 5 XWLOL]HG WKHO LVW PHWKRG IRU FXPXODWLYH LPSDFW DQDO\VLVGXHWRWKHXSGDWHG*HQHUDO3ODQDQGUHYLVHG=RQLQJ2UGLQDQFHDGGUHVVLQJ DOO SURSHUWLHV LQWKH &LW\SURM HFWHG GHFOLQH LQGHYHORSP HQW VTXDUHIRR WDJH DQG VWDELOLW\ LQ KRXVLQJ SRSXODWLRQ 7KH&LWLHVRI+XQ WLQJWRQ 3DUN &RPPHUFH %HOO 0D\ZRRGDQG/RV$QJHOHVDQ GWKH&RXQW\RI/R V$QJHOHVZHUHFRQVXOWHGLQWKH SUHSDUDWLRQRIDOLVWRIODUJHGHYHORSPHQWSURMHFWV&XPXODWLYHLPSDFWVDVVRFLDWHG ZLWK WKH DGRSWLRQ DQG LPSOHPHQWDWLRQ RIWKH FHUWLILHG *HQHUDO 3ODQ (,5ZD V DQDO\]HG ZKHQ FRQVLGHUHG ZLWK SODQQHG GHYHORSPHQWV LQWKH VXUURXQGLQJ FRPPXQLWLHV 7KH IROORZLQJ GLVFXVVHV WKH FXPXODWLYH LPSDFWV DVVRFLDWHG ZLWKDGR SWLQJ DQG LPSOHPHQWLQJWKHSURSRVHG9HUQRQ*HQHUDO3ODQDQG]RQLQJRUGLQDQFHXSGDWH $LU4XDOLW\ 7KH FRQWH[W IRU DVVHVVLQJ FXPXODWLYH DLU TXDOLW\ LPSDFWV LQ WKH6RXW K &RDVW$L U %DVLQLVLQWHUPVRIQDWLRQDODQGVWDWHFULWHULDSROOXWDQWVWDQ GDUGV7KHSURSRVHG *HQHUDO 3ODQDQG]RQLQJRUGLQDQFHXSGD WH LV FRQVLVWHQW ZLWK WKH$403DV GLVFXVVHG LQ 6HFWLRQ WKHU HIRUH WKH SURMHFW ZLOO QRWFRQIOL FW ZLWK ORQJWHUP LPSOHPHQWDWLRQRIWKH$403DQGWKHFXPXODWLYH%DVLQZLGHLPSDFWVLWLVGHVLJQHG WRUHGXFH $QDO\VLVRI/RQJ7HUP(IIHFWV )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH 7KH &LW\ ZLOO FRQWLQXH WRHYD OXDWH VKRUWWHUP FRQVWUXFWLRQUHODWHG LPSDFWV DQG ORQJWHUPLPSDFWVIRUGLVFUHWLRQDU\ODQGXVHSURMHFWVVRWKDWEHVWDYDLODEOHFRQWURO PHDVXUHVFDQEHDSSOLHGZKHUHZDUUDQWHGWRPLQLPL]HWKHHIIH FWVRILQGLYLGXDO GHYHORSPHQWSURMHFWV7KUHVKROGVUHFRPPHQGHGE\WKH6&$40'ZLOOFRQWLQXHWR EH WKH SUHIHUUHG FULWHULD IRU GHWHUPLQLQJ WKH OHYHO RI LPSDFW VLJQLILFDQFH DWWKH SURMHFWOHYHORIUHYLHZ7KHSURSR VHGSURMHFWZRXOGQRWDXWKRUL]HDQ\SDUWLFXODU SURMHFWRUDQ\H[HPSWLRQVIURPRUFRQIOLFWVZLWKWKH$403DQGZRXOGQRWUHVXOWLQ DQ\GLUHFWDLUTXDOLW\LPSDFWV +RZHYHUDVGHWHUPLQHGLQWKH FHUWLILHG*HQHUDO3ODQ(,5SRWHQWLDOGHYHORSPHQW SURMHFWVLQWKHVXUURXQGLQJDUHDZRXOGUHSUHVHQWVXEVWDQWLDOQHZGHYHORSPHQWWR WKH UHJLRQ WKDWZ LOO DWWUDFW QHZ YHKLFOH WULSV DQG JHQHUDWH DVVRFLDWHG SROOXWDQW HPLVVLRQV'HVSLWHODQGXVHSROLFLHVDQGSUDFWLFHVDQGUHJLRQDOHIIRUWVWRUHGX FH SROOXWDQWHPLVVLRQVHPLVVLRQVDVVRFLDWHGZLWKUHJLRQDOGHYHORSPHQWZKHQDGGHG WR H[LVWLQJ SROOXWDQW HPLVVLRQV DUHDQWLFLSDWHGWRUHVXOWLQFRQWLQX HG RYHUDOO HPLVVLRQ OHYHOVLQ H[FHVV RI 6&$40' WKUHVKROGV $OWK RXJK 9HUQRQ DQG RWKHU MXULVGLFWLRQV ZLOOE H UHTXLUHG WRDGRS W DQG LPSOHPHQW PHDVXUHVWR ZRUN WRZDUG $403DLUTXDOLW\LPSURYHPHQWJRDOVWKHLQFUHDVHLVFXPXODWLYHO\FRQVLGHUDEOH 7KHUHIRUH FRQVLVWHQW ZLWKWKH FHUWLILHG *HQHUDO 3ODQ(,5WKHSURSR VHG SURMHFW¶V FRQWULEXWLRQ WRFXPXODWLYH DLU TXDOLW\LPSD FWV ZRXOGEHsignificant and unavoidable$VW KHSURSRVHG*HQHUDO3ODQDQG]RQLQJRUGLQDQFHX SGDWHZRXOG UHVXOWLQUHGXFHGGHYHORSPHQWLQWHQVLW\FRPSDUHGWRWKHFHUWLILHG*HQHUDO3ODQ(,5 FXPXODWLYHLPSDFWVDVDUHVXOWRIWKHSURSRVHGSURMHFWZRXOGQRWEHLQFUHDVHG +D]DUGVDQG+D]DUGRXV0DWHULDOV 7KHFRQWH[WIRUDVVHVVLQJFXPXODWLYHKD]DUGRXVPDWHULDOVLPSDFWVLQYROYHVH[LVWLQJ DQGSRWHQWLDOGHYHORSPHQWZLWKLQWKHSODQQLQJDUH DDQGWKRVHVXUURXQGLQJDUHDV WKDWFRXOGUHVXOWLQWKHWUDQVSRUWXVHRUGLVSRVDORIKD]DUGRXVPDWHULDOVRUZDVWHV 7\SLFDO XVHVZRXOG LQFOXGH LQGXVWULDO DFWLYLWLHV XWLOLW\S URYLGHUV DQG ZDVWH PDQDJHPHQWVHUYLFHV $VIXWXUHGHYHORSPHQWRFFXUVZLWKLQWKHSODQQLQJDUHDWKHSRVVLELOLW\H[LVWVWKDW LQGXVWULHVXVLQJKD]DUGRXVPDWHULDOVZLOOORFDWHSUR[LPDWHWRVHQVLWLYH XVHV 7KH FXPXODWLYH LPSDFW RI UHJLRQDO GHYHORSPHQW RQ SXEOLFVDIHW\LV SRWHQWLDOO\ VLJQLILFDQW EXWFDQ EHUHGX FHG WRD OHVVWK DQ VLJQLILFDQW OHYHO WKURXJK LPSOHPHQWDWLRQRIWKHPLWLJDWLRQPHDVXUHVLQFOXGHGLQWKHFH UWLILHG3URJUDP(,5 LQFOXGLQJ FRQWLQXHG LPSOHPHQWDWLRQ RI WKH &LW\R I 9HUQRQ¶V +D]DUGRXV 0DWHULDOV 0RQLWRULQJ 3URJUDP DQGFRQ WLQXHG LPSOHPHQWDWLRQ DFWLYLWLHVWRD VVXUH WKDW KD]DUGRXV ZDVWHV JHQHUDWHG E\ 9HUQRQ EXVLQHVVHV DUH KDQGOHG DQG GLVSRVHG RI DFFRUGLQJWRIHGHUDOVWDWHDQGORFDOUHJXODWLRQV9HUQRQZLOOFRQWLQXHWRUHTXLUH HYHU\EXVLQHVVWRPDLQWDLQDOLVWRIPDWHULDOVDIHW\GDWDVKHHWVIRUWKH FKHPLFDOV DQGRWKHUKD]DUGRXVPDWHULDOVXVHGRUVWRUHGRQVLWHLQDFFRUGDQFHZLWKODZDQGWR SURYLGH WKDW OLVW WRWKH )LUH 'HSDUWPHQW DQG(QYLURQPHQWD O +HDOWK 'HSDUWPHQW (QIRUFHPHQWRIVWDWHFRXQW\ DQGORFDOKD]DUGRXVPDWHULDOUHJXODWLRQVZLOOUHGX FH VLJQLILFDQW SXEOLFKHDOWKKD]DUGVWRDOH VV WKDQ VLJQLILFDQW OHYHO$ V DUHVX OW FRQVLVWHQWZLWKWKHFHUWLILH G3URJUDP(,5LPSOHPHQWDWLRQRIWKHIRFXVHG*HQHUDO $QDO\VLVRI/RQJ7HUP(IIHFWV 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW 3ODQ DQG ]RQLQJ RUGLQDQFHXSGDWHZLOOUHVX OW LQQ R VLJQLILFDQWFXPXODWLYH LPSDFW ZLWKUHVSHFWWRKD]DUGVDQGKD]DUGRXVPDWHULDOV 1RLVH ,PSOHPHQWDWLRQRIWKHSURSRVHGIRFXVHG*HQHUDO3ODQDQG]RQLQJRUGLQDQFHXSGDWH ZRXOGQRWJHQHUDWHQHZVWDWLRQDU\QRLVHVRXUFHVRXWVLGHRIWKHSODQQLQJDUHDDQG ZRXOG QRW WKHUHIRUH UHVXOW LQ FXPXODWLYHO\ FRQVLGHUDEOH QRLVH LPSDFWV LQYROYLQJ VWDWLRQDU\VRXUFHV$GGLWLRQDOWUDIILFYROXPHVDVVRFLDWHGZLWKIXWXUHJURZWKLQWKH SODQQLQJ DUHDZRXOGFRPELQH ZLWK UHJLRQDO WUDIILFRQPDMRULQWHUMXULVGLFWLRQD O URDGVDQGKLJKZD\VOHDGLQJWR9HUQRQ WKDWZRXOGFRQWULEXWHWRFXPXODWLYHHIIHFWV LQYROYLQJURDGZD\QRLVH&RQVLVWHQWZLWKWKHILQGLQJVRIWKHFHUWLILHG(,5WKHOHYHO RI WUDIILF QRLVHDWW ULEXWDEOH WR 9HUQRQEDVHG WULSV WKDWZLOORFFX U RXWVLGHRIWKH SODQQLQJDUHDZLOOLQ FUHDVHJUDGXDOO\RYHUDORQJ SHULRG RI WLPHDQGZRXOGQRW UHVXOWLQFXPXODWLYHO\FRQVLGHUDEOHFKDQJHVLQURDGZD\QRLVHOHYHOVLQWKHFRQWH[W RIUHJLRQDOWUDIILFJURZWK 8WLOLWLHV 7KHDQDO\VLVLQ6HFWLRQ8WLOLWLHVDVVHVVHVWKHFXPXODWLYHORQJWHUPLPSDFWRI JURZWK ZLWKLQWKH SODQQLQJ DUHD RQZDWHUVXS SO\ DQGVROLGZDVWH GLVSRVDO FDSDELOLWLHV $VFRQFOXGHGIRU ERWK RIWK HVH LVVXH DUHDV DQG FRQVLVWHQW ZLWKWKH FHUWLILHG(,5LPSDFWVZLOOEHOHVVWKDQVLJQLILFDQW &LWLHV LQWKHLPPH GLDWH DUHD XVH WKH VDPH ZDWHUVRXUFHVD QG VDPH ODQGILOOV DV 9HUQRQ %RWK ZDWHU VXSSOLHV DQGODQG ILOO VSDFH DUH GLPLQLVKLQJUHVRXUFHVLQWKH UHJLRQ&RQVHUYDWLRQDQGUHF\FOLQJHIIRUWVDUHYLJRURXVO\SXUVXHGDWORFDODQGVWDWH OHYHOV WR SURORQJ WKH OLIH RI WKHVHUH VRXUFHV )R UHVLJKW DQG SODQQLQJ UHSUHVHQW LPSRUWDQWVWUDWHJLHVWRDGGUHVVORQJWHUPVKRUWIDOOV+RZHYHURYHUWKHOLIHR IWKH IRFXVHG*HQHUDO3ODQDQG]RQLQJRUGLQDQFHXSGDWHWKHVHUHVRXUFHVDUHDQWLFLSDWHG WREHFRPHLQFUHDVLQJO\VWUHVVHG7KHFHUWLILHG(,5FRQFOXGHGWKDWFRQVHUYDWLYHO\ FXPXODWLYHORQJWHUPLPSDFWVVKRXOGEHFRQVLGHUHGVLJQLILFDQW 7UDQVSRUWDWLRQ 7KH6&$*UHJLRQDOWUDIILFPRGHOZDVXVHGWRDVVHVVLPSDFWDFFRXQWVIRUUHJLRQDO FXPXODWLYHJURZWK%DVHGRQWKHDQDO\VLVFRQWDLQHGLQ6HFWLRQ7UDQVSRUWDWLRQ RI WKLV(, 5 ORQJWHUP LPSOHPHQWDWLRQ RIWKHIRFXVHG*HQ HUDO 3ODQ DQG ]RQLQJ RUGLQDQFHXSGDWHDQGFXPXODWLYHUHJLRQDOJURZWKZLOOUHVXOWLQWKHUHGXFWLRQRIWKH OHYHO RIVHUYL FH /26 WR/ 26 )IU RP WKH SUHYLRXV *HQHUDO3ODQSULRUWR PLWLJDWLRQDWWKHIROORZLQJLQWHUVHFWLRQV 6RWR6WUHHWDW9HUQRQ$YHQXH 'RZQH\5RDGDW%DQGLQL%RXOHYDUG $OWKRXJK WKHSURSR VHG XSGDWH ZRXOGQR W VXEVWDQWLDOO\ LQFUHDVH IXWXUH SURMHFWHG LPSDFWV FRPSDUHG WR WKH FXUUHQW *HQHUDO 3ODQ LQWHUVHFWLRQV DUH SURMHFWHGWRRSHUDWHDW/26(DQG)LQ WKHDEVHQFHRIDQ\ LPSURYHPHQWVWRWKH FLUFXODWLRQQHWZRUN $QDO\VLVRI/RQJ7HUP(IIHFWV )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH ,PSOHPHQWDWLRQRIPLWLJDWLRQPHDVXUHVLGHQWLILHGLQWKH3URJUDP(,5PD\DOORZWKH &LW\WRPDLQWDLQLWVOHYHORIVHUYLFHREMHFWLYHVIRUWKHORFDOURDGQHWZRUNRYHUWKH ORQJ WHUP)XQGLQJ KDVEHHQ VHFXUHG DQG LPSOHPHQWDWLRQ RIWKH/ RV $QJHOHV &RXQW\ $XWRPDWHG 7UDIILF6XU YHLOODQFH DQG &RQWURO6\VWH P $76$& KDV EHJXQ +RZHYHU QR IXQGLQJ KDVEHHQLGHQWLILHG IRU PLWLJDWLRQ PHDVXUHV OLVWHG LQWKH 3URJUDP(,57KHRQO\RWKHUIXQGHGLPSURYHPHQWLVWKH H[WHQVLRQRIWK6WUHHW ZKLFKKDVEHHQFRPSOHWHGVLQFH )XUWKHUWKHUHVSRQVLELOLW\RIIXQGLQJDQG FRPSOHWLQJ , LPSURYHPHQWV OLHV ZLWK &DOWUDQV $VVX FK FRQVWUXFWLRQ RIWKH EULGJHDQGIUHHZD\LPSURYHPHQWVFDQQRWEHJXDUDQWHHGDVWUDIILFLPSDFWPLWLJDWLRQ PHDVXUHVIRUWKHSXUSRVHVRIWKLV(,57KHQXPEHURILQWHUVHFWLRQVSURMHFWHGWR RSHUDWHDWDOHYHORIVHUYLFHZ RUVHWKDQWKH&LW\¶VDGRSWHGPLQLPXPRI/26'ZLOO UHPDLQ WKH VDPH DV WKHFHUWLILHG* HQHUDO 3ODQ EXWZLOOLQFUHDVHIURP LQWHUVHFWLRQVGXULQJH[LVWLQJFRQGLWLRQVWRZLWKLPSOHP HQWDWLRQRIWKHSURSRVHG *HQHUDO3ODQDQG]RQLQJRUGLQDQFHXSGDWH7KHSURSRVHG*HQHUDO3ODQ8SGDWHZLOO QRWUHVXOWLQVXEVWDQWLDOFKDQJHVLQORQJWHUPWUDIILFLPSDFWVZKHQFRPSDUHGWRWKH DQDO\VLV SURYLGHG LQ WKHFHUWLILHG(,5DV GLVFXVVHG LQ6HFWLR Q , PSDFWV ZLOO UHPDLQsignificant and unavoidable Growth-Inducing Impacts *URZWKLQGXFLQJ HIIHFWVLQ FOXGH ZD\VLQZKLFKWKHSURSRVHG*HQHUD O 3ODQDQ G ]RQLQJ RUGLQDQFH XSGDWH FRXOG IRVWHU HFRQRPLF RU SRSXODWLRQ JURZWKRUWKH FRQVWUXFWLRQRIDGGLWLRQDOKRX VLQJHLWKHUGLUHFWO\RULQGLUHFWO\LQWKHVXUURXQGLQJ HQYLURQPHQW$SULPHH[D PSOHLVDPDMRULQIUDVWUXFWXUHSURMHFWRUURDGH[WHQVLRQ ZKLFK SURYLGHV XUEDQ VHUYLFH FDSDFLWLHV WRFXUUHQWO\XQG HYHORSHG DUHDV WKXV UHPRYLQJDQREVWDFOHWRSRSXODWLRQJURZWK 7KHSURSRVHG*HQHUDO3ODQDQG]RQLQJRUGLQDQFHXSGDWHLVVSHFLILFDOO\LQWHQGHGWR SURYLGH IRU WKH RUGHUO\JUR ZWK RIWKH SODQQLQJ DUHD WR DFKLHYHHFRQRPLF HQYLURQPHQWDODQGTXDOLW\RIOLIHEHQHILWV1RWKLQJLQWKH*HQHUDO3ODQDQG]RQLQJ RUGLQDQFH XSGDWHSURSR VHV QHZ LQIUDVWUXFWXUH V\VWHPV WRIDFLOLWDWHJURZWK RI XQGHYHORSHGDUHDVWKDWZHUHQRWSURSRVHGLQWKHH[LVWLQJ*HQHUDO3ODQ7KHUHDUH QR SURSRVHG SROLFLHVUHJXODWLR QV RURUG LQDQFHV WKDW DUHSDUWRIWKH SURMHFW RU LPSOLHG E\WKH*HQHUDO3ODQD QG ]RQLQJ RUGLQDQFH XSGDWHW KDW ZLOOH QFRXUDJH RU HQDEOHVLJQLILFDQWO\KLJKHUOHYHOVRIJURZWKWKDQKDYHEHHQ DQWLFLSDWHGLQUHJLRQDO IRUHFDVWVE\6&$*,PSURYHPHQWVWRWKHURDGVWRUPGUDLQSRWDEOHZDWHUDQG VHZHU V\VWHPVLQ FOXGLQJ WKRVH OLVWHG LQ WKLV 6XSSOHPHQWDO (,5 DUH LQWHQGHG WR DFKLHYH GHVLUHG OHYHOVRI VHUYLFH DVJURZ WK RFFXUV UDWKHU WKDQ IDFLOLWDWH JURZWK EH\RQG ZKDW LVS ODQQHG IRU LQ WKH H[LVWLQJ *HQHUDO 3ODQ 3URMH FWV SHUPLWWHG SXUVXDQW WR ODQGXVHSROL F\ ZLOO SURYLGH IRUDG GLWLRQDO KRXVLQJ DQ HPHUJHQF\ VKHOWHU DQH[SDQGH G FRPPHUFLDO GLVWULFW VODXJKWHULQJDQG UHQGHULQJ XVHDQ G WUXFNLQJDQGIUHLJKWWHUPLQDOV Energy Conservation Introduction 7KLVHQHUJ\FRQVHUYDWLRQDQDO\VLVKDVEHHQSUHSDUHGSXUVXDQWWR&DOLIRUQLD3XEOLF 5HVRXUFHV&RGH6HFWLRQEDQG$SSHQGL[)RIWKH&(4$*XLGHOLQHV $QDO\VLVRI/RQJ7HUP(IIHFWV 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW 7KHSXUSRVHRIWKLVDQDO\VLVLVWRDVVH VVWKHVKRUWDQGORQJWHUPHQHUJ\GHPDQ G RIWKHSURSRVHGSURMHFWLGHQWLI\SURSRVHGDQGUHTXLUHGFRQVHUYDWLRQPHDVXUHVDQG DVVHVVWKHH[WHQWWRZKLFKWKHSURSRVHGSURMHFWZRXOGFRQVHUYHHQHUJ\3URMHFW HQHUJ\ GHPDQG ZLOOQRW EH ZDVWHIXO LQHIILFLHQW RUXQQ HFHVVDU\ LI LWGRH V QRW LQFUHDVHHQHUJ\GHPDQGRYHUW\SLFDOFRQVWUXFWLRQDQGRSHUDWLQJUHTXLUHPHQWV $SSHQGL[)RIWKH6WDWH&(4$*XLGHOLQH VVWDWHVWKDWWKHJRDORIDVVHVVLQJHQHUJ\ FRQVHUYDWLRQLQDSURMHFWLVWR HQVXUHWKHZLVHDQGHIILFLHQWXVHRIHQHUJ\(QHUJ\ HIILFLHQF\ LV DFKLHYHG E\GH FUHDVLQJ HQHUJ\ FRQVXPSWLRQ GHFUHDVLQJ UHOLDQFH RQ IRVVLOIXHOVDQGLQFUHDVLQJUHOLDQFHRQUHQHZDEOHHQHUJ\VRXUFHV7KHJXLGHOLQHV IRU DQDO\VLVRIHQHUJ\FRQ VHUYDWLRQ SURYLGHG LQ $SSHQGL[ ) RIWKH 6WDWH &(4$ *XLGHOLQHVDUHSURYLGHGKHUHLQ CEQA Appendix F: Energy Conservation , ,QWURGXFWLRQ 7KHJRDORIFRQVHUYLQJHQHUJ\LPSOLHVWKHZLVHDQGHIILFLHQWXVHRIHQHUJ\ 7KHPHDQVRIDFKLHYLQJWKLVJRDOLQFOXGH GHFUHDVLQJRYHUDOOSHUFDSLWDHQHUJ\FRQVXPSWLRQ GHFUHDVLQJUHOLDQFHRQIRVVLOIXHOVVXFKDVFRDOQDWXUDOJDVDQGRLODQG LQFUHDVLQJUHOLDQFHRQUHQHZDEOHHQHUJ\VRXUFHV ,Q RUGHUWRDVVXUH WKDWHQHUJ\LPS OLFDWLRQV DUH FRQVLGHUHG LQSUR MHFW GHFLVLRQVWKH&DOLIRUQLD(QYLURQPHQWDO4XDOLW\$FWUHTXLUHVWKDW(,5VLQFOXGH D GLVFXVVLRQRIWK H SRWHQWLDOHQHUJ\ LPSDFWV RI SURSRVHG SURMHFWV ZLWK SDUWLFXODU HPSKDVLVRQDYR LGLQJ RU UHGXFLQJ LQHIILFLHQW ZDVWHIXODQG XQQHFHVVDU\ FRQVXPSWLRQ RIHQHUJ\VHH3XEOLF5HVRXUFHV&RGHVHFWLRQ E(QHUJ\FRQVHUYDWLRQLPSOLHVWKDWDSURMHFW¶VFRVWHIIHFWLYHQHVV EHUHYLHZHGQRWRQO\LQ GROODUVEXW DOVRLQWHUPVRIHQHUJ\UHTXLUHPHQWV )RU PDQ\ SURMHFWV FRVWHIIHFWLYHQHVVPD \ EHGHWHUPLQHGPR UH E\HQH UJ\ HIILFLHQF\WKDQE\LQLWLDOGROODUFRVWV$OHDGDJHQF\PD\FRQVLGHUWKHH[WHQW WR ZKLFK DQ HQHUJ\ VRXUFH VHUYLQJ WKH SURMHFW KDV DOUHDG\ XQGHUJRQH HQYLURQPHQWDOUHYLHZWKDWDGHTXDWHO\DQDO\]HGDQGPLWLJDWHGWKHHIIHFWVRI HQHUJ\SURGXFWLRQ ,, (,5&RQWHQWV 3RWHQWLDOO\VLJQLILFDQWHQHUJ\LPSOLFDWLRQVRIDSURM HFWVKDOOEHFRQVLGHUHGLQ DQ(,5WRWKHH[WHQWUHOHYDQWDQGDSSOLFDEOHWRWKHSURMHFW7KHIROORZLQJOLVW RI HQHUJ\ LPSDFW SRVVLELOLWLHV DQGSR WHQWLDO FRQVHUYDWLRQ PHDVXUHV LV GHVLJQHGWRDVVLVWLQ WKHSUHSDUDWLRQRIDQ(,5,QPDQ\LQVWDQFHV VSHFLILF LWHPVPD\QRWDSSO\RUDGGLWLRQ DOLWHPVPD\EHQHHGHG:KHUHLWHP VOLVWHG EHORZDUHDSSOLFDEOHRUUHOHYDQWWRWKHSURMHFWWKH\VKRXOGEHFRQVLGHUHGLQ WKH(,5 $QDO\VLVRI/RQJ7HUP(IIHFWV )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH $ 3URMHFW'HVFULSWLRQPD\LQFOXGHWKHIROORZLQJLWHPV (QHUJ\ FRQVXPLQJ HTXLSPHQW DQG SURFHVVHV ZKLFK ZLOOE H XVHG GXULQJ FRQVWUXFWLRQ RSHUDWLRQ DQGRU UHPRYDO RI WKHSURM HFW ,I DSSURSULDWH WKLVGLVFXVVLRQ VKRXOG FRQVLGHU WKH HQHUJ\ LQWHQVLYHQHVVRIPDWHULDOVDQGHTXLSPHQWUHTXLUHGIRUWKHSURMHFW 7KHHIIHFWVRIWKHSURMHFWRQORFDODQGUHJLRQDOHQHUJ\VXSSOLHVDQG RQUHTXLUHPHQWVIRUDGGLWLRQDOFDSDFLW\ 7KH HIIHFWVR I WKH SURMHFW RQ SHDN DQG EDVH SHULRG GHPDQGV IRU HOHFWULFLW\DQGRWKHUIRUPVRIHQHUJ\ 7KH GHJUHH WRZKLFKWKHSURMHFWFR PSOLHV ZLWKH [LVWLQJ HQHUJ\ VWDQGDUGV 7KHHIIHFWVRIWKHSURMHFWRQHQHUJ\UHVRXUFHV 7KHSURMHFW¶VSURMHFWHGWUDQVSRUWDWLRQHQHUJ\XVHUHTXLUHPHQWVDQG LWVRYHUDOOXVHRIHIILFLHQWWUDQVSRUWDWLRQDOWHUQDWLYHV % 0LWLJDWLRQ0HDVXUHVPD\LQFOXGH 3RWHQWLDOPHDVXUHVWRUHGXFHZDVWHIXOLQHIILFLHQWDQGXQQHFHVVDU\ FRQVXPSWLRQRIHQHUJ\GXULQJFRQVWUXFWLRQRSHUDWLRQPDLQWHQDQFH DQGRU UHPRYDO 7KH GLVFXVVLRQ VKRXOG H[SODLQ ZK\FHUWDLQ PHDVXUHVZHUHLQFRUSRUDWHGLQWKHSURMHFWDQGZK\RWKHUPHDVXUHV ZHUHGLVPLVVHG 7KHSRWHQWLDORI VLWLQJRULHQWDWLRQDQGGHVLJQWRP LQLPL]HHQHUJ\ FRQVXPSWLRQ LQFOXGLQJ WUDQVSRUWDWLRQ HQHUJ\ LQFUHDVH ZDWHU FRQVHUYDWLRQDQGUHGXFHVROLGZDVWH 7KHSRWHQWLDOIRUUHGXFLQJSHDNHQHUJ\GHPDQG $OWHUQDWLYHIXHOVSDUWLFXODUO\UHQHZDEOHRQHVRUHQHUJ\V\VWHPV (QHUJ\FRQVHUYDWLRQZKLFKFRXOGUHVXOWIURPUHF\FOLQJHIIRUWV & $OWHUQDWLYHV VKRXOG EH FRPSDUHG LQ WHUPV RI RYHUDOO HQHUJ\ FRQVXPSWLRQ DQGLQWHUPV RI UHGXFLQJ ZDVWHIXO LQHIILFLHQW DQG XQQHFHVVDU\FRQVXPSWLRQRIHQHUJ\ ' 8QDYRLGDEOH $GYHUVH (IIHFWV PD\ LQFOXGH ZDVWHIXO LQHIILFLHQWDQG XQQHFHVVDU\ FRQVXPSWLRQRIHQHUJ\ GXULQJ WKHSURMHFW FRQVWUXFWLRQ RSHUDWLRQ PDLQWHQDQFH DQGRU UHPRYDO WKDW FDQQRW EH IHDVLEO\ PLWLJDWHG ( ,UUHYHUVLEOH&RPPLWPHQWRI5HVRXUFHVPD\LQFOXGHDGLVFXVVLRQRIKRZ WKH SURMHFW SUHHPSWV IXWXUHH QHUJ\ GHYHORSPHQW RU IXWXUH HQHUJ\ FRQVHUYDWLRQ ) 6KRUW7HUP JDLQV YHUVXV /RQJ7HUP ,PSDFWV FDQ EHFRP SDUHG E\ FDOFXODWLQJWKHSURMHFW¶VHQHUJ\FRVWVRYHUWKHSURMHFW¶VOLIHWLPH * *URZWK,QGXFLQJ (IIHFWV PD\ LQFOXGH WKH HVWLPDWHG HQHUJ\ FRQVXPSWLRQRIJURZWKLQGXFHGE\WKHSURMHFW $QDO\VLVRI/RQJ7HUP(IIHFWV 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW Energy Demand 6KRUWWHUPHQHUJ\GHPDQGZRXOGUHVXOWIURPGHYHORSPHQWFRQVWUXFWLRQSXUVXDQW WR LPSOHPHQWDWLRQ RI WKHS URSRVHG SURMHFW 7KLV ZRXOG LQFOXGHHQHUJ\ GHPDQG IURP ZRUNHUDQG YHQGRU YHKLFOH WULSVDQ G FRQVWUXFWLRQ HTXLSPHQWXVDJH/RQJ WHUP HQHUJ\GHPDQ G ZRXOGUHVXOW IURP RSHUDWLRQ RIYDULRX V GHYHORSPHQW W\SHV SXUVXDQW WR LPSOHPHQWDWLRQ RI WKHSUR SRVHG *HQHUDO 3ODQD QG ]RQLQJ RUGLQDQFH XSGDWH7KLVZRXOGW\SLFDOO\LQFOXGHHQHUJ\GHPDQGIURPYHKLFOHWULSVHOHFWULFLW\ DQG QDWXUDOJD V XVDJH DQG ZDWHU DQG ZDVWHZDWHUFRQYH \DQFH 7K LV VHFWLRQ JHQHUDOO\GHVFULEHVWKHHQHUJ\QHHGVRIWKHVHDFWLYLWLHV Construction Activities 7KHSURSRVHG*HQHUDO3ODQDQ G]RQLQJRUGLQDQFHXSGDWHZLOOQRWGLUH FWO\UHVXOWLQ FRQVWUXFWLRQ RIDQ\ GHYHORSPHQW RU LQIUDVWUXFWXUH KRZHYHU IXWXUHG HYHORSPHQW VXSSRUWHG E\WKHSROLFLHVR I WKH*HQHUDO3ODQZLOOUHVX OW LQVKRUWWH UP HQHUJ\ GHPDQG6KRUWWHUPHQHUJ\GHPDQGZLOORFFXUGXULQJVLWHSUHSDUDWLRQJUDGLQJ EXLOGLQJ FRQVWUXFWLRQ SDYLQJ DQGS DLQWLQJ DFWLYLWLHV DVVRFLDWHG ZLWKQ HZ GHYHORSPHQW(QHUJ\GHPDQGUHVXOWVIURPXVHRIHTXLSPHQWZRUNHUYHQGRUDQG KDXOLQJWULSV Operational Activities 7KHSURSRVHG*HQHUDO3ODQDQ G]RQLQJRUGLQDQFHXSGDWHZLOOQRWGLUH FWO\UHVXOWLQ RSHUDWLRQ RIDQ\GH YHORSPHQW RULQIUDVWUXFWXUH KRZHYHU IXWXUH GHYHORSPHQW VXSSRUWHG E\WKH SROLFLHV RI WKH* HQHUDO 3ODQ ZLOO UHVXOW LQO RQJWHUP HQHUJ\ GHPDQG /RQJWHUP HQHUJ\ GHPDQG ZLOO RFFXU SULPDULO\ IURPP RELOH VRXUFHV HOHFWULFLW\DQGQDWXUDOJDVXVHDQGZDWHUDQGZDVWHZDWHU Mobile Sources 0RELOHVRXUFHHQHUJ\GHPDQGSULPDULO\LVDVVRFLDWHGZLWKLQGLYLGXDOYHKLFOHHQHUJ\ GHPDQG DQG WKHUHIRUH JDVROLQH DQGG LHVHO IXHO SULPDULO\ DV ZHOOD V HOHFWULFLW\ LQFUHDVLQJO\ IRU HOHFWULF YHKLFOHV 0RE LOH VRXUFH HQHUJ\ GHPDQG PD\ DOVREH DVVRFLDWHG ZLWK SXEOLF WUDQVSRUWDWLRQ VXFK DV EXVHV DQG WUDLQVDVVRFLDWHG ZLWK QDWXUDO JDV GLHVHO IXHORUHOHFWULFLW\2IDOORS HUDWLRQDO HQHUJ\GH PDQGV WKH SURSRVHG *HQHUDO 3ODQ DQG]R QLQJ RUGLQDQFH XSGDWH VHHNV PRVW WR UHGXFH WKH HQHUJ\GHPDQGRIPRELOHVRXUFHVWKURXJKLPSURYHGODQGXVHDQGFLUFXODWLRQ QHWZRUN SODQQLQJ WR UHGXFHUHOLDQFHRQ LQGLYLGXDOYHKLFOH V DQGSURPRWH XVHRI SXEOLFWUDQVSRUWDWLRQDVZHOODVQRQPRWR UL]HGWUDQVSRUWDWLRQVXFKDVZDONLQJDQG ELNLQJ%\VHHNLQJWRUHGXFHWKHDPRXQWRILQGLYLG XDOYHKLFOHXVDJHWKHSURSRVHG *HQHUDO 3ODQDQG]RQLQJRUGLQ DQFH XSGDWH ZRXOG DFKLHYH UHGXFWLRQV LQPRELOH VRXUFHRSHUDWLRQDOHQHUJ\GHPDQG Electricity and Natural Gas Use (OHFWULFLW\ DQG QDWXUDOJDVZR XOG EHUHT XLUHG WRS URYLGH HQHUJ\ WRWKH SURSRVHG GHYHORSPHQWRIUHVLGHQWLDOFRPPHUFLDOLQGXVWULDODQGRWKHUODQGXVHVSURYLGHGIRU LQWKHSURSRVHG*HQHUDO3ODQDQG]RQLQJRUGLQDQFHXSGDWH$OOQHZGH YHORSPHQW DQG UHGHYHORSPHQW ZRXOG EH VXEMHFW WR FXUUHQW &%& UHTXLUHPHQWVIRUEXLOGLQ J HQHUJ\ HIILFLHQF\ 2WKHURSS RUWXQLWLHV ZRXOG DOVRFRQWLQX H WREHDYDLOD EOH WR $QDO\VLVRI/RQJ7HUP(IIHFWV )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH H[LVWLQJDQGQHZGHYHORSPHQWWRLQFRUSRUDWHHQHUJ\VDYLQJIHDWXUH VRUUHQHZDEOH HQHUJ\VRXUFHVLQWREXLOGLQJV Water and Wastewater (OHFWULFLW\ ZLOOLQGLUH FWO\ EH UHTXLUHG WRWUHDW DQG FRQYH\ ZDWHU WR DQG FRQYH\ ZDVWHZDWHU IURPGH YHORSPHQW WKDWLPSOHPHQWVWK H SURSRVHG *HQHUDO3ODQDQG ]RQLQJRUGLQDQFHXSGDWH 3XUVXDQWWRWKH:DWHU&RQVHUYDWLRQLQ/DQGVFDSLQJ$FW RXWGRRU ZDWHU XVH ZLOO FRQWLQXH WR EH UHJXODWHG IRU QHZ GHYHORSPHQW WR SODQ ODQGVFDSLQJDFFRUGLQJO\DQGFRQVHUYHZDWHU Energy Conservation 7KH SURMHFWZLOOEHVXEMHFWWR VWDWH ZDWHU HIILFLHQF\ UHJXODWLRQV SXUVXDQW WRWKH &DOLIRUQLD %XLOGLQJ &RGH &%&WK DW ZLOO UHGXFH ORQJWHUPSURMHFW HQHUJ\ GHPDQG7KHVHUHTXLUHPHQWVZRXOGUHGXFHZDVWHIXOLQHIILFLHQWDQGX QQHFHVVDU\ FRQVXPSWLRQRIHQHUJ\RYHUWKHORQJWHUP California Building Code 3XUVXDQWWRWKH&%&&$/*5((1UHTXLU HPHQWVWKHSURMHFWZLOOEHVXEMHFWWR WKHIROORZLQJUHTXLUHPHQWV SHUFHQWUHGXFWLRQLQZDWHUGHPDQG SHUFHQWUHGXFWLRQLQZDVWHZDWHUGLVFKDUJHV Reduce Water and Wastewater Demand (5.303.2 & 5.303.4) 7KHPLQLPXPSHUFHQWUHGXFWLRQ LQZDWHUGHP DQGDQGZDVWHZDWHU GLVFKDUJHV ZRXOGGHFUHDVHLQGRRUZDWHUGHPDQG7KLVZRXOGUHVXOWLQDFRQFXUUHQWUHGXFWLRQ LQHQHUJ\GHPDQGWRVXSSO\WUHDWDQGFRQYH\ZDWHUDQGZDVWHZDWHU Conclusion 7KHFRQVHUYDWLRQRIHQHUJ\ZLOOUHVXOWIUR PLPSOHPHQWDWLRQRIWKH&%&5HJLRQDO *UHHQKRXVH*DV,QYHQWRU\DQG5HGXFWLRQ3ODQDQG*HQHUDO3ODQSROLFLHVVHHNLQJWR PD[LPL]HWKHXVHRIFOHDQDQGDOWHUQDWLYHIXHODQGSRZHU:LWKLPSOHPHQWDWLRQRI H[LVWLQJ UHJXODWLRQV DQG SURSRVHG SROLFLHV HQHUJ\ GHPDQG IRU GHYHORSPHQW WKDW LPSOHPHQWV WKHSUR SRVHG *HQHUDO 3ODQ DQG ]RQLQJ RUGLQDQFH XSGDWHZLOOQRWE H ZDVWHIXOLQHIILFLHQWRUXQQHFHVVDU\ Significant Irreversible Environmental Changes 2YHUWKHORQJWHUPGHYHORSPHQWSURMHFWVSXUVXHGFRQVLVWHQWZLWKXSGDWHG*HQHUDO 3ODQODQGXVH SROLF\DQGWKHUHYLVHG=RQLQJ2UGLQDQFHSURYLVLRQVZLOOUHVXOWLQWKH FRQVXPSWLRQRIQRQUHQHZDEOHUHVRXUFHVVXFKDVFRQVWUXFWLRQPDWHULDOVDQGRQFH SURMHFWVDUHRSHUDWLRQDOWKHXVHRIHQHUJ\UHVRXUFHVIRUKHDWLQJFRROLQJLQGXVWU\ WUDQVSRUWDWLRQHWF7KLVXVHZLOOKDYHDQLUUHYHUVLEOHHIIHFWRQVXFKUHVRXUFHV 7KH XSGDWHG *HQHUDO 3ODQ DQG UHYLVHG=RQ LQJ 2UGLQDQFH FRXOG UHVXOWLQ GHYHORSPHQWRIXUEDQXVHVLQWKHIHZUHPDLQLQJORWVLQWKH&LW\WKDWDUHFXUUHQWO\ $QDO\VLVRI/RQJ7HUP(IIHFWV 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW YDFDQW 2QFH GHYHORSHG UHYHUVLRQ WR D OHVVXUE DQ XVHRURSHQVSD FH LVK LJKO\ XQOLNHO\ 7KHLUUHYHUVLEOHFRPPLWPHQWRIOLPLWHGUHVRXUFHVLVLQKHUHQWLQDQ\GH YHORSPHQW SURMHFW RU LQWKHFDVHR I WKH*HQHUDO3ODQX SGDWH FXPXODWLYHGHYHORSPHQW SURMHFWV5HVRXUFHVDQWLFLSDWHGWREHLUUHYHUVLEO\FRPPLWWHGRYHUWKHDSSUR[LPDWH \HDUOLIHRIWKH*HQHUDO3ODQXSGDWHLQFOXGHEXWDUHQRWOLPLWHGWROXPEHUDQG RWKHU UHODWHG IRUHVWSURGXFWVVDQGJUDYH O DQGFRQFUH WH SHWURFKHPLFDOV FRQVWUXFWLRQ PDWHULDOV VWHHO FRSSHU OHDGDQ G RWKHU PHWDOV DQG ZDWHU ,PSOHPHQWDWLRQRIWKH*HQHUDO3ODQXSGDWHUHSUHVHQWVDORQJWHUPFRPPLWPHQWWR WKHFRQVXPSWLRQRIIRVVLOIXHORLODQGQDWXUDOJDV Unavoidable Significant Environmental Impacts &RQVLVWHQW ZLWKWK H FHUWLILHG *HQHUDO 3ODQ (,5LPSOHP HQWDWLRQRI WKHXSGDWH G *HQHUDO3ODQDQGUHYLVHG=RQ LQJ2UGLQDQFHZLOOUHVXOWLQWKHIROORZLQJVLJQLILFDQW XQDYRLGDEOHSURMHFWOHYHODQGFXPXODWLYHLPSDFWV $LU4XDOLW\&XPXODWLYH 7UDIILF&XPXODWLYHLPSDFWRQVXUIDFHVWUHHWVDQG,QWHUVWDWH 8WLOLWLHV&XPXODWLYHLPSDFWRQZDWHUDQGODQGILOOUHVRXUFHV ,QWURGXFWLRQ ([HFXWLYH6XPPDU\ 3URMHFW'HVFULSWLRQ (QYLURQPHQWDO,PSDFW$QDO\VLV $OWHUQDWLYHV $QDO\VLVRI/RQJ7HUP(IIHFWV (IIHFWV)RXQG1RWWREH6LJQLILFDQW 3UHSDUDWLRQ7HDP ,QWURGXFWLRQ ([HFXWLYH6XPPDU\ 3URMHFW'HVFULSWLRQ (QYLURQPHQWDO,PSDFW$QDO\VLV $OWHUQDWLYHV $QDO\VLVRI/RQJ7HUP(IIHFWV (IIHFWV)RXQG1RWWREH6LJQLILFDQW 3UHSDUDWLRQ7HDP 5HIHUHQFHV 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW Effects Found Not to Be Significant 7.0 &(4$ *XLGHOLQHV 6HFWLRQ UHTXLUHV D VWDWHPHQW LQGLFDWLQJWKHUH DVRQ WKDW YDULRXV SRVVLEOH VLJQLILFDQW HIIHFWV DUH GHWHUPLQHG QRWWREH VLJQLILFDQW DQG WKHUHIRUHDUHQRWGLVFXVVHGLQWKH(,57K H,QLWLDO6WXG\SUHSDUHGIRUWKH&LW\ RI 9HUQRQ )RFXVHG *HQHUDO 3ODQ DQG =RQLQJ 2UGLQDQFH 8SGDWH DQG FLUFXODWHG RQ 6HSWHPEHUGHWHUPLQHGWKDWWKHLPSDFWVOLVWHGEHORZZRXOGQRWRFFXURU ZRXOG EH OHVVWKD Q VLJQLILFDQW WKHUHIRUHWKHVH WRSLFVKDYHQRWE HHQ IXUWKHU DQDO\]HGLQWKLV6(,53OHDVHUHIHUWR$SSHQGL[$,QLWLDO6WXG\IRUH[SODQDWLRQVRI WKHEDVLVIRUWKHVHFRQFOXVLRQV Aesthetics x 6FHQLF9LVWDV±1R,PSDFW x 6FHQLF5HVRXUFHV±1R,PSDFW x 9LVXDO&KDUDFWHU±1R,PSDFW Agriculture Resources x )DUPODQG0DSSLQJDQG0RQLWRULQJ3URJUDP±1R,PSDFW x $JULFXOWXUDO=RQLQJDQG/DQG8VH±1R,PSDFW x )DUPODQG&RQYHUVLRQ±1R,PSDFW Biological Resources x 6HQVLWLYH1DWXUDO&RPPXQLWLHV±1R,PSDFW x :HWODQGV±1R,PSDFW x :LOGOLIH0LJUDWLRQ±1R,PSDFW x &RQVHUYDWLRQ3ODQQLQJ±1R,PSDFW Cultural Resources x +LVWRULFDO5HVRXUFHV±/HVVWKDQ6LJQLILFDQW,PSDFW x $UFKDHRORJLFDO5HVRXUFHV±/HVVWKDQ6LJQLILFDQW,PSDFW x 3DOHRQWRORJLFDO5HVRXUFHV±1R,PSDFW x +XPDQ5HPDLQV±1R,PSDFW Geology and Soils x 6XUIDFH)DXOW5XSWXUH±/HVVWKDQ6LJQLILFDQW,PSDFW x 6WURQJ6HLVPLF*URXQG6KDNLQJ±/HVVWKDQ6LJQLILFDQW,PSDFW x /LTXHIDFWLRQ±/HVVWKDQ6LJQLILFDQW,PSDFW x /DQGVOLGHV±1R,PSDFW x /RVVRI7RSVRLO±/HVVWKDQ6LJQLILFDQW,PSDFW x ([SDQVLYH6RLOV±/HVVWKDQ6LJQLILFDQW,PSDFW x 6HSWLF7DQNV±1R,PSDFW Hydrology and Water Quality x :DWHUDQG:DVWHZDWHU6WDQGDUGV±/HVVWKDQ6LJQLILFDQW,PSDFW x *URXQGZDWHU6XSSOLHVDQG5HFKDUJH±/HVVWKDQ6LJQLILFDQW,PSDFW (IIHFWV1RW)RXQGWREH6LJQLILFDQW )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH x 2Q±DQG2II6LWH(URVLRQ±/HVVWKDQ6LJQLILFDQW,PSDFW x 2QDQG2II6LWH)ORRGLQJ±/HVVWKDQ6LJQLILFDQW,PSDFW x 6WRUP'UDLQ&DSDFLW\DQG5XQRII±/HVVWKDQ6LJQLILFDQW,PSDFW x <HDU)ORRGLQJDQG+RXVLQJ±/HVVWKDQ6LJQLILFDQW,PSDFW x ,PSHGDQFH RU 5HGLUHFWLRQ RI <HDU )ORRGLQJ ±/H VV WKDQ6LJQ LILFDQW ,PSDFW x 'DPRU/HYHH)DLOXUH±/HVVWKDQ6LJQLILFDQW,PSDFW x 6HLFKH7VXQDPLRU0XGIORZ±1R,PSDFW x 6WRUPZDWHU9HORFLW\DQG5XQRII±/HVVWKDQ6LJQLILFDQW,PSDFW Land Use and Planning x 'LYLVLRQRI&RPPXQLWLHV±1R,PSDFW x 3ODQQLQJ&RQIOLFWV±/HVVWKDQ6LJQLILFDQW,PSDFW x &RQVHUYDWLRQ3ODQQLQJ±1R,PSDFW Mineral Resources x /RVVRI0LQHUDO5HVRXUFHV±1R,PSDFW Population and Housing x 3RSXODWLRQ*URZWK±/HVVWKDQ6LJQLILFDQW,PSDFW x 'LVSODFHPHQWRI+RXVLQJ±1R,PSDFW x 'LVSODFHPHQWRU3HRSOH±1R,PSDFW Public Services x 6FKRROV±/HVVWKDQ6LJQLILFDQW,PSDFW x 3DUNV±/HVVWKDQ6LJQLILFDQW,PSDFW x 2WKHU6HUYLFHV±/HVVWKDQ6LJQLILFDQW,PSDFW Recreation x 'HWHULRUDWLRQRI)DFLOLWLHV±/HVVWKDQ6LJQLILFDQW,PSDFW x ([SDQVLRQRI)DFLOLWLHV±/HVVWKDQ6LJQLILFDQW,PSDFW ,QWURGXFWLRQ ([HFXWLYH6XPPDU\ 3URMHFW'HVFULSWLRQ (QYLURQPHQWDO,PSDFW$QDO\VLV $OWHUQDWLYHV $QDO\VLVRI/RQJ7HUP(IIHFWV (IIHFWV)RXQG1RWWREH6LJQLILFDQW 3UHSDUDWLRQ7HDP 5HIHUHQFHV ,QWURGXFWLRQ ([HFXWLYH6XPPDU\ 3URMHFW'HVFULSWLRQ (QYLURQPHQWDO,PSDFW$QDO\VLV $OWHUQDWLYHV $QDO\VLVRI/RQJ7HUP(IIHFWV (IIHFWV)RXQG1RWWREH6LJQLILFDQW 3UHSDUDWLRQ7HDP 5HIHUHQFHV 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW Preparation Team 8.0 Lead Agency &LW\RI9HUQRQ 6DQWD)H$YHQXH 9HUQRQ&DOLIRUQLD 6.HYLQ:LOVRQ'LUHFWRURI&RPPXQLW\6HUYLFHVDQG:DWHU Environmental Analysis 0,*_+RJOH,UHODQG,QF ,RZD$YHQXH6XLWH 5LYHUVLGH&DOLIRUQLD /DXUD6WHWVRQ3ULQFLSDO &KULVWRSKHU%URZQ'LUHFWRURI(QYLURQPHQWDO6HUYLFHV 5XVVHOO%UDG\3URMHFW$VVRFLDWH *HQHYLHYH6KDUURZ3URMHFW$VVRFLDWH 2OLYLD<RXQJ3URMHFW$VVRFLDWH Transportation and Traffic .XQ]PDQ$VVRFLDWHV 7RZQ &RXQWU\5RDG6XLWH 2UDQJH&DOLIRUQLD :LOOLDP.XQ]PDQ3(3ULQFLSDO &DUO%DOODUG/(('*$3ULQFLSDO$VVRFLDWH 5REHUW.XQ]PDQ6HQLRU$VVRFLDWH $P\.LP(,7$VVRFLDWH 3UHSDUDWLRQ7HDP )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH 7KLV3DJH,QWHQWLRQDOO\/HIW%ODQN ,QWURGXFWLRQ ([HFXWLYH6XPPDU\ 3URMHFW'HVFULSWLRQ (QYLURQPHQWDO,PSDFW$QDO\VLV $OWHUQDWLYHV $QDO\VLVRI/RQJ7HUP(IIHFWV (IIHFWV)RXQG1RWWREH6LJQLILFDQW 3UHSDUDWLRQ7HDP 2UJDQL]DWLRQVDQG3HUVRQV&RQVXOWHG ,QWURGXFWLRQ ([HFXWLYH6XPPDU\ 3URMHFW'HVFULSWLRQ (QYLURQPHQWDO,PSDFW$QDO\VLV $OWHUQDWLYHV $QDO\VLVRI/RQJ7HUP(IIHFWV (IIHFWV)RXQG1RWWREH6LJQLILFDQW 3UHSDUDWLRQ7HDP 2UJDQL]DWLRQVDQG3HUVRQV&RQVXOWHG 6XSSOHPHQWDO(QYLURQPHQWDO,PSDFW5HSRUW Organizations and Persons Consulted 9.0 1RQH 2UJDQL]DWLRQVDQG3HUVRQV&RQVXOWHG )RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH 7KLV3DJH,QWHQWLRQDOO\/HIW%ODQN Supplemental Environmental Impact Report 6WDWH&OHDULQJKRXVH1R City of Vernon Focused General Plan and Zoning Ordinance Update /HDG$JHQF\ &LW\RI9HUQRQ 6DQWD)H$YHQXH 9HUQRQ&$ 'HFHPEHU Volume 2 Appendix A Notice of Preparation/Initial Study 7KLV3DJH,QWHQWLRQDOO\/HIW%ODQN DRAFT INITIAL STUDY City of Vernon Focused General Plan and Zoning Ordinance Update 6HSWHPEHU Lead Agency: &LW\RI9HUQRQ 'HSDUWPHQWRI&RPPXQLW\6HUYLFHV :DWHU 6DQWD)H$YHQXH 9HUQRQ&$ Consultant to the Lead Agency: +RJOH,UHODQG,QF 1RUWK5RVHPHDG%RXOHYDUG6XLWH 3DVDGHQD&$ 7KLV3DJH,QWHQWLRQDOO\/HIW%ODQN Focused General Plan and Zoning Ordinance Update i Table of Contents 1 Introduction ......................................................................................................... 1 2 Project Description ............................................................................................... 3 ± 3URMHFW7LWOH ± /HDG$JHQF\1DPHDQG$GGUHVV ± &RQWDFW3HUVRQDQG3KRQH1XPEHU ± 3URMHFW/RFDWLRQ ± 3URMHFW6SRQVRU¶V1DPHDQG$GGUHVV ± *HQHUDO3ODQ/DQG8VH'HVLJQDWLRQ ± =RQLQJ'LVWULFW ± 3URMHFW'HVFULSWLRQ ± 3URMHFW2EMHFWLYHV ± 6XUURXQGLQJ/DQG8VHV ± (QYLURQPHQWDO6HWWLQJ ± 5HTXLUHG$SSURYDOV ± 2WKHU3XEOLF$JHQFLHV:KRVH$SSURYDO,V5HTXLUHG $VVXPSWLRQV 3 Determination .................................................................................................... 19 ± (QYLURQPHQWDO)DFWRUV3RWHQWLDOO\$IIHFWHG ± 'HWHUPLQDWLRQ 4 Evaluation of Environmental Impacts ................................................................. 21 ± $HVWKHWLFV ± $JULFXOWXUHDQG)RUHVW5HVRXUFHV ± $LU4XDOLW\ ± %LRORJLFDO5HVRXUFHV ± &XOWXUDO5HVRXUFHV ± *HRORJ\DQG6RLOV ± *UHHQKRXVH*DV(PLVVLRQV ± +D]DUGVDQG+D]DUGRXV0DWHULDOV ± +\GURORJ\DQG:DWHU4XDOLW\ ± /DQG8VHDQG3ODQQLQJ ± 0LQHUDO5HVRXUFHV ± 1RLVH ± 3RSXODWLRQDQG+RXVLQJ ± 3XEOLF6HUYLFHV ± 5HFUHDWLRQ ± 7UDQVSRUWDWLRQDQG7UDIILF ± 8WLOLWLHVDQG6HUYLFH6\VWHPV ± 0DQGDWRU\)LQGLQJVRI6LJQLILFDQFH 5 References ........................................................................................................ 61 ± /LVWRI3UHSDUHUV Table of Contents ii Initial Study List of Exhibits ([KLELW5HJLRQDO&RQWH[WDQG9LFLQLW\0DS ([KLELW3URSRVHG*HQHUDO3ODQ/DQG8VH0DS ([KLELW3URSRVHG=RQLQJ0DS ([KLELW3URSRVHG+RXVLQJ6LWHV Focused General Plan and Zoning Ordinance Update 1 1Introduction 7KH&LW\RI9HUQRQ/HDG$JHQF\DGRSWHGFRPSUHKHQVLYHXSGDWHVWRWKH&LW\RI9HUQRQ*HQHUDO 3ODQDQG=RQLQJ2UGLQDQFHRQ'HFHPEHU7KH*HQHUDO3ODQLVDFRPSUHKHQVLYHORQJ UDQJHSODQWKDWJXLGHVGHFLVLRQVUHODWLQJWRODQGXVHWUDQVSRUWDWLRQKRXVLQJSXEOLFVDIHW\XVH RIRSHQVSDFHDQGQDWXUDOUHVRXUFHVSDUNVDQGUHFUHDWLRQDQGQRLVHLQWKHFRPPXQLW\7KH =RQLQJ2UGLQDQFHLPSOHPHQWVWKHODQGXVHSROLFLHVFRQWDLQHGLQWKH*HQHUDO3ODQ,QFRQMXQFWLRQ ZLWKDSSURYDORIWKH*HQHUDO3ODQDQG=RQLQJ2UGLQDQFHLQWKH9HUQRQ&LW\&RXQFLOFHUWLILHG D)LQDO3URJUDP(QYLURQPHQWDO,PSDFW5HSRUW*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH(,56WDWH &OHDULQJKRXVH 1R >6&+@ ZKLFK HYDOXDWHG DW D SURJUDP OHYHO RI DQDO\VLV WKH HQYLURQPHQWDOFRQVHTXHQFHVRIORQJWHUPLPSOHPHQWDWLRQ*HQHUDO3ODQ7KH3URJUDP(,5DOVR H[DPLQHGDOWHUQDWLYHVWRWKHSURMHFWDQGUHFRPPHQGHGPLWLJDWLRQPHDVXUHVWKDWZRXOGUHGXFHRU DYRLGWKHSURMHFW¶VVLJQLILFDQWLPSDFWV7KH*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH(,5IRXQGWKDWWKH SURMHFWZRXOGUHVXOWLQWKHIROORZLQJVLJQLILFDQWLPSDFWVWKDWFRXOGQRWEHIXOO\PLWLJDWHG WUDIILFRQORFDOVXUIDFHVWUHHWVDQGIUHHZD\VDWERWKWKHSURMHFWOHYHODQGRQDFXPXODWLYH EDVLV FXPXODWLYHDLUTXDOLW\LPSDFWV FXPXODWLYHXWLOLWLHVLPSDFWV 7KH&LW\RI9HUQRQKDVSUHSDUHGWKLV,QLWLDO6WXG\IRUXVHLQGHWHUPLQLQJZKHWKHUWKHLPSDFWV DVVRFLDWHG ZLWK WKH FXUUHQWO\ SURSRVHG *HQHUDO 3ODQ $PHQGPHQWV =RQLQJ 2UGLQDQFH $PHQGPHQWV DQG =RQLQJ 0DS FKDQJHV FROOHFWLYHO\ UHIHUUHG WR DV WKH ³SURMHFW´ RU ³3URSRVHG )RFXVHG8SGDWH´ZHUHDGGUHVVHGLQWKH*HQHUDO3ODQ(,5%DVHGRQWKHDQDO\VLVFRQWDLQHG LQWKLV,QLWLDO6WXG\WKH&LW\ZLOOGHWHUPLQHZKHWKHUDVXEVHTXHQWRUVXSSOHPHQWDO(,5±RUQR IXUWKHUUHYLHZSXUVXDQWWRWKH&DOLIRUQLD(QYLURQPHQWDO4XDOLW\$FW&(4$3XEOLF5HVRXUFHV&RGH HWVHTDQGWKH&(4$*XLGHOLQHV*RYHUQPHQW&RGHHWVHT²LVUHTXLUHG 8QGHU&(4$DVXEVHTXHQWRUVXSSOHPHQWDO(,5WRDSUHYLRXVO\FHUWLILHG(,5LVUHTXLUHGLIRQHRU PRUHRIWKHIROORZLQJFLUFXPVWDQFHVDULVHV 6XEVWDQWLDOFKDQJHVDUHSURSRVHGLQWKHSURMHFWZKLFKZLOOUHTXLUHPDMRUUHYLVLRQVLQWKH SUHYLRXV(,5GXHWRWKHLQYROYHPHQWRIQHZVLJQLILFDQWHQYLURQPHQWDOHIIHFWVRUD VXEVWDQWLDOLQFUHDVHLQWKHVHYHULW\RISUHYLRXVO\LGHQWLILHGVLJQLILFDQWHIIHFWV&(4$ *XLGHOLQHVVXEGD 6XEVWDQWLDOFKDQJHVRFFXUZLWKUHVSHFWWRWKHFLUFXPVWDQFHVXQGHUZKLFKWKHSURMHFWLV XQGHUWDNHQZKLFKZLOOUHTXLUHPDMRUUHYLVLRQVRIWKHSUHYLRXV(,5GXHWRWKHLQYROYHPHQW RIQHZVLJQLILFDQWHQYLURQPHQWDOHIIHFWVRUDVXEVWDQWLDOLQFUHDVHLQWKHVHYHULW\RI SUHYLRXVO\LGHQWLILHGVLJQLILFDQWHIIHFWV&(4$*XLGHOLQHVVXEG>D@>@RU 1HZLQIRUPDWLRQRIVXEVWDQWLDOLPSRUWDQFHZKLFKZDVQRWNQRZQDQGFRXOGQRWKDYHEHHQ NQRZQZLWKWKHH[HUFLVHRIUHDVRQDEOHGLOLJHQFHDWWKHWLPHWKHSUHYLRXV(,5ZDVFHUWLILHG DVFRPSOHWHVKRZVDQ\RIWKHIROORZLQJ D7KHSURMHFWZLOOKDYHRQHRUPRUHVLJQLILFDQWHIIHFWVQRWGLVFXVVHGLQWKHSUHYLRXV(,5 E6LJQLILFDQWHIIHFWVSUHYLRXVO\H[DPLQHGZLOOEHVXEVWDQWLDOO\PRUHVHYHUHWKDQVKRZQLQ WKHSUHYLRXV(,5 F0LWLJDWLRQPHDVXUHVRUDOWHUQDWLYHVSUHYLRXVO\IRXQGQRWWREHIHDVLEOHZRXOGLQIDFW EHIHDVLEOHDQGZRXOGVXEVWDQWLDOO\UHGXFHRQHRUPRUHVLJQLILFDQWHIIHFWVRIWKH SURMHFWEXWWKHSURMHFWSURSRQHQWVGHFOLQHWRDGRSWWKHPLWLJDWLRQPHDVXUHRU DOWHUQDWLYHRU 2 Introduction 2 Initial Study G0LWLJDWLRQPHDVXUHVRUDOWHUQDWLYHVZKLFKDUHFRQVLGHUDEO\GLIIHUHQWIURPWKRVH DQDO\]HGLQWKHFHUWLILHG(,5ZRXOGVXEVWDQWLDOO\UHGXFHRQHRUPRUHVLJQLILFDQWHIIHFWV RQWKHHQYLURQPHQWEXWWKHSURMHFWSURSRQHQWVGHFOLQHWRDGRSWWKHPLWLJDWLRQ PHDVXUHRUDOWHUQDWLYH&(4$*XLGHOLQHVVXEGD±GVHHDOVR3XE 5HVRXUFHV&RGH 7KHOHDGDJHQF\PD\FKRRVHWRSUHSDUHDVXSSOHPHQWWRDQ(,5UDWKHUWKDQDVXEVHTXHQW(,5LI $Q\RIWKHFRQGLWLRQVGHVFULEHGLQ6HFWLRQZRXOGUHTXLUHWKHSUHSDUDWLRQRID VXEVHTXHQW(,5DQG 2QO\PLQRUDGGLWLRQVRUFKDQJHVZRXOGEHQHFHVVDU\WRPDNHWKHSUHYLRXV(,5DGHTXDWHO\ DSSO\WRWKHSURMHFWLQWKHFKDQJHGVLWXDWLRQ&(4$*XLGHOLQHV 7KH*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH(,5LVDYDLODEOHIRUUHYLHZDWWKH&LW\RI9HUQRQ &RPPXQLW\6HUYLFHVDQG:DWHU'HSDUWPHQW6DQWD)H$YHQXH9HUQRQ&$ 7KLV,QLWLDO6WXG\FRQFOXGHVWKDWD6XSSOHPHQWDO(,5WRWKH9HUQRQ *HQHUDO 3ODQ DQG =RQLQJ 2UGLQDQFH 3URJUDP (,5 LV UHTXLUHG IRU WKH 3URSRVHG )RFXVHG 8SGDWH 2QO\PLQRUDGGLWLRQVRU FKDQJHVZRXOGEHQHFHVVDU\WRPDNHWKHSUHYLRXV(,5DGHTXDWHO\DSSO\WRWKHSURSRVHGSURMHFW LQWKHFKDQJHGVLWXDWLRQDVRQO\YHU\OLPLWHGODQGXVHFKDQJHVDUHSURSRVHG Focused General Plan and Zoning Ordinance Update 3 2 Project Description 2.1 – Project Title &LW\RI9HUQRQ)RFXVHG*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH8SGDWH 2.2 – Lead Agency Name and Address &LW\RI9HUQRQ 6DQWD)H$YHQXH 9HUQRQ&$ 2.3 – Contact Person and Phone Number 6.HYLQ:LOVRQ'LUHFWRURI&RPPXQLW\6HUYLFHVDQG:DWHU 2.4 – Project Location 7KHSURMHFWDSSOLHVWRDOOSDUFHOVZLWKLQWKH&LW\RI9HUQRQDQGWKH &LW\¶VVSKHUHRILQIOXHQFH 9HUQRQLVORFDWHGLQWKHFHQWUDOSRUWLRQRI/RV$QJHOHV&RXQW\GLUHFWO\VRXWKRIGRZQWRZQ/RV $QJHOHV 9HUQRQ LV DGMDFHQW WR WKH FLWLHV RI /RV $QJHOHV +XQWLQJWRQ 3DUN 0D\ZRRG DQG &RPPHUFH7KH&LW\¶VSODQQLQJDUHDHQFRPSDVVHVDSSUR[LPDWHO\VTXDUHPLOHV([KLELW 5HJLRQDO/RFDWLRQDQG9LFLQLW\0DSLOOXVWUDWHVWKH9HUQRQ¶VORFDWLRQZLWKLQ/RV$QJHOHV&RXQW\ DQGLWVORFDOFRQWH[W 2.5 – Project Sponsor’s Name and Address &LW\RI9HUQRQ 6DQWD)H$YHQXH 9HUQRQ&$ 2.6 – General Plan Land Use Designation ,QGXVWULDOZLWKYDULRXVRYHUOD\VVHH([KLELW 2.7 – Zoning District ,QGXVWULDOZLWKYDULRXVRYHUOD\VVHH([KLELW 2.8 – Project Description 7KH&LW\RI9HUQRQDGRSWHGDFRPSUHKHQVLYHXSGDWHWRWKH*HQHUDO3ODQDQG=RQLQJ2UGLQDQFHLQ $3URJUDP(QYLURQPHQWDO,PSDFW5HSRUW3(,5ZDVSUHSDUHGDWWKHWLPHDQGFHUWLILHGE\ WKH9HUQRQ&LW\&RXQFLO,QWKHSDVWWKH&LW\KDVDGRSWHGDQGLPSOHPHQWHGODQGXVHSROLF\WKDW DOORZHGIRUYHU\OLPLWHGKRXVLQJLQ9HUQRQUHVWULFWHGWRH[LVWLQJUHVLGHQFHVGXHWRWKHXQLTXH DQGXELTXLWRXVLQGXVWULDOQDWXUHRIWKH&LW\+RZHYHULQWKH&LW\&RXQFLOFRPPLWWHGWR LPSOHPHQWLQJQHZJRRGJRYHUQDQFHSUDFWLFHVWKDWLQFOXGHGDGRSWLQJODQGXVHSROLFLHVDLPHGDW LQFUHDVLQJWKHYRWLQJSRSXORXV6SHFLILFDOO\WKH&LW\KDVGHWHUPLQHGWKDWDGGLWLRQDOSURSHUWLHV 2 Project Description 4 Initial Study FRXOGEHGHVLJQDWHGIRUUHVLGHQWLDOXVHDQGKDVLGHQWLILHGVSHFLILFORFDWLRQVZKHUHQHZKRXVLQJ GHYHORSPHQWZRXOGEHSHUPLWWHGWRRFFXU7KH&LW\KDVGUDIWHGODQGXVHSROLFLHVDQG]RQLQJ UHJXODWLRQVWKDWZRXOGDOORZVXFKGHYHORSPHQWWRRFFXU 7KHSURSRVHGSURMHFWFRQVLVWVRIVHYHUDOFRPSRQHQWV x +RXVLQJ(OHPHQW8SGDWHWRFRPSO\ZLWK6WDWH+RXVLQJ(OHPHQWODZUHJDUGLQJ WLPHO\XSGDWHVDQGWRLQFOXGHLQIRUPDWLRQRQSRWHQWLDOKRXVLQJVLWHVLQWKH&LW\E\UHYLVLQJ H[LVWLQJODQGXVHSROLF\ZKLFKSURKLELWHGQHZKRXVLQJ7KH+RXVLQJ(OHPHQWLGHQWLILHVWZR VLWHV ZKHUH UHVLGHQWLDO KRXVLQJ FRXOG EH SHUPLWWHG DQG RQH VLWHZKHUHDQHPHUJHQF\ VKHOWHUFRXOGEHSHUPLWWHG x 8SGDWHWRWKH/DQG8VH(OHPHQWWRLQWURGXFHQHZ2YHUOD\V+RXVLQJ DQG (PHUJHQF\ 6KHOWHU x 8SGDWHWRWKH/DQG8VH(OHPHQWWRH[SDQGFRPPHUFLDODQGWUXFNLQJ XVHV /DQG 8VH (OHPHQWSROLFLHVUHJDUGLQJFRPPHUFLDODQGWUXFNLQJDQGIUHLJKWXVHVKDYHEHHQUHYLVHGWR H[SDQGZKHUHWKHVHXVHVFDQEHHVWDEOLVKHGLQWKH&LW\ x 8SGDWHWKH5HVRXUFHV6DIHW\DQG1RLVH(OHPHQWVWRFRPSO\ZLWKUHFHQWO\SDVVHG6WDWH ODZVDQGXSGDWHSHUWLQHQWLQIRUPDWLRQ x 8SGDWHWKH,PSOHPHQWDWLRQ3ODQ$SSHQGL[$ZLWKQHZDSSOLFDEOHSROLFLHVUHODWHGWRWKH DERYHUHYLVHGSROLF\FKDQJHV x 5HYLVHWKH=RQLQJ2UGLQDQFHWRFUHDWHLPSOHPHQWLQJ]RQLQJRYHUOD\VIRUQHZ*HQHUDO3ODQ ODQGXVHGHVLJQDWLRQRYHUOD\VDQGRUSROLFLHV²+RXVLQJ(PHUJHQF\ 6KHOWHU 7UXFN DQG )UHLJKW7HUPLQDO2YHUOD\²DQGWRH[SDQGWKHDUHDWRZKLFKWKH&RPPHUFLDO 2YHUOD\ DSSOLHV$GGLWLRQDOFOHDQXSLWHPVZKLFKGRQRWDIIHFWWKHSROLF\GLUHFWLRQRIWKH=RQLQJ 2UGLQDQFHDUHDOVRLQFOXGHGLQWKLVSURMHFW x 3RWHQWLDOKRXVLQJSURMHFWDWQG'ULYH7KH&LW\KDVUHFHLYHGPXOWLSOHSURSRVDOVIRUD UHVLGHQWLDO GHYHORSPHQW DW WKLV ORFDWLRQ 7KH SRWHQWLDO RI ORFDWLQJ QHZ KRXVLQJ DW WKLV ORFDWLRQLVUHYLHZHGLQWKLV,QLWLDO6WXG\ (DFK RI WKHVH FRPSRQHQWV LV GLVFXVVHG LQ PRUH GHWDLO EHORZ )RU WKH SXUSRVHV RI WKLV ,QLWLDO 6WXG\ WKH IRFXVHG XSGDWH WR WKH 9HUQRQ *HQHUDO 3ODQ DQG =RQLQJ 2UGLQDQFH LQFOXGLQJ WKH SRWHQWLDOKRXVLQJSURMHFWDWQG'ULYHLVFROOHFWLYHO\UHIHUUHGWRDV³WKHSURMHFW´DQG³WKH 3URSRVHG)RFXVHG8SGDWH´7KH³SODQQLQJDUHD´LVWKHDUHDWRZKLFK WKH SURMHFW DSSOLHV WKLV LQFOXGHVDOOSDUFHOVZLWKLQWKH&LW\RI9HUQRQDQGLWVVSKHUHRILQIOXHQFH Update to General Plan Elements Housing Element 7KH9HUQRQ+RXVLQJ(OHPHQWPHHWVWKHYHU\VSHFLILFUHTXLUHPHQWV RI VWDWH ODZ UHJDUGLQJWKHFRQWHQWRIKRXVLQJHOHPHQWV*RYHUQPHQW&RGH6HFWLRQHWVHT6WDWHODZ UHTXLUHVWKDWWKH+RXVLQJ(OHPHQWEHXSGDWHGDWOHDVWHYHU\HLJKW\HDUVRQDWLPHOLQHFRQVLVWHQW ZLWKWKH5HJLRQDO7UDQVSRUWDWLRQ3ODQXQOHVVH[WHQGHGE\WKHOHJLVODWXUH$UWLFOH6HFWLRQ ±&KDSWHURI'LYLVLRQRI7LWOHRIWKH*RYHUQPHQW&RGHVHWVIRUWKWKHOHJDO UHTXLUHPHQWVIRUDKRXVLQJHOHPHQWDQGHQFRXUDJHVWKHSURYLVLRQ RI DIIRUGDEOH DQG GHFHQW KRXVLQJLQVXLWDEOHOLYLQJHQYLURQPHQWVIRUDOOFRPPXQLWLHVWRPHHWVWDWHZLGHJRDOV7KH +RXVLQJ(OHPHQWXSGDWHLVDSROLF\GRFXPHQWE\WKH&LW\RI9HUQRQUHJDUGLQJLWVFXUUHQW 2 Project Description Focused General Plan and Zoning Ordinance Update 5 DQG SURMHFWHG IXWXUH KRXVLQJ QHHGV DV LGHQWLILHG E\ WKH 6WDWH+RXVLQJ DQG &RPPXQLW\ 'HYHORSPHQW 'HSDUWPHQW RU +&' DQG WKH 6RXWKHUQ &DOLIRUQLD $VVRFLDWLRQ RI *RYHUQPHQWV 6&$* DQG WKH &LW\¶V JRDOV SROLFLHV DQG SURJUDPV WR DGGUHVV WKRVH LGHQWLILHG QHHGV 6SHFLILFDOO\WKHHOHPHQWGHWDLOV 3RSXODWLRQFKDUDFWHULVWLFVDQGWUHQGV (PSOR\PHQWFKDUDFWHULVWLFV 7KHW\SHVRIKRXVHKROGVLQ9HUQRQ 6SHFLDOQHHGVSRSXODWLRQV +RXVLQJFKDUDFWHULVWLFVDQGWUHQGV &RQVWUDLQWVRQWKHGHYHORSPHQWRIQHZKRXVLQJ +RXVLQJUHVRXUFHVDYDLODEOHYDFDQWDQGXQGHUXWLOL]HGVLWHVILQDQFLDOUHVRXUFHV +RZWKH&LW\ZLOOZRUNWRPHHWWKH5HJLRQDO+RXVLQJ1HHGV$VVHVVPHQW5+1$DOORFDWLRQ DVVLJQHGE\6&$*DQGRWKHUZLVHDFKLHYHKRXVLQJJRDOV *LYHQ9HUQRQ¶VVWDWXVDVDQLQGXVWULDOFLW\WKH+RXVLQJ(OHPHQWKDVLQWKHSDVWSURPXOJDWHGWKH SROLF\WKDWQRQHZKRXVLQJZLOOEHFRQVWUXFWHGLQ9HUQRQGXHWRWKHVDIHW\ULVNVSRVHGE\WKH PXOWLWXGH RI LQGXVWULHV RSHUDWLQJ WKHUH LQFOXGLQJ PDQ\ WKDW LQYROYH WKH XVH WUDQVSRUW DQG SURGXFWLRQ RI KD]DUGRXV ZDVWHV 7KLV +RXVLQJ (OHPHQW UHYLVHV WKDW SROLF\ DQG LGHQWLILHVWZRSRWHQWLDOVLWHVIRUKRXVLQJGHYHORSPHQWWKDWKDYHEHHQGHHPHGPRVWVXLWDEOH2QH RI WKHVH VLWHV LV GHVLJQDWHG ZLWK D +RXVLQJ 2YHUOD\ LQ WKH /DQG 8VH (OHPHQW 7KH +RXVLQJ (OHPHQWDOVRDGGUHVVHVQHZ6WDWHODZVLQFOXGLQJ6%FRGLILHGDV*RYHUQPHQW&RGH6HFWLRQ >D@>@ ZKLFK UHTXLUHV MXULVGLFWLRQV WR LGHQWLI\ D ]RQH LQ ZKLFK WR SHUPLW HPHUJHQF\ KRPHOHVV VKHOWHUV E\ ULJKW 7KH +RXVLQJ (OHPHQW LGHQWLILHV DQ DUHD GHVLJQDWHG ZLWK DQ (PHUJHQF\6KHOWHU2YHUOD\LQWKH*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH6HH([KLELWIRUORFDWLRQV RIERWKSRWHQWLDOKRXVLQJDQGHPHUJHQF\VKHOWHUVLWHV $GGLWLRQDOXSGDWHVLQFOXGHQHZ86&HQVXVLQIRUPDWLRQDQGLQIRUPDWLRQWRFRPSO\ZLWK6% UHODWHG WR SHUVRQV ZLWK GHYHORSPHQWDO GLVDELOLWLHV 7KH 6WDWH 'HSDUWPHQW RI +RXVLQJ DQG &RPPXQLW\'HYHORSPHQW+&'ZLOOUHYLHZWKHGUDIWHOHPHQWWRGHWHUPLQHZKHWKHULWPHHWVWKH UHTXLUHPHQWVRIVWDWHODZ Land Use Element 7KH/DQG8VH(OHPHQWLGHQWLILHVWKHSK\VLFDOIRUPRI9HUQRQDQGKRZODQGZLOOEHXVHGRYHUWKH ORQJWHUP7KLVHOHPHQWVHWVIRUWKWKHORFDWLRQW\SHDQGLQWHQVLW\XVHVDQGDOVRHVWDEOLVKHVWKH GHVLUHGPL[DQGUHODWLRQVKLSEHWZHHQXVHV/DQGXVHGHVLJQDWLRQVLGHQWLI\WKHW\SHVDQGQDWXUH RIGHYHORSPHQWSHUPLWWHGWKURXJKRXWWKHSODQQLQJDUHD7KHJRDOVDQGSROLFLHVFRQWDLQHGLQWKLV HOHPHQWSURYLGHWKHIRXQGDWLRQIRUPDLQWDLQLQJ9HUQRQDVDUHJLRQDOPDQXIDFWXULQJDQGLQGXVWULDO FHQWHUZKLOHDOORZLQJIRUVRPHFRPPHUFLDOXVHVDQGSXEOLFIDFLOLWLHV7KHVHSROLFLHVZHUHUHWDLQHG LQWKLV3URSRVHG)RFXVHG8SGDWH ,QUHFRJQLWLRQRI9HUQRQ¶VXQLTXHVWDWXVDVDQH[FOXVLYHO\LQGXVWULDOFLW\WKH*HQHUDO3ODQ HVWDEOLVKHG D VLQJOH ODQG XVH FDWHJRU\ ,QGXVWULDO DQG WKUHH RYHUOD\ GLVWULFWV &RPPHUFLDO 5HQGHULQJDQG6ODXJKWHULQJ7KH)RFXVHG8SGDWHSURSRVHVWRH[SDQG WKH DUHD WR ZKLFK WKH &RPPHUFLDO2YHUOD\DSSOLHV$OVRUHJXODWLRQVZLOOSHUPLWDQFLOODU\FRPPHUFLDOXVHVWKURXJKRXW WKH&LW\RQZHHNHQGVWREHLPSOHPHQWHGE\WKH=RQLQJ2UGLQDQFH,QDGGLWLRQWZRQHZRYHUOD\ GLVWULFWV DUH SURSRVHG WR EH DGGHG WKH +RXVLQJ 2YHUOD\ DQG WKH(PHUJHQF\6KHOWHU2YHUOD\ (DFKRIWKHVHRYHUOD\GLVWULFWVDSSO\WRRQHVSHFLILFVLWHZLWKLQWKH&LW\UHVSHFWLYHO\WKDWKDV EHHQ LGHQWLILHG DV PRVW VXLWDEOH IRU WKHVH XVHV 7KH +RXVLQJ 2YHUOD\ ZRXOG SHUPLW XS WR DQ DGGLWLRQDOXQLWVLQWKH&LW\RI9HUQRQ 2 Project Description 6 Initial Study Housing Overlay District 7KH+RXVLQJ2YHUOD\'LVWULFWLVSURSRVHGWRDSSO\WRRQHYDFDQWSDUFHOORFDWHGRQWKHHDVW VLGH RI WKH &LW\ 7KH +RXVLQJ 2YHUOD\ 'LVWULFW LV DSSOLFDEOH RQO\ WR VLWHV WKDW KDYH EHHQ VSHFLILFDOO\LGHQWLILHGE\WKH&LW\DQGGHWHUPLQHGWREHWKHEHVWORFDWLRQVIRUKRXVLQJJLYHQ VXUURXQGLQJ XVHV SUR[LPLW\ WR VHUYLFHV DQG DPHQLWLHV DQG GLVWDQFH IURP VDIHW\ KD]DUGV 5HVLGHQWLDO XVHV DUH SHUPLWWHG LQ WKLV GLVWULFW ZLWK D &RQGLWLRQDO 8VH 3HUPLW RU RWKHU GLVFUHWLRQDU\UHYLHZVXFKDVD'HYHORSPHQW$JUHHPHQWJLYHQWKHXQLTXHVDIHW\FRQVWUDLQWV LQ9HUQRQ Emergency Shelter Overlay District 7KH(PHUJHQF\6KHOWHU2YHUOD\'LVWULFWLVSURSRVHGWRDSSO\WRDVLQJOHYDFDQWSDUFHOORFDWHG LQWKHQRUWKZHVWFRUQHURIWKH&LW\7KH(PHUJHQF\6KHOWHU2YHUOD\'LVWULFWLVDSSOLFDEOHRQO\ WRVLWHVWKDWKDYHEHHQVSHFLILFDOO\LGHQWLILHGE\WKH&LW\DQGGHWHUPLQHGWREHDSSURSULDWH ORFDWLRQV IRU HPHUJHQF\ VKHOWHUV 7KLV 'LVWULFW LV LQWHQGHG WRFRPSO\ ZLWK UHTXLUHPHQWV RI *RYHUQPHQW&RGH6HFWLRQDDVGLVFXVVHGLQWKH+RXVLQJ(OHPHQW Safety Element 7KH6DIHW\(OHPHQWHVWDEOLVKHVSROLFLHVWRSURWHFWWKHFRPPXQLW\IURPQDWXUDODQGKXPDQFDXVHG KD]DUGV7KHHOHPHQWLQFOXGHVDGLVFXVVLRQRIWKRVHIHDWXUHVZLWKLQRUQHDUWKHSODQQLQJDUHD WKDWUHSUHVHQWDSRWHQWLDOGDQJHUWREXLOGLQJVVWUXFWXUHVSXEOLFIDFLOLWLHVDQGLQIUDVWUXFWXUH7KH HOHPHQWHVWDEOLVKHVJRDOVSROLFLHVDQGSODQVWRPLQLPL]HGDQJHUV WR UHVLGHQWV ZRUNHUV DQG YLVLWRUVDVVRFLDWHGZLWKVHLVPLFKD]DUGVIORRGLQJDQGKD]DUGRXVPDWHULDOV 7KH6DIHW\(OHPHQWZDVXSGDWHGWRDFKLHYHFRQVLVWHQF\ZLWKQHZODQGXVHDQGKRXVLQJSROLFLHV DQGWRFRPSO\ZLWK$%HQDFWHGLQDQGHIIHFWLYHLQ $% UHYLVHG PXOWLSOH VHFWLRQVRIWKH*RYHUQPHQW&RGHDQGUHTXLUHVIORRGULVNPDQDJHPHQWLQIRUPDWLRQWREHLQFOXGHG LQWKH6DIHW\(OHPHQW$VSDUWRIWKLVXSGDWHQHZ)HGHUDO(PHUJHQF\ 0DQDJHPHQW $JHQF\ )(0$IORRGPDSVZHUHDGGHGWRWKH6DIHW\(OHPHQW3ROLFLHVZHUHVOLJKWO\UHYLVHGWR UHIOHFW XSGDWHGKRXVLQJSROLF\7KHXQGHUO\LQJSUHH[LVWLQJ6DIHW\(OHPHQWJRDOVUHPDLQWKHVDPH Resources Element 7KH5HVRXUFHV(OHPHQWFRQWDLQVJRDOVDQGSROLFLHVWKDWHQFRXUDJHFRQVHUYDWLRQDQGPDQDJHPHQW RIERWKFXOWXUDODQGQDWXUDOUHVRXUFHVLQFOXGLQJZDWHUUHVRXUFHVRSHQVSDFHHQHUJ\UHVRXUFHV DLUTXDOLW\KLVWRULFEXLOGLQJVDQGVLWHV 7KHSURMHFWSURSRVHVOLPLWHGFKDQJHVDVVRFLDWHGZLWKWKH)RFXVHG*HQHUDO3ODQXSGDWHIRUWKH 5HVRXUFHV(OHPHQW6SHFLILFDOO\WKHLQIRUPDWLRQUHODWHGWRWKH8UEDQ:DWHU0DQDJHPHQW3ODQ 8:03DSSOLFDEOHWRWKH&LW\ZDVXSGDWHGWRUHIOHFWLQIRUPDWLRQLQWKHPRVWUHFHQWO\DGRSWHG 8:03$GGLWLRQDOO\DSROLF\ZDVDGGHGUHODWHGWR$%WKH*OREDO:DUPLQJ6ROXWLRQV $FWRIDQG6%WRFRQVXOWZLWKUHJLRQDOJRYHUQPHQWDOJURXSVWRFRRUGLQDWHODQG XVH FLUFXODWLRQ DQG LQIUDVWUXFWXUH SODQQLQJ $GGLWLRQDO FKDQJHV ZHUH PDGH WR DFKLHYH FRQVLVWHQF\UHJDUGLQJWKH&LW\¶VKRXVLQJSROLF\VSHFLILFDOO\WKHSROLF\FKDQJHWRSHUPLWKRXVLQJLQ YHU\OLPLWHGORFDWLRQVLQWKH&LW\UDWKHUWKDQSURKLELWLQJQHZKRXVLQJ7KHXQGHUO\LQJSUHH[LVWLQJ 5HVRXUFHV(OHPHQWJRDOVUHPDLQWKHVDPH Noise Element 7KH 1RLVH (OHPHQW IRFXVHV RQ PLQLPL]LQJ FRPPXQLW\ QRLVH E\ LGHQWLI\LQJ LWV VRXUFHV DQG DVVHVVLQJDOWHUQDWLYHPHWKRGVWRUHGXFHLPSDFWV7KHHOHPHQWHVWDEOLVKHVSROLFLHVWRDEDWHQRLVH DQG UHGXFH WKH GHWULPHQWDO KHDOWK HIIHFWV DVVRFLDWHG ZLWK H[FHVVLYH QRLVH OHYHOV 7KH HOHPHQW LGHQWLILHVQRLVHVWDQGDUGVDQGODQGXVHFRPSDWLELOLW\JXLGHOLQHVWREHXVHGLQWKHDVVHVVPHQWRI GHYHORSPHQWSURSRVDOVWRSURWHFWQRLVHVHQVLWLYHODQGXVHVIURPH[FHVVLYHQRLVH 2 Project Description Focused General Plan and Zoning Ordinance Update 7 7KHSURMHFWSURSRVHVOLPLWHGFKDQJHVWRWKH1RLVH(OHPHQWWRUHIOHFWUHYLVHGKRXVLQJSROLF\7KH XQGHUO\LQJSUHH[LVWLQJ1RLVH(OHPHQWJRDOVUHPDLQWKHVDPH Implementation Plan 7KH *HQHUDO 3ODQ LQFOXGHV D FRPSUHKHQVLYH ,PSOHPHQWDWLRQ 3ODQ WKDW SURYLGHV GLUHFWLRQ IRU WUDQVODWLQJJRDOVDQGSROLFLHVWRVSHFLILFDFWLRQV7KH,PSOHPHQWDWLRQ3ODQVHUYHVDVDEDVLVIRU PDNLQJIXWXUHSURJUDPPLQJGHFLVLRQVUHODWHGWRWKHDVVLJQPHQWRIVWDIIDQGWKHH[SHQGLWXUHRI &LW\IXQGV7KH,PSOHPHQWDWLRQ3ODQLGHQWLILHVLQGLYLGXDOSURJUDPUHVSRQVLELOLW\IXQGLQJVRXUFHV DQG D WLPHIUDPH IRU FRPSOHWLRQ $ OLPLWHG QXPEHU RI QHZ DFWLRQV ZHUH DGGHG WR WKH ,PSOHPHQWDWLRQ3ODQWRFRUUHODWHZLWKQHZSROLFLHVLQWKH*HQHUDO3ODQ Update to Zoning Ordinance and Zoning Map 8SGDWHV WR WKH =RQLQJ 2UGLQDQFH DQG =RQLQJ 0DS ([KLELW DUHODUJHO\ LQWHQGHG WR DFKLHYH FRQVLVWHQF\EHWZHHQWKHUHYLVLRQVSURSRVHGLQWKH)RFXVHG*HQHUDO3ODQXSGDWHDQGWKH=RQLQJ 2UGLQDQFH $GGLWLRQDO SROLF\ FKDQJHV LQFOXGH H[SDQGLQJ WKH&RPPHUFLDO 2YHUOD\ ]RQH DQG SHUPLWWLQJDQFLOODU\FRPPHUFLDORQZHHNHQGVWKURXJKRXWWKH&LW\HVWDEOLVKLQJDQHZ7UXFN DQG )UHLJKW 7HUPLQDO 2YHUOD\ 'LVWULFW WR FHUWDLQ DUHDV RI WKH &LW\DQGSURYLGLQJUHODWHG GHYHORSPHQW VWDQGDUGV DQG FRPSOHWLQJ PLQRU FOHDQ XS RI ODQJXDJH LQ WKH 2UGLQDQFH WR IDFLOLWDWHLWVLQWHUSUHWDWLRQ General Plan Consistency and Commercial Overlay Expansion 7KH &LW\ SUHSDUHG UHYLVLRQV WR WKH =RQLQJ 2UGLQDQFH WR DFKLHYHFRQVLVWHQF\ ZLWK /DQG 8VH (OHPHQW2YHUOD\'LVWULFWVJRDOVSROLFLHVDQGLPSOHPHQWDWLRQPHDVXUHVVSHFLILHGLQWKH*HQHUDO 3ODQ 7KHVH UHYLVLRQV LQFOXGH D QHZ +RXVLQJ 2YHUOD\ 'LVWULFW DQG (PHUJHQF\ 6KHOWHU 2YHUOD\ 'LVWULFWLQERWKWKH=RQLQJ2UGLQDQFHDQGWKH=RQLQJ0DSDQGUHODWHGXVHGHYHORSPHQWDQGVLWH SODQQLQJVWDQGDUGVIRUWKHVHQHZRYHUOD\V$GGLWLRQDOFKDQJHVLQFOXGHUHYLVLRQVWRFRPPHUFLDO XVHVSROLF\DVLQGLFDWHGLQWKH*HQHUDO3ODQ/DQG8VH(OHPHQW7KHVHFKDQJHVDUHUHIOHFWHGLQ WKHSURSRVHGDPHQGPHQWVWRWKH=RQLQJ2UGLQDQFHZLWKWKHUHYLVLRQVWRUHJXODWLRQVIRUDQFLOODU\ FRPPHUFLDO XVHV SHUPLWWHG RQ ZHHNHQGV DQG H[SDQVLRQ RI WKH &RPPHUFLDO 2YHUOD\ RQ WKH =RQLQJ0DS$GGLWLRQDOUHJXODWLRQVDUHLQFOXGHGIRUSDUNLQJDQGORDGLQJVWDQGDUGVIRUGLIIHUHQW W\SHVRIFRPPHUFLDOXVHV Truck and Freight Terminal Overlay Zoning District 7KH&LW\SURSRVHVWRHVWDEOLVKDQHZ=RQLQJ2YHUOD\'LVWULFW7KLVRYHUOD\ZRXOGFRUUHODWHWRWKH QHZ7UXFNDQG)UHLJKW2YHUOD\LQWKH*HQHUDO3ODQ7KH7UXFNDQG )UHLJKW 7HUPLQDO 2YHUOD\ 'LVWULFWDVSURSRVHGLVUHSUHVHQWHGLQ([KLELW'HYHORSPHQWVWDQGDUGVLQFOXGLQJVLWHSODQQLQJ VWDQGDUGVDQGDOORZDEOHXVHVDUHLQFOXGHGLQWKH=RQLQJ2UGLQDQFHDPHQGPHQWV:KHUHDVWUXFN DQGIUHLJKWWHUPLQDOVZRXOGQRWEHDOORZHGHOVHZKHUHLQWKH&LW\WKLVDPHQGPHQWSURSRVHVWR DOORZWKHVHXVHVVXEMHFWWRGHYHORSPHQWVWDQGDUGVDQGD&RQGLWLRQDO8VH3HUPLWZLWKLQWKHQHZ 7UXFNDQG)UHLJKW7HUPLQDO2YHUOD\'LVWULFW Clean Up Items 6HFWLRQ'HILQLWLRQVRIWKH=RQLQJ2UGLQDQFHLVSURSRVHGWREHXSGDWHGWRLQFUHDVHFODULW\ LQLQWHUSUHWDWLRQDQGLPSOHPHQWWKHDERYHSROLF\FKDQJHV7KHGHILQLWLRQVRIFRPPXQLW\IDFLOLWLHV IORRUDUHD UDWLR IUHLJKW WHUPLQDO LQFLGHQWDO XVH UHWDLO XVH VODXJKWHULQJ WUXFN WHUPLQDO DQG ZDUHKRXVHXVHZLOOEHXSGDWHGDQGGHILQLWLRQVZLOOEHDGGHGIRUKD]DUGRXVZDVWHIDFLOLW\LQGRRU UHF\FOLQJIDFLOLW\RXWGRRUUHF\FOLQJIDFLOLW\VROLGZDVWHIDFLOLW\DQGWUDGHVFKRRO 6HFWLRQ=RQHV3HUPLWWHG8VHV'HYHORSPHQW6WDQGDUGVDQG6LWH3ODQQLQJ6WDQGDUGVLV SURSRVHGWREHXSGDWHGZLWKWKHIROORZLQJFKDQJHV DGGLWLRQDOXVHVSHUPLWWHGE\ULJKWZHUHDGGHG 2 Project Description 8 Initial Study XVHVSHUPLWWHGZLWKDFRQGLWLRQDOXVHSHUPLWZHUHDGGHGRUUHYLVHG EXIIHUUHTXLUHPHQWVIRUDFXWHO\KD]DUGRXVPDWHULDOVZLWKLQIHHWRIDVFKRRODUHDGGHG VFUHHQLQJ RI RXWGRRU VWRUDJH DFWLYLWLHV PRGLILHG FODULILFDWLRQV RQ ZDWHU XVDJH UHTXLUHPHQWVIRUFRQGLWLRQDOXVHSHUPLWV LQWHUSUHWDWLRQV E\ WKH &RPPXQLW\ 6HUYLFHV 'LUHFWRU UHJDUGLQJ PHDVXUHPHQWV DQG H[FHSWLRQVWRVWDQGDUGV FODULILFDWLRQV RQ SDUNLQJ DFFHVV SDUNLQJ VSDFH VL]H YHKLFOH PDQHXYHULQJ DQG VWUHHW GHGLFDWLRQ H[WHQVLRQRIDPRUWL]DWLRQRIQRQFRQIRUPLQJRXWGRRUDFWLYLWLHVDQGVWRUDJHWR RWKHUPLQRUFODULILFDWLRQDQGW\SRJUDSKLFDOFKDQJHV Proposed Residential Project at 4675 52 nd Drive 7RLQVWLWXWHJRRGJRYHUQDQFHSUDFWLFHVLQFOXGLQJH[SDQVLRQRIWKHYRWLQJSRSXODWLRQLQ9HUQRQ WKH &LW\ KDV LGHQWLILHG D VLWH DW QG 'ULYH DV SRVVLEO\ DSSURSULDWH IRU QHZ KRXVLQJ GHYHORSPHQW 7KLVLVWKH RQO\ORFDWLRQLQWKH&LW\WKDWLVSURSRVHG WR EH GHVLJQDWHG ZLWK WKH +RXVLQJ2YHUOD\'LVWULFWDVSDUWRIWKH)RFXVHG*HQHUDO3ODQXSGDWH7KHSDUFHOLVRZQHGE\WKH &LW\RI9HUQRQDQGZRXOGEHGHYHORSHGE\D\HWWREHGHWHUPLQHG GHYHORSHU LI WKLV SURMHFW LQFOXGLQJ *HQHUDO 3ODQ DQG =RQLQJ 2UGLQDQFH DPHQGPHQWV LV DSSURYHG 7R PHHW JRRG JRYHUQDQFHDJUHHGXSRQGHDGOLQHVIRUDFKLHYLQJQHZKRXVLQJGHYHORSPHQWLQ9HUQRQWKH&LW\ LVVXHGD5HTXHVWIRU3URSRVDOVRQ$SULOIRUGHYHORSPHQWSURSRVDOVIRUQHZKRXVLQJRQ WKLV DFUH VLWH 3URMHFW SURSRVDOV ZHUH UHFHLYHG LQ -XO\ DOO SURSRVLQJ H[FOXVLYHO\ UHVLGHQWLDOXVHDQG\LHOGLQJEHWZHHQDQGWRWDOXQLWV7KUHHGHYHORSPHQWSURSRVDOVZLOOEH FRQVLGHUHGWKHVHWKUHHSURSRVDOVZLOOSURYLGHWKHIUDPHZRUNIRUHQYLURQPHQWDODQDO\VLVLQWKLV ,QLWLDO6WXG\+RZHYHUSRWHQWLDOXQLW\LHOGRIWKHWKUHHSURSRVHGSURMHFWVWREHFRQVLGHUHGLV WRXQLWVFRQVLVWHQWZLWKWKH&LW\SROLF\GLUHFWLRQIRUWKLVVLWH$OOGHYHORSPHQWSURSRVDOV LQFOXGH SURYLVLRQV IRU RQVLWH RSHQ VSDFHDPHQLWLHV EXIIHULQJWKURXJK VHWEDFNV IURP WKH DGMDFHQWUDLOURDGVSXUDQGRQVLWHSDUNLQJ 1R SHUPLWWHG DFWLYLWLHV RU DSSURYHG DFWLRQV ZLOO RFFXU UHODWHGWRDQ\SRWHQWLDOUHVLGHQWLDO GHYHORSPHQWRQWKLVVLWHXQWLODQGLI*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH DPHQGPHQWV DUH FRPSOHWHGDQGWKLV&(4$UHYLHZSURFHVVKDVEHHQFRPSOHWHG 2.9 – Project Objectives 7KLVXSGDWHLVEHLQJSXUVXHGVRWKDWWKH&LW\¶V*HQHUDO3ODQDQG=RQLQJ2UGLQDQFHDUHFRQVLVWHQW ZLWK 6WDWH ODZ DQG FRQVLVWHQW ZLWK HDFK RWKHU DQG WR SURYLGH SROLF\ GLUHFWLRQ IRU DGGLWLRQDO KRXVLQJVLWHVZLWKLQWKH&LW\WRIRUZDUG&LW\SROLF\WRH[SDQGWKHYRWLQJSRSXODWLRQLQ9HUQRQ 2WKHU REMHFWLYHV RI WKH *HQHUDO 3ODQ UHPDLQ XQFKDQJHG 6SHFLILFDOO\ WKH &LW\¶V LQWHQW LV WR FRQWLQXHWRVXSSRUWWKHRQJRLQJLQGXVWULDOFKDUDFWHURIWKH&LW\ZKLOHUHFRJQL]LQJWKHFKDQJLQJ LQGXVWULDOHQYLURQPHQWWKURXJKRXWWKH8QLWHG6WDWHVDQGJOREDOO\DQGWRUHVSRQGDSSURSULDWHO\ 2.10 – Surrounding Land Uses 7KHSURMHFWDSSOLHVWRDOOSDUFHOVZLWKLQWKH&LW\RI9HUQRQDQGLWVVSKHUHRILQIOXHQFH9HUQRQLV DGMDFHQWWRWKHFLWLHVRI/RV$QJHOHV+XQWLQJWRQ3DUN0D\ZRRGDQG&RPPHUFH6XUURXQGLQJ XVHVLQWKHVHFLWLHVLQFOXGHUHVLGHQWLDOFRPPHUFLDODQGLQGXVWULDOXVHV :LWK UHJDUG WR SURSRVHG *HQHUDO3ODQ ODQG XVH FKDQJHV DQG UHODWHG FRQVLVWHQF\ =RQLQJ 0DS FKDQJHVWKHWZRQHZ*HQHUDO3ODQ2YHUOD\'LVWULFWVDUHDSSOLHGWRRQHSDUFHOHDFK7KHSURSRVHG +RXVLQJ2YHUOD\VLWHLVDWWKHVRXWKHDVWHGJHRIWKH&LW\RQYDFDQWVLWH7RWKHVRXWKLQWKH&LW\ 2 Project Description Focused General Plan and Zoning Ordinance Update 9 RI0D\ZRRGDUHUHVLGHQWLDOXVHVLQWKHIRUPRIVLQJOHIDPLO\DQGPXOWLIDPLO\KRXVLQJ7RWKH ZHVWDQGQRUWKDUHYDFDQWSDUFHOVWKH/RV$QJHOHV5LYHUOLHVIDUWKHUQRUWK7RWKHHDVWDUH LQGXVWULDOXVHV 7KH(PHUJHQF\6KHOWHU2YHUOD\'LVWULFWLVORFDWHGQHDUWKHLQWHUVHFWLRQRI$ODPHGD6WUHHWDQG( WK6WUHHWQHDUWKH$ODPHGD&RUULGRUIUHLJKWUDLOOLQH7KHVLWHLVFXUUHQWO\YDFDQW6XUURXQGLQJ XVHVLQFOXGHUHVLGHQWLDOSXEOLFXWLOLW\$ODPHGD&RUULGRUDQGZKROHVDOHFRPPHUFLDOXVHV 7KH&RPPHUFLDO2YHUOD\'LVWULFWLVSURSRVHGWREHH[SDQGHGWRLQFOXGHDGGLWLRQDOSDUFHOVDORQJ 6RWR6WUHHWDVZHOODVSURSHUWLHVRQ6ODXVRQ$YHQXHDQG$WODQWLF%RXOHYDUG6XUURXQGLQJXVHV DUHJHQHUDOO\LQGXVWULDOLQQDWXUHZLWKDOLPLWHGQXPEHURIFRPPHUFLDOXVHV$GGLWLRQDOO\WKH SRWHQWLDO H[SDQVLRQ RI WKH &RPPHUFLDO 2YHUOD\ 'LVWULFW ZRXOG EHDGMDFHQWWRWKH0D\ZRRG (OHPHQWDU\6FKRROORFDWHGLQWKHDGMDFHQW&LW\RI0D\ZRRG 7KH=RQLQJ0DSKDVDQDGGLWLRQDOSURSRVHGDPHQGPHQWWKH7UXFNDQG)UHLJKW7HUPLQDO2YHUOD\ 'LVWULFW7KLVRYHUOD\ZRXOGDSSO\WRDQRUWKHUQSRUWLRQRIWKH&LW\DVLQGLFDWHGLQ([KLELW 6XUURXQGLQJXVHVDUHJHQHUDOLQGXVWULDOLQQDWXUHDVZHOODVUDLO\DUGVDQGUDLOOLQHV7KH/RV $QJHOHV5LYHUERUGHUVPXFKRIWKLVSURSRVHG2YHUOD\'LVWULFW 2.11 – Environmental Setting 7KH&LW\RI9HUQRQLVORFDWHGLQWKHFHQWUDOSRUWLRQRI/RV$QJHOHV&RXQW\GLUHFWO\VRXWKHDVWRI GRZQWRZQ/RV$QJHOHV9HUQRQLVDGMDFHQWWRWKHFLWLHVRI/RV$QJHOHV +XQWLQJWRQ 3DUN 0D\ZRRGDQG&RPPHUFH9HUQRQLVFRQQHFWHGWRWKHUHJLRQDOUDLO OLQHV YLD WKH $ODPHGD &RUULGRUZKLFKLVWKHSULPDU\FRQQHFWLRQEHWZHHQWKHSRUWVRI/RV$QJHOHVDQG/RQJ%HDFKDQG WKHUDLO\DUGVORFDWHGLQ9HUQRQ&RPPHUFHDQGGRZQWRZQ/RV$QJHOHV$SRUWLRQRIWKH+REDUW <DUGDQLQWHUPRGDOIDFLOLW\ZKHUHODUJHVKLSSLQJFRQWDLQHUVDUHWUDQVIHUUHGIURPUDLOURDGFDUVWR WUXFNVDQGYLFHYHUVDLVDOVRORFDWHGLQ9HUQRQ 7KHFRUSRUDWHOLPLWVRIWKH&LW\RI9HUQRQHQFRPSDVVDSSUR[LPDWHO\VTXDUHPLOHVH[WHQGLQJ JHQHUDOO\IURP$ODPHGD6WUHHWDQGWKH$ODPHGD&RUULGRURQWKHZHVWWRWKH,IUHHZD\WRWKH HDVWDQGWKHFLWLHVRI0D\ZRRGDQG+XQWLQJWRQ3DUNRQWKHVRXWKDQGWKHFLWLHVRI/RV$QJHOHV DQG&RPPHUFHWRWKHQRUWK$SRUWLRQRIXQLQFRUSRUDWHG/RV$QJHOHV&RXQW\LVORFDWHGLQWKH SODQQLQJDUHDWKDWLQFOXGHVSULPDULO\LQGXVWULDOXVHVDQGSRUWLRQVRIWKH/RV$QJHOHV5LYHU/DQGV ZLWKLQ9HUQRQODUJHO\KDYHEHHQGHYHORSHGZLWKLQGXVWULDOXVHVVLQFHLQFRUSRUDWLRQLQ&ORVH WR HPSOR\HHV FRPPXWH LQWR 9HUQRQ GDLO\ WR ZRUN LQ WKH PDQXIDFWXULQJ ZDUHKRXVLQJLQGXVWULDODQGWUDQVSRUWDWLRQUHODWHGEXVLQHVVHV$VRI9HUQRQKDGRQO\ UHVLGHQFHVDQGDSRSXODWLRQRISHUVRQV 2.12 – Required Approvals x 7KH&LW\&RXQFLOPXVWDSSURYHD*HQHUDO3ODQ$PHQGPHQWWKDWLQFRUSRUDWHVWKHIRFXVHG XSGDWHVLQWRWKHFXUUHQW*HQHUDO3ODQ x 7KH&LW\&RXQFLOPXVWDSSURYHD=RQH7H[W$PHQGPHQWWRFUHDWHDQG LPSOHPHQW WKH +RXVLQJ 2YHUOD\ (PHUJHQF\ 6KHOWHU 2YHUOD\ 7UXFN DQG )UHLJKW 7HUPLQDO 2YHUOD\ DQG H[SDQVLRQRIWKH&RPPHUFLDO2YHUOD\DVZHOODVRWKHUIRFXVHGDPHQGPHQWVWRIDFLOLWDWH LPSOHPHQWDWLRQDQGHDVHLQWHUSUHWDWLRQRIWKH=RQLQJ2UGLQDQFH x 7KH&LW\&RXQFLOPXVWDSSURYHD=RQLQJ0DS$PHQGPHQWWRDSSO\WKH+RXVLQJ2YHUOD\ (PHUJHQF\6KHOWHU2YHUOD\7UXFNDQG)UHLJKW7HUPLQDO2YHUOD\DQG H[SDQVLRQ RI WKH &RPPHUFLDO2YHUOD\WRWKH=RQLQJ0DS x 7KH&LW\&RXQFLOPXVWDSSURYHD'HYHORSPHQW$JUHHPHQWUHODWHGWRQG'ULYHSULRU WRDSSURYDORIEXLOGLQJSHUPLWVIRUDSURSRVHGSURMHFWRQWKLVVLWH 2 Project Description 10 Initial Study 2.13 – Other Public Agencies Whose Approval Is Required 7KH6WDWHRI&DOLIRUQLD'HSDUWPHQWRI+RXVLQJDQG&RPPXQLW\'HYHORSPHQW ZLOO UHYLHZ WKH +RXVLQJ (OHPHQW IRU FRPSOLDQFH ZLWK 6WDWH ODZ DQG LQGLFDWH ZKHWKHU WKH DGRSWHG (OHPHQW LV FRQVLVWHQWZLWK6WDWH+RXVLQJ(OHPHQW/DZ$UWLFOHRIWKH*RYHUQPHQW&RGH Assumptions 7KHHQYLURQPHQWDODQDO\VLVFRQWDLQHGLQWKLV,QLWLDO6WXG\LVEDVHGRQWKHIROORZLQJDVVXPSWLRQV Project Specific Environmental Review: ,QWKH&LW\RI9HUQRQDOOGHYHORSPHQW SURSRVDOV WKDW DUH FRQVLGHUHG ³SURMHFWV´ XQGHU &(4$ DUH VXEMHFWWRDQHQYLURQPHQWDO UHYLHZSURFHVVWRGHWHUPLQHWKHOHYHORILPSDFWDQGWRLPSRVHDSSURSULDWH PLWLJDWLRQ PHDVXUHVLIQHHGHGWRDYRLGVLJQLILFDQWLPSDFWV7KHRQO\SRWHQWLDOKRXVLQJGHYHORSPHQW SURMHFWZKLFKWKLV,QLWLDO6WXG\ZLOOUHYLHZLVDSSOLFDEOHWRGHYHORSPHQWDWQG'ULYH ZKHUHKRXVLQJLVDQWLFLSDWHGLQWKHQHDUIXWXUH Purpose and Focus of this Initial Study for the Focused General Plan and Zoning Ordinance Environmental Review: 2WKHUWKDQSURYLGLQJHQYLURQPHQWDOUHYLHZIRUD SRWHQWLDOKRXVLQJGHYHORSPHQWDWQG'ULYHWKLVSURMHFWZRXOGQRWDXWKRUL]HDQ\ SODQVIRUFRQVWUXFWLRQRIQHZXVHVRUUHGHYHORSPHQWRIDQ\SURSHUWLHVWRSURGXFHQHZ XVHV7KHSURSRVHGSURMHFWLVDQXSGDWHWRH[LVWLQJSROLF\GRFXPHQWV1RRWKHUGLUHFW HQYLURQPHQWDO LPSDFWV EHVLGHV WKRVH GLVFXVVHG IRU QG 'ULYH WKHUHIRUH ZRXOG RFFXU,QDGGLWLRQWRDVVHVVLQJLPSDFWVUHODWHGWRDSRWHQWLDOKRXVLQJGHYHORSPHQWDW QG'ULYHWKHQWKHSXUSRVHRIWKHHQYLURQPHQWDODVVHVVPHQWLVWRGHWHUPLQHZKHWKHU WKHUH DUH DQ\ SHFXOLDU W\SHV RI LPSDFWV WKDW FRXOG RFFXU DV DQLQGLUHFW UHVXOW RI WKH +RXVLQJ (OHPHQW VWUDWHJLHV DQG RWKHU DPHQGPHQWV WR WKH *HQHUDO3ODQDQG=RQLQJ 2UGLQDQFH %HFDXVHWKH&LW\FHUWLILHGD3URJUDP(,5LQIRUDFRPSUHKHQVLYH XSGDWH RI WKH *HQHUDO3ODQDQG=RQLQJ2UGLQDQFHWKHDQDO\VLVLQWKLV,QLWLDO6WXG\WLHUVXSRQWKLVSULRU 3URJUDP(,5IRUWKHSXUSRVHRIGHWHUPLQLQJZKHWKHUD6XEVHTXHQWRU6XSSOHPHQWDO(,5LV UHTXLUHGRUDQ$GGHQGXPWRWKHSULRU3URJUDP(,5 2 Project Description Focused General Plan and Zoning Ordinance Update 11 Exhibit 1: Regional Context and Vicinity Map 2 Project Description 12 Initial Study 7KLV3DJH,QWHQWLRQDOO\/HIW%ODQN 7KLV3DJH,QWHQWLRQDOO\/HIW%ODQN 7KLV3DJH,QWHQWLRQDOO\/HIW%ODQN 7KLV3DJH,QWHQWLRQDOO\/HIW%ODQN± 3 Determination 20 Initial Study 7KLV3DJH,QWHQWLRQDOO\/HIW%ODQN Focused General Plan and Zoning Ordinance Update 21 4 Evaluation of Environmental Impacts 4.1 – Aesthetics :RXOGWKHSURMHFW Potentially Significant Impact Less Than Significant with Mitigation Incorporation Less Than Significant Impact No Impact D +DYHDVXEVWDQWLDODGYHUVH HIIHFWRQDVFHQLFYLVWD"Ŀ Ŀ Ŀ E 6XEVWDQWLDOO\GDPDJHVFHQLF UHVRXUFHVLQFOXGLQJEXWQRW OLPLWHGWRWUHHVURFN RXWFURSSLQJVDQGKLVWRULF EXLOGLQJVZLWKLQYLHZIURPD VWDWHVFHQLFKLJKZD\" Ŀ Ŀ Ŀ F 6XEVWDQWLDOO\GHJUDGHWKH H[LVWLQJYLVXDOFKDUDFWHURU TXDOLW\RIWKHVLWHDQGLWV VXUURXQGLQJV" Ŀ Ŀ Ŀ G &UHDWHDQHZVRXUFHRI VXEVWDQWLDOOLJKWRUJODUHZKLFK ZRXOGDGYHUVHO\DIIHFWGD\RU QLJKWWLPHYLHZVLQWKHDUHD" Ŀ Ŀ Ŀ DGNo Impact.3RWHQWLDOLPSDFWVWRVFHQLFYLVWDVZLWKLQWKH&LW\RI9HUQRQZHUHSUHYLRXVO\ DQDO\]HGLQWKH9HUQRQ*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH(,57KHDQDO\VLVFRQFOXGHGWKDWQR LPSDFWZRXOGUHVXOWVLQFHQRVFHQLFYLVWDVVFHQLFUHVRXUFHVRUVWDWHVFHQLFKLJKZD\VDUHORFDWHG LQWKH&LW\,QDGGLWLRQWRODQGXVHFKDQJHVSURSRVHGLQWKH*HQHUDO3ODQWKH3URSRVHG)RFXVHG 8SGDWH LQFOXGHV UHYLVLRQV WR WKH =RQLQJ 2UGLQDQFH WR LQWURGXFHGHYHORSPHQW VWDQGDUGV FRQFHUQLQJORWVVL]HVEXLOGLQJLQWHQVLW\VHWEDFNVEXLOGLQJKHLJKWOLPLWDWLRQVIRUWKHSURSRVHGQHZ ]RQLQJGLVWULFWRYHUOD\V7KHVHVWDQGDUGVDUHLQWHQGHGWRSURYLGHIRUTXDOLW\GHVLJQRISURSRVHG GHYHORSPHQW DV ZHOO DV HQVXUH FRPSDWLELOLW\ ZLWK H[LVWLQJ VXUURXQGLQJ GHYHORSPHQW 7KH 3URSRVHG)RFXVHG8SGDWHGRHVQRWSURSRVHDQ\FKDQJHVWRWKH=RQLQJ2UGLQDQFHZKLFKZRXOG UHPRYHRUUHYLVHH[LVWLQJGHYHORSPHQWVWDQGDUGVWRUHGXFHOLJKWDQGJODUHLPSDFWV,PSDFWVRI WKH3URSRVHG)RFXVHG8SGDWHZRXOGEHVLPLODUWRWKRVHLGHQWLILHGLQWKH*HQHUDO3ODQ(,5DQGQR QHZLPSDFWZRXOGRFFXU :LWKUHJDUGWRWKHSURSRVHGGHYHORSPHQWDWQG'ULYHVXUURXQGLQJODQGXVHVWRWKHZHVW HDVWDQGQRUWKFRQVLVWRILQGXVWULDOEXVLQHVVHV5HVLGHQWLDOXVHVVLQJOHDQGPXOWLIDPLO\DUH ORFDWHGDFURVVWKHVWUHHWWRWKHVRXWKLQWKH&LW\RI0D\ZRRG3URSRVHGGHYHORSPHQWDWWKLVVLWH ZRXOG EH WZR WR WKUHH VWRULHV LQ KHLJKW D SURSRVDO IRU D WKUHHVWRU\ GHYHORSPHQW KDV D JUDGXDWLQJKHLJKWZKLFKLQFUHDVHVIURPWKHVWUHHWHGJHWRZDUGVWKHEDFNRIWKHSURSHUW\7ZR SURSRVDOVZRXOGEHOLPLWHGWRWZRVWRULHVLQKHLJKW*LYHQWKHLQGXVWULDOQDWXUDORIRWKHUH[LVWLQJ ODQGXVHVLQWKHDUHDDSURSRVHGKRXVLQJGHYHORSPHQWRQWKLVVLWHRIUHODWLYHO\FRQVLVWHQWVFDOH 4 Evaluation of Environmental Impacts 22 Initial Study ZLWK QHDUE\ UHVLGHQWLDO XVHV ZRXOG EH FRQVLVWHQW ZLWK WKH DHVWKHWLF FRQGLWLRQ DW QHDUE\ UHVLGHQWLDOXVHVUHODWLYHWRVFDOH 7KHGHYHORSPHQWSURSRVDOVDOODLPWRSURYLGHFOHDUSHGHVWULDQRULHQWDWLRQWRZDUGWKHQG'ULYH ERXQGDU\ZLWKJURXQGIORRUHQWUDQFHVDQGOLPLWHGSDUNLQJDQGGULYHZD\ LQWHUUXSWLRQV 7KH GHYHORSPHQW SURMHFWV DV SURSRVHG ZRXOG EH FRPSDWLEOH ZLWK H[LVWLQJ FRQGLWLRQV UHODWLYH WR DGMDFHQWUHVLGHQWLDOXVHVDQGQRVFHQLFYLVWDVZRXOGEHLPSDFWHG $OO GHYHORSPHQW SURSRVDOV LQFOXGH ODQGVFDSLQJ EXLOGLQJ DUWLFXODWLRQ DQG YDULHG DUFKLWHFWXUDO PDWHULDOV 7KH SURSRVHG GHVLJQVZRXOGFRPSOHPHQWEXLOGLQJVRQVXUURXQGLQJSURSHUWLHVDQGSURYLGHRSHQVSDFHDPHQLWLHV LQWKHIRUPRIFRXUW\DUGVDQGFKLOGSOD\DUHDV 7KHSURMHFWVLWHLVLQDGHYHORSHGXUEDQDUHDWKDWLVFXUUHQWO\ ZHOO LOOXPLQDWHG 6RXUFHV RI LOOXPLQDWLRQ LQFOXGH IUHHVWDQGLQJ VWUHHWOLJKWV OLJKW IL[WXUHVRQ EXLOGLQJV SROHPRXQWHG OLJKWV WUDIILFVLJQDOVDQGYHKLFOHKHDGOLJKWV7KHSURMHFWZLOOEHUHTXLUHG WR DGKHUH WR H[LVWLQJ GHYHORSPHQW VWDQGDUGV WR UHJXODWH OLJKW DQG JODUH ZKLFK ZRXOGDOVR EH UHYLHZHG GXULQJ WKH GLVFUHWLRQDU\ UHYLHZ SURFHVV IRU WKH GHYHORSPHQW SURMHFW 7KH SURSRVHG GHYHORSPHQW SURMHFWV ZRXOGKDYHQRDGYHUVHDHVWKHWLFLPSDFWV 1RQHZRUVXEVWDQWLDOO\PRUHVHYHUHLPSDFWVZRXOGRFFXUZLWKLPSOHPHQWDWLRQRIWKH3URSRVHG )RFXVHG8SGDWH 4 Evaluation of Environmental Impacts Focused General Plan and Zoning Ordinance Update 23 4.2 – Agriculture and Forest Resources :RXOGWKHSURMHFW Potentially Significant Impact Less Than Significant with Mitigation Incorporation Less Than Significant Impact No Impact D &RQYHUW3ULPH)DUPODQG8QLTXH )DUPODQGRU)DUPODQGRI6WDWHZLGH ,PSRUWDQFH)DUPODQGDVVKRZQRQ WKHPDSVSUHSDUHGSXUVXDQWWRWKH )DUPODQG0DSSLQJDQG0RQLWRULQJ 3URJUDPRIWKH&DOLIRUQLD5HVRXUFHV $JHQF\WRQRQDJULFXOWXUDOXVH" Ŀ Ŀ Ŀ E &RQIOLFWZLWKH[LVWLQJ]RQLQJIRU DJULFXOWXUDOXVHRUD:LOOLDPVRQ$FW FRQWUDFW"Ŀ Ŀ Ŀ F &RQIOLFWZLWKH[LVWLQJ]RQLQJIRURU FDXVHUH]RQLQJRIIRUHVWODQGDV GHILQHGLQ3XEOLF5HVRXUFHV&RGH VHFWLRQJWLPEHUODQGDV GHILQHGE\3XEOLF5HVRXUFHV&RGH VHFWLRQRUWLPEHUODQG]RQHG 7LPEHUODQG3URGXFWLRQDVGHILQHGE\ *RYHUQPHQW&RGHVHFWLRQJ" Ŀ Ŀ Ŀ G 5HVXOWLQORVVRIIRUHVWODQGRU FRQYHUVLRQRIIRUHVWODQGWRQRQIRUHVW XVH"Ŀ Ŀ Ŀ H ,QYROYHRWKHUFKDQJHVLQWKHH[LVWLQJ HQYLURQPHQWZKLFKGXHWRWKHLU ORFDWLRQRUQDWXUHFRXOGUHVXOWLQ FRQYHUVLRQRI)DUPODQGWRQRQ DJULFXOWXUDOXVHRUFRQYHUVLRQRIIRUHVW ODQGWRQRQIRUHVWXVH" Ŀ Ŀ Ŀ DENo Impact.7KH&LW\RI9HUQRQLVDQXUEDQL]HGFLW\IXOO\EXLOWRXWDQGFRPSULVHG RI YLUWXDOO\DOOLQGXVWULDOXVHVZLWKDIHZFRPPHUFLDODQGUHVLGHQWLDOXVHVVFDWWHUHGWKURXJKRXWWKH FLW\%DVHGXSRQDUHYLHZRIPDSVSUHSDUHGSXUVXDQWWRWKH)DUPODQG0DSSLQJDQG0RQLWRULQJ 3URJUDP)003RIWKH&DOLIRUQLD5HVRXUFHV$JHQF\WKHSURMHFWVWXG\DUHDGRHVQRWFRQWDLQDQ\ ODQG GHVLJQDWHG DV ³3ULPH )DUPODQG´ ³8QLTXH )DUPODQG´ RU ³)DUPODQG RI 6WDWHZLGH ,PSRUWDQFH´ &DOLIRUQLD'HSDUWPHQWRI&RQVHUYDWLRQ)DUPODQG0DSSLQJDQG0RQLWRULQJ3URJUDP7KH&LW\RI 9HUQRQLVLQGLFDWHGZLWKLQ³$UHD1RW0DSSHG´LQPDSVRI/RV$QJHOHV&RXQW\ $VVXFKQRLPSDFWZRXOGRFFXU1R:LOOLDPVRQ$FWFRQWUDFWVDUHDFWLYHIRUDQ\ 4 Evaluation of Environmental Impacts 24 Initial Study SURSHUW\ ZLWKLQ 9HUQRQ $OOSURSHUWLHVZLWKLQ9HUQRQDUH ]RQHG ,QGXVWULDOFHUWDLQSURSHUWLHV KDYHDGGLWLRQDORYHUOD\GLVWULFWVDSSOLHG1HLWKHUWKH,QGXVWULDO]RQHQRUDQ\RYHUOD\VDUHLQWHQGHG IRU DJULFXOWXUDO XVHV 1 R QHZ RU VXEVWDQWLDOO\ PRUH VHYHUH LPSDFWVZRXOGRFFXUZLWK LPSOHPHQWDWLRQRIWKH3URSRVHG8SGDWHWKDQDVLGHQWLILHGLQWKH*HQHUDO3ODQDQG=RQLQJ 2UGLQDQFH3URJUDP(,51RLPSDFWZRXOGRFFXU FGNo Impact.1RWLPEHUODQG H[LVWV ZLWKLQWKH SODQQLQJDUHD7KLVFRQGLWLRQSUHFOXGHV WKH SRVVLELOLW\RIFRQIOLFWVZLWKIRUHVWODQG]RQLQJRUORVVRIIRUHVWODQGDVDUHVXOWRILPSOHPHQWDWLRQ 7KHUHIRUHQRLPSDFWVZRXOGUHVXOWIURPWKH3URSRVHG)RFXVHG8SGDWH1RQHZRUVXEVWDQWLDOO\ PRUHVHYHUHLPSDFWVZRXOGRFFXUZLWKLPSOHPHQWDWLRQRIWKH3URSRVHG)RFXVHG8SGDWHWKDQDV LGHQWLILHGLQWKH*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH3URJUDP(,5 HNo Impact.*LYHQWKHH[LVWLQJLQGXVWULDODQGEXLOWRXWQDWXUHRI9HUQRQWKHSURMHFWZRXOGQRW UHVXOWLQDQ\FRQYHUVLRQRIIDUPODQGRUIRUHVWODQGWRDQRWKHUXVH1RQHZRUVXEVWDQWLDOO\PRUH VHYHUHLPSDFWVZRXOGRFFXUZLWKLPSOHPHQWDWLRQRIWKH3URSRVHG)RFXVHG 8SGDWH WKDQ DV LGHQWLILHGLQWKH*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH3URJUDP(,5 &DOLIRUQLD'HSDUWPHQWRI&RQVHUYDWLRQ:LOOLDPVRQ$FW3URJUDP 4 Evaluation of Environmental Impacts Focused General Plan and Zoning Ordinance Update 25 4.3 – Air Quality :KHUHDYDLODEOHWKHVLJQLILFDQFHFULWHULDHVWDEOLVKHGE\WKHDSSOLFDEOHDLUTXDOLW\ PDQDJHPHQWRUDLUSROOXWLRQFRQWUROGLVWULFWPD\EHUHOLHGXSRQWRPDNHWKHIROORZLQJ GHWHUPLQDWLRQV:RXOGWKHSURMHFW Potentially Significant Impact Less Than Significant with Mitigation Incorporation Less Than Significant Impact No Impact D &RQIOLFWZLWKRUREVWUXFW LPSOHPHQWDWLRQRIWKHDSSOLFDEOH DLUTXDOLW\SODQ"ĿĿĿ E 9LRODWHDQ\DLUTXDOLW\VWDQGDUGRU FRQWULEXWHVXEVWDQWLDOO\WRDQ H[LVWLQJRUSURMHFWHGDLUTXDOLW\ YLRODWLRQ" Ŀ Ŀ Ŀ F 5HVXOWLQDFXPXODWLYHO\ FRQVLGHUDEOHQHWLQFUHDVHRIDQ\ FULWHULDSROOXWDQWIRUZKLFKWKH SURMHFWUHJLRQLVQRQDWWDLQPHQW XQGHUDQDSSOLFDEOHIHGHUDORU VWDWHDPELHQWDLUTXDOLW\VWDQGDUG LQFOXGLQJUHOHDVLQJHPLVVLRQV ZKLFKH[FHHGTXDQWLWDWLYH WKUHVKROGVIRUR]RQHSUHFXUVRUV" Ŀ Ŀ Ŀ G ([SRVHVHQVLWLYHUHFHSWRUVWR VXEVWDQWLDOSROOXWDQW FRQFHQWUDWLRQV"Ŀ Ŀ Ŀ H &UHDWHREMHFWLRQDEOHRGRUV DIIHFWLQJDVXEVWDQWLDOQXPEHURI SHRSOH"ĿĿĿ DLess than Significant Impact. FGPotential Significant Impact.$V LGHQWLILHG LQ WKH 9HUQRQ *HQHUDO 3ODQ DQG =RQLQJ 2UGLQDQFH(,5 RYHUWKHORQJWHUPLPSOHPHQWDWLRQRI*HQHUDO3ODQ SROLFLHVFRXOGUHVXOWLQDQ LQFUHDVHLQFULWHULDSROOXWDQWHPLVVLRQVSULPDULO\GXHWRUHODWHGPRWRUYHKLFOHWULSV6WDWLRQDU\ VRXUFHV DQG DUHD VRXUFHV²LQFOXGLQJ HPLVVLRQV IURP QDWXUDO JDV FRPEXVWLRQ ODQGVFDSH HTXLSPHQWDQGVROYHQWVIURPVXUIDFHFRDWLQJV²ZRXOGUHVXOWLQOHVVHU TXDQWLWLHV RI FULWHULD SROOXWDQWHPLVVLRQV 6WDWLRQDU\VRXUFHVDQGGLHVHOIXHOHGPRELOHVRXUFHVZRXOGDOVRJHQHUDWHHPLVVLRQVRIWR[LFDLU FRQWDPLQDQWV 7$&V LQFOXGLQJ GLHVHO SDUWLFXODWH PDWWHU WKDW FRXOG SRVH D KHDOWK ULVN :KLOH LPSOHPHQWDWLRQRIWKH3URSRVHG)RFXVHG8SGDWHZRXOGOLNHO\KDYHOHVVWKDQVLJQLILFDQWDLUTXDOLW\ LPSDFWVWKH*HQHUDO3ODQ$PHQGPHQWDQG=RQLQJ0DS$PHQGPHQWSURSRVHFKDQJHVLQWKHODQG XVHGHVLJQDWLRQRIVSHFLILFSDUFHOVZLWKLQWURGXFWLRQRIWZRQHZ*HQHUDO3ODQRYHUOD\GLVWULFWVDQG WKUHH QHZ =RQLQJ 'LVWULFWV DQG UHYLVLRQV WR DQRWKHU H[LVWLQJ RYHUOD\ GLVWULFW DV DSSOLHG LQ 4 Evaluation of Environmental Impacts 26 Initial Study ([KLELWVDQGDQGDOORZDQFHRIQHZXVHVWKDWFRXOGUHVXOWLQDQLQFUHDVHLQGHYHORSPHQW LQWHQVLW\DQGDFRUUHVSRQGLQJLQFUHDVHLQYHKLFOHWULSVDQGWUDIILFWKDWFRXOGWULJJHUSRWHQWLDOO\ VLJQLILFDQWDLUTXDOLW\LPSDFWV$VVXFKLPSOHPHQWDWLRQRIWKH3URSRVHG8SGDWHFRXOGUHVXOWLQD QHZVLJQLILFDQWDLUTXDOLW\LPSDFWRUDVXEVWDQWLDOLQFUHDVHLQWKHVHYHULW\RIDSUHYLRXVO\LGHQWLILHG DLUTXDOLW\LPSDFW)XUWKHUPRUHWKH9HUQRQ*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH3URJUDP (,5ZKLOHILQGLQJSURMHFWUHODWHGLPSDFWVUHJDUGLQJDLUTXDOLW\ OHVV WKDQ VLJQLILFDQW IRXQG FXPXODWLYHDLUTXDOLW\LPSDFWVVLJQLILFDQWDQGXQDYRLGDEOH7KHUHIRUHSRWHQWLDODLUTXDOLW\LPSDFWV ZLOOEHIXOO\DQDO\]HGZLWKLQD6XSSOHPHQWDO(,5WRWKH9HUQRQ*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH (,5WREHSUHSDUHGIRUWKHSURSRVHG)RFXVHG8SGDWH HLess than Significant Impact.$VLQGLFDWHGLQWKH,QLWLDO6WXG\FRPSOHWHGIRUWKH 9HUQRQ*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH3URJUDP(,5WKHPDMRULW\RIGHYHORSPHQWDQWLFLSDWHG WRRFFXULQ9HUQRQZRXOGEHSUHGRPLQDQWO\LQGXVWULDO1HZGHYHORSPHQW DVVRFLDWHG ZLWK WKH 3URSRVHG)RFXVHG$PHQGPHQWVPD\EHLQGXVWULDOFRPPHUFLDORUUHVLGHQWLDOLQQDWXUH(DFKQHZ GHYHORSPHQWZLOOEHUHTXLUHGWRFRPSO\ZLWKWKH6RXWK&RDVW$LU4XDOLW\0DQDJHPHQW'LVWULFW¶V JXLGHOLQHVUHJDUGLQJRGRUFRQWURO,QDGGLWLRQWKHSURSRVHG=RQLQJ2UGLQDQFHLQFOXGHVDGGLWLRQDO UHTXLUHPHQWVWRSURKLELWWKHHPLVVLRQRIQR[LRXVRGRUVLQWRWKHRXWVLGHDLU$Q\LPSDFWDVVRFLDWHG ZLWK WKH 3URSRVHG )RFXVHG 8SGDWH ZRXOG DV VXFK EH EHQHILFLDO JLYHQ WKH &LW\¶V SURSRVHG PHDVXUHVWRFRQVWUDLQRGRUVIURPEXVLQHVVHV 7KHSURSRVHG UHVLGHQWLDOGHYHORSPHQWSURMHFWDW QG'ULYHJLYHQLWVUHVLGHQWLDOQDWXUH ZRXOGQRWLQYROYHDQ\XVHVDVVRFLDWHGZLWKRGRUFRPSODLQWVDVLQGLFDWHGLQWKH&(4$$LU4XDOLW\ +DQGERRN VXFK DV DJULFXOWXUDO RSHUDWLRQV ZDVWHZDWHU WUHDWPHQWSODQWVODQGILOOVDQGVRPH LQGXVWULDORSHUDWLRQV&RPSOLDQFHZLWKH[LVWLQJUHJXODWLRQVZLOOHQVXUHWKDWLPSDFWZLOOEHOHVV WKDQVLJQLILFDQW7KHSURSRVHG(PHUJHQF\6KHOWHU2YHUOD\ZRXOGOLNHZLVHKDYHQRRGRUSURGXFLQJ XVHV :LWKUHJDUGWRWKHSURSRVHG7UXFNLQJDQG)UHLJKW2YHUOD\'LVWULFWRGRUVPD\EHDVVRFLDWHGZLWK GLHVHOWUXFNLQJDFWLYLWLHVKRZHYHUH[LVWLQJXVHVDOUHDG\JHQHUDWHDWWUDFWVLJQLILFDQWGLHVHOWUXFN WUDIILF2GRUVDVVRFLDWHGZLWKQHZWUXFNLQJRUIUHLJKWWHUPLQDOVFRQVWUXFWHGSXUVXDQWWRUHYLVHG ]RQLQJSROLF\DUHQRWDQWLFLSDWHGWREHQRWLFHDEOHRUVLJQLILFDQWUHODWLYHWRH[LVWLQJFRQGLWLRQV ([SDQGHGDUHDVRIWKH&RPPHUFLDO2YHUOD\'LVWULFWDUHQRWDQWLFLSDWHGWRKDYHPRUHVLJQLILFDQW RGRULPSDFWVWKDQH[LVWLQJLQGXVWULDOXVHVKDYHRGRULPSDFWVDUH OLNHO\ WR EH OHVV ZLWK FRPPHUFLDOXVHVWKDQLQGXVWULDO1RQHZRUVXEVWDQWLDOO\PRUHVHYHUHLPSDFWVZRXOGRFFXUZLWK LPSOHPHQWDWLRQRIWKH3URSRVHG8SGDWHWKDQWKRVHLGHQWLILHGLQWKH*HQHUDO3ODQDQG=RQLQJ 2UGLQDQFH3URJUDP(,5 4 Evaluation of Environmental Impacts Focused General Plan and Zoning Ordinance Update 27 4.4 – Biological Resources :RXOGWKHSURMHFW Potentially Significant Impact Less Than Significant with Mitigation Incorporation Less Than Significant Impact No Impact D +DYHDVXEVWDQWLDODGYHUVHHIIHFW HLWKHUGLUHFWO\RUWKURXJKKDELWDW PRGLILFDWLRQVRQDQ\VSHFLHV LGHQWLILHGDVDFDQGLGDWH VHQVLWLYHRUVSHFLDOVWDWXVVSHFLHV LQORFDORUUHJLRQDOSODQVSROLFLHV RUUHJXODWLRQVRUE\WKH&DOLIRUQLD 'HSDUWPHQWRI)LVKDQG*DPHRU 86)LVKDQG:LOGOLIH6HUYLFH" Ŀ Ŀ Ŀ E +DYHDVXEVWDQWLDODGYHUVHHIIHFW RQDQ\ULSDULDQKDELWDWRURWKHU VHQVLWLYHQDWXUDOFRPPXQLW\ LGHQWLILHGLQORFDORUUHJLRQDO SODQVSROLFLHVUHJXODWLRQVRUE\ WKH&DOLIRUQLD'HSDUWPHQWRI)LVK DQG*DPHRU86)LVKDQG:LOGOLIH 6HUYLFH" Ŀ Ŀ Ŀ F +DYHDVXEVWDQWLDODGYHUVHHIIHFW RQIHGHUDOO\SURWHFWHGZHWODQGVDV GHILQHGE\6HFWLRQRIWKH &OHDQ:DWHU$FWLQFOXGLQJEXW QRWOLPLWHGWRPDUVKYHUQDOSRRO FRDVWDOHWFWKURXJKGLUHFW UHPRYDOILOOLQJK\GURORJLFDO LQWHUUXSWLRQRURWKHUPHDQV" Ŀ Ŀ Ŀ G ,QWHUIHUHVXEVWDQWLDOO\ZLWKWKH PRYHPHQWRIDQ\QDWLYHUHVLGHQW RUPLJUDWRU\ILVKRUZLOGOLIH VSHFLHVRUZLWKHVWDEOLVKHGQDWLYH UHVLGHQWRUPLJUDWRU\ZLOGOLIH FRUULGRUVRULPSHGHWKHXVHRI QDWLYHZLOGOLIHQXUVHU\VLWHV" Ŀ Ŀ Ŀ H &RQIOLFWZLWKDQ\ORFDOSROLFLHVRU RUGLQDQFHVSURWHFWLQJELRORJLFDO UHVRXUFHVVXFKDVDWUHH SUHVHUYDWLRQSROLF\RURUGLQDQFH" Ŀ Ŀ Ŀ 4 Evaluation of Environmental Impacts 28 Initial Study I &RQIOLFWZLWKWKHSURYLVLRQVRIDQ DGRSWHG+DELWDW&RQVHUYDWLRQ 3ODQ1DWXUDO&RPPXQLW\ &RQVHUYDWLRQ3ODQRURWKHU DSSURYHGORFDOUHJLRQDORUVWDWH KDELWDWFRQVHUYDWLRQSODQ" Ŀ Ŀ Ŀ DINo Impact.$VLQGLFDWHGLQWKH,QLWLDO6WXG\FRPSOHWHGIRUWKH9HUQRQ*HQHUDO3ODQDQG =RQLQJ2UGLQDQFH3URJUDP(,5 9HUQRQLVDIXOO\EXLOWRXWFRPPXQLW\DQGQRQDWLYHKDELWDW UHPDLQV*LYHQWKHLQGXVWULDOQDWXUHRIWKHPDMRULW\RIWKHFLW\QRXQLTXHELRORJLFDOUHVRXUFHVRU KDELWDW FRQVHUYDWLRQ DUHDV DUH ORFDWHG ZLWKLQ WKH SODQQLQJ DUHD1RVSHFLHVLGHQWLILHGDVD FDQGLGDWHVHQVLWLYHRUVSHFLDOVWDWXVVSHFLHVLQORFDORUUHJLRQDOSODQVSROLFLHVRUUHJXODWLRQVRU E\WKH&DOLIRUQLD'HSDUWPHQWRI)LVKDQG*DPHRU86)LVKDQG:LOGOLIH6HUYLFHDUHNQRZQWR H[LVW ZLWKLQ WKH 3ODQQLQJ $UHD $FFRUGLQJ WR WKH IHGHUDO 1DWLRQDO :HWODQGV ,QYHQWRU\ WKH SURMHFWVLWHGRHVQRWFRQWDLQDQ\ZHWODQGVDQGWKHSURSRVHGSURMHFWZRXOGQRWGLVWXUEDQ\ RIIVLWHZHWODQGV7KH/RV$QJHOHV5LYHUZKHUHLWUXQVWKURXJK9HUQRQLVFRQFUHWHOLQHGDQG GRHVQRWIXQFWLRQDVULSDULDQKDELWDW7KH&LW\RI9HUQRQGRHVQRWKDYHDQ\DGRSWHGWUHH SUHVHUYDWLRQRUGLQDQFHRURWKHUSROLFLHVSURWHFWLQJELRORJLFDOUHVRXUFHV9HUQRQGRHVQRW FRQWDLQDQ\+DELWDW&RQVHUYDWLRQ3ODQ 1DWXUDO&RPPXQLW\&RQVHUYDWLRQ3ODQ RURWKHU DSSURYHGORFDOUHJLRQDORUVWDWHKDELWDWFRQVHUYDWLRQSODQ1RLPSDFWZLOORFFXU1RQHZRU VXEVWDQWLDOO\PRUHVHYHUHLPSDFWZRXOGRFFXUZLWKLPSOHPHQWDWLRQRIWKH3URSRVHG)RFXVHG 8SGDWH 8QLWHG6WDWHV)LVKDQG:LOGOLIH6HUYLFH1DWLRQDO:HWODQGV,QYHQWRU\ KWWS:HWODQGV:HWODQGV0DSSHUKWPO!>$FFHVVHG$XJXVW@ 8QLWHG6WDWHV)LVKDQG:LOGOLIH6HUYLFH&RQVHUYDWLRQ3ODQVDQG$JUHHPHQWV'DWDEDVH KWWSHFRVIZVJRYFRQVHUYBSODQVSXEOLFMVS!>$FFHVVHG$XJXVW@ &DOLIRUQLD'HSDUWPHQWRI)LVKDQG*DPH&DOLIRUQLD1DWXUDO&RPPXQLW\&RQVHUYDWLRQ3ODQQLQJ KWWSZZZGIJFDJRYKDEFRQQFFS!>$FFHVVHG$XJXVW@ 4 Evaluation of Environmental Impacts Focused General Plan and Zoning Ordinance Update 29 4.5 – Cultural Resources :RXOGWKHSURMHFW Potentially Significant Impact Less Than Significant with Mitigation Incorporation Less Than Significant Impact No Impact D &DXVHDVXEVWDQWLDODGYHUVHFKDQJH LQWKHVLJQLILFDQFHRIDKLVWRULFDO UHVRXUFHDVGHILQHGLQ"Ŀ Ŀ Ŀ E &DXVHDVXEVWDQWLDODGYHUVHFKDQJH LQWKHVLJQLILFDQFHRIDQ DUFKDHRORJLFDOUHVRXUFHSXUVXDQWWR " Ŀ Ŀ Ŀ F 'LUHFWO\RULQGLUHFWO\GHVWUR\D XQLTXHSDOHRQWRORJLFDOUHVRXUFHRU VLWHRUXQLTXHJHRORJLFIHDWXUH"Ŀ Ŀ Ŀ G 'LVWXUEDQ\KXPDQUHPDLQV LQFOXGLQJWKRVHLQWHUUHGRXWVLGHRI IRUPDOFHPHWHULHV"Ŀ Ŀ Ŀ DELess than Significant Impact.$VLQGLFDWHGLQWKH,QLWLDO6WXG\DVVRFLDWHGZLWKWKH 9HUQRQ*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH3URJUDP(,5 9HUQRQLVODUJHO\EXLOWRXWDQGGRHVQRW FRQWDLQDQ\NQRZQDUFKDHRORJLFDOUHVRXUFHV,QGXVWULDOXVHVKDYHEHHQWKHSUHGRPLQDQWODQGXVH LQWKH&LW\VLQFHWKHHDUO\V9HUQRQFRQWDLQVPDQ\LQGXVWULDOEXLOGLQJVWKDWKRXVHGLYHUVH LQGXVWULHVVRPHRIZKLFKDOVRGLVSOD\DUFKLWHFWXUHRIGLVWLQFWSHULRGVDQGVW\OHVDVLQGLFDWHGLQ WKH*HQHUDO3ODQ5HVRXUFHV(OHPHQW $GRSWLRQRIWKH3URSRVHG)RFXVHG8SGDWHZLOOQRWUHVXOWLQDQ\DFWLRQWKDWZLOOGLUHFWO\FDXVHWKH HOLPLQDWLRQRUDOWHUDWLRQRIDQ\EXLOGLQJWKDWPD\KDYHKLVWRULFVLJQLILFDQFH7KH*HQHUDO3ODQ 5HVRXUFHV(OHPHQWFRQWDLQVSROLFLHVWKDWZRUNWRSURWHFWSRWHQWLDOO\KLVWRULFEXLOGLQJVDQGVLWHV WKHIRFXVHGXSGDWHZRXOGQRWUHYLVHRUUHPRYHDQ\RIWKHVHSROLFLHV1REXLOGLQJVDUHORFDWHGDW QG'ULYHKRXVLQJVLWH*LYHQWKDWWKHVLWHZDVSUHYLRXVO\GHYHORSHGDQGJUDGHGIRUSDVW GHYHORSPHQWV DQ\ EXULHG DUFKDHRORJLFDO UHVRXUFHV ZRXOG KDYH DOUHDG\ EHHQ XQFRYHUHG RU GHVWUR\HGDWWKHWLPHRILQLWLDOGHYHORSPHQWRIWKHVLWH,PSDFWVUHODWHGWRKLVWRULFDODQG DUFKDHRORJLFDOUHVRXUFHVIRUWKH3URSRVHG)RFXVHG8SGDWHZRXOGEHVLPLODUWRWKRVHLGHQWLILHGLQ WKH *HQHUDO 3ODQ DQG =RQLQJ 2UGLQDQFH 3URJUDP (,5 LPSDFWVZRXOGEHOHVVWKDQ VLJQLILFDQW FGNo Impact.*LYHQWKHKLJKO\EXLOWRXWDQGLQGXVWULDOFKDUDFWHURI9HUQRQQREXULHG SDOHRQWRORJLFDOUHVRXUFHVRUKXPDQUHPDLQVRUFHPHWHULHVDUHDQWLFLSDWHGWREHGLVWXUEHGE\WKH SURSRVHGSURMHFW([LVWLQJODZ6HFWLRQRIWKH&DOLIRUQLD+HDOWKDQG6DIHW\&RGHDQG 6HFWLRQVDQGRIWKH3XEOLF5HVRXUFHV&RGHUHTXLUHVWKHSURWHFWLRQDQGSURSHU WUHDWPHQWRIDQ\SUHKLVWRULFRUKLVWRULFDUWLIDFWVRUKXPDQUHPDLQVHQFRXQWHUHGGXULQJH[FDYDWLRQ DFWLYLWLHV ,PSOHPHQWDWLRQ RI *HQHUDO 3ODQ DQG =RQLQJ 2UGLQDQFH SROLF\ DQG VWDQGDUGV DQG DSSOLFDWLRQRIH[LVWLQJODZRQDQLQGLYLGXDOSURMHFWEDVLVZLOODOORZDQ\SRWHQWLDOSDOHRQWRORJLFDO UHVRXUFHVRUKXPDQUHPDLQVXQFRYHUHGWREHSURSHUO\WUHDWHG 4 Evaluation of Environmental Impacts 30 Initial Study :LWKUHJDUGWRWKHSRWHQWLDOKRXVLQJGHYHORSPHQWDWQG'ULYHVLQFHWKHSURMHFWVLWHZDV GHYHORSHG LQ WKH SDVW DOWKRXJK LW LV YDFDQW QRZ DV DOO EXLOGLQJV KDYH EHHQ GHPROLVKHG QR SDOHRQWRORJLFDOUHVRXUFHVRUKXPDQUHPDLQVRUFHPHWHULHVDUHDQWLFLSDWHGWREHGLVWXUEHGE\WKH SURSRVHGSURMHFW$Q\EXULHGSDOHRQWRORJLFDOUHVRXUFHVRUKXPDQUHPDLQVOLNHO\ZRXOGKDYHEHHQ XQFRYHUHGRUGHVWUR\HGDWWKDWWLPHRILQLWLDOGHYHORSPHQWRIWKHVLWH,QWKHXQOLNHO\HYHQWWKDW SDOHRQWRORJLFDO UHVRXUFHV RU KXPDQ UHPDLQV DUH XQFRYHUHG H[LVWLQJ UHJXODWRU\ SURFHGXUHV SXUVXDQWWR6HFWLRQRIWKH&DOLIRUQLD+HDOWKDQG6DIHW\&RGHDQG6HFWLRQVDQG RIWKH3XEOLF5HVRXUFHV&RGHZRXOGEHUHTXLUHGDQGLPSDFWVWRUHVRXUFHVDQGRUKXPDQ UHPDLQVZRXOGEHDYRLGHG1RLPSDFWZLOORFFXUZLWKDSSOLFDWLRQRIWKHVHH[LVWLQJUHJXODWLRQV ,PSDFWVRIWKH3URSRVHG8SGDWHZRXOGEHVLPLODUWRWKRVHLGHQWLILHGLQWKH*HQHUDO3ODQDQG =RQLQJ2UGLQDQFH3URJUDP(,5QRLPSDFWZRXOGRFFXU 4 Evaluation of Environmental Impacts Focused General Plan and Zoning Ordinance Update 31 4.6 – Geology and Soils :RXOGWKHSURMHFW Potentially Significant Impact Less Than Significant with Mitigation Incorporation Less Than Significant Impact No Impact D ([SRVHSHRSOHRUVWUXFWXUHVWR SRWHQWLDOVXEVWDQWLDODGYHUVH HIIHFWVLQFOXGLQJWKHULVNRIORVV LQMXU\RUGHDWKLQYROYLQJ L 5XSWXUHRIDNQRZQHDUWKTXDNH IDXOWDVGHOLQHDWHGRQWKHPRVW UHFHQW$OTXLVW3ULROR(DUWKTXDNH )DXOW=RQLQJ0DSLVVXHGE\WKH 6WDWH*HRORJLVWIRUWKHDUHDRU EDVHGRQRWKHUVXEVWDQWLDOHYLGHQFH RIDNQRZQIDXOW"5HIHUWR'LYLVLRQ RI0LQHVDQG*HRORJ\6SHFLDO 3XEOLFDWLRQ ĿĿĿ LL 6WURQJVHLVPLFJURXQGVKDNLQJ"ĿĿĿ LLL6HLVPLFUHODWHGJURXQGIDLOXUH LQFOXGLQJOLTXHIDFWLRQ"ĿĿĿ LY/DQGVOLGHV"ĿĿĿ E 5HVXOWLQVXEVWDQWLDOVRLOHURVLRQRU WKHORVVRIWRSVRLO"ĿĿĿ F %HORFDWHGRQDJHRORJLFXQLWRUVRLO WKDWLVXQVWDEOHRUWKDWZRXOG EHFRPHXQVWDEOHDVDUHVXOWRIWKH SURMHFWDQGSRWHQWLDOO\UHVXOWLQRQ RURIIVLWHODQGVOLGHODWHUDO VSUHDGLQJVXEVLGHQFHOLTXHIDFWLRQ RUFROODSVH" ĿĿĿ G %HORFDWHGRQH[SDQVLYHVRLODV GHILQHGLQ7DEOH%RIWKH 8QLIRUP%XLOGLQJ&RGH FUHDWLQJVXEVWDQWLDOULVNVWROLIHRU SURSHUW\" ĿĿĿ 4 Evaluation of Environmental Impacts 32 Initial Study H +DYHVRLOVLQFDSDEOHRIDGHTXDWHO\ VXSSRUWLQJWKHXVHRIVHSWLFWDQNV RUDOWHUQDWLYHZDVWHZDWHUGLVSRVDO V\VWHPVZKHUHVHZHUVDUHQRW DYDLODEOHIRUWKHGLVSRVDORIZDVWH ZDWHU" ĿĿĿ DLLess than Significant Impact.1RSRUWLRQRI9HUQRQLVWUDYHUVHGE\DNQRZQIDXOWDV GHOLQHDWHGRQWKH$OTXLVW3ULROR(DUWKTXDNH)DXOW=RQLQJ0DS $VFRQFOXGHGLQWKH9HUQRQ *HQHUDO3ODQDQG=RQLQJ2UGLQDQFH3URJUDP(,5WKHSRWHQWLDOIRU VXUIDFH IDXOW UXSWXUH LV FRQVLGHUHG WR EH ORZ,PSDFWV RI WKH 3URSRVHG )RFXVHG 8SGDWH ZRXOG EH VLPLODU WR WKRVH LGHQWLILHGLQWKHSULRU3URJUDP(,5DQGZRXOGEHOHVVWKDQVLJQLILFDQW DLLLess than Significant Impact.$VQRWHGDERYHLQDLWKH&DOLIRUQLD'HSDUWPHQWRI &RQVHUYDWLRQUHSRUWVQRNQRZQIDXOWVLQ9HUQRQ+RZHYHUWKHSURSRVHGSURMHFWDQGDOOIXWXUH GHYHORSPHQWSURSRVHGSXUVXDQWWR*HQHUDO3ODQODQGXVHSROLF\DQG=RQLQJ2UGLQDQFHVWDQGDUGV ZLOOEHVXEMHFWWRJURXQGVKDNLQJLPSDFWVVKRXOGDPDMRUHDUWKTXDNHRFFXULQWKHIXWXUHLQWKH VXUURXQGLQJVHLVPLFDOO\DFWLYH6RXWKHUQ&DOLIRUQLDUHJLRQ7KH6DIHW$OHPHQWRIWKH*HQHUDO3ODQ LQGLFDWHVWKDWWKH/DV&LHQJDV)DXOWUXQVDORQJWKHQRUWKHDVWERXQGDU\RIWKH&LW$XUWKHUPRUH EOLQG WKUXVW IDXOWV PD\ EH ORFDWHG LQ WKH YLFLQLW\ %OLQG WKUXVW IDXOWV ODFN VXSHUILFLDO JURXQG IHDWXUHVQRUPDOO\DVVRFLDWHGZLWKWKUXVWIDXOWVWKDWKDYHUHFHQWO\H[SHULHQFHGVHLVPLFDFWLYLW\ 3RWHQWLDOLPSDFWVLQFOXGHLQMXU\RUORVVRIOLIHDQGSURSHUW\GDPDJH %XLOGLQJV DQG VWUXFWXUHV SURSRVHG SXUVXDQW WR WKH *HQHUDO 3ODQDQG=RQLQJ2UGLQDQFHZLOOEH VXEMHFW WR WKH VHLVPLF GHVLJQ FULWHULD RI WKH &DOLIRUQLD %XLOGLQJ &RGH &%& DQG DQ\ SURMHFW VSHFLILFGHVLJQUHTXLUHPHQWV$GKHUHQFHWRWKHVHUHTXLUHPHQWVZLOOUHGXFHWKHSRWHQWLDORIWKH EXLOGLQJ IURP FROODSVLQJ GXULQJ DQ HDUWKTXDNH WKHUHE\ PLQLPL]LQJ LQMXU\ DQG ORVV RI OLIH $OWKRXJKVWUXFWXUHVPD\EHGDPDJHGGXULQJHDUWKTXDNHVDGKHUHQFH WR VHLVPLF GHVLJQ UHTXLUHPHQWVZLOOPLQLPL]HGDPDJHWRSURSHUW\DQGVWUXFWXUHVEHFDXVHWKHVWUXFWXUHZRXOGEH GHVLJQHGQRWWRFROODSVH7KH&%&LVLQWHQGHGWRSURYLGHPLQLPXP UHTXLUHPHQWV WR SUHYHQW PDMRUVWUXFWXUDOIDLOXUHDQGORVVRIOLIH$GKHUHQFHWRH[LVWLQJUHJXODWLRQVZLOOUHGXFHWKHULVNRI ORVV LQMXU\ DQG GHDWK LPSDFWV RI WKH 3URSRVHG )RFXVHG 8SGDWH ZRXOG EH VLPLODU WR WKRVH LGHQWLILHGLQWKH*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH3URJUDP(,5DQGZRXOGEHOHVVWKDQ VLJQLILFDQW DLLLLess than Significant Impact.$VLQGLFDWHGLQWKH*HQHUDO3ODQDQG=RQLQJ 2UGLQDQFH3URJUDP(,5SRUWLRQVRIWKHVRXWKDQGHDVWHUQVHFWRUVRIWKH&LW\DUHVXVFHSWLEOHWR OLTXHIDFWLRQ &DOLIRUQLD6WDWH'HSDUWPHQWRI&RQVHUYDWLRQ&DOLIRUQLD*HRORJLFDO6XUYH\$OTXLVW3ULROR(DUWKTXDNH)DXOW =RQH0DSV/RV$QJHOHV4XDGUDQJOH-DQXDU\2WKHUSRUWLRQVRIWKHFLW\QRWPDSSHG +RZHYHU DOO GHYHORSPHQW RFFXUULQJ SXUVXDQW WR WKH XSGDWHG *HQHUDO 3ODQ DQG =RQLQJ2UGLQDQFHZLOOEHFRQVWUXFWHGLQFRPSOLDQFHZLWKWKH&%&DQGZLOOLQFRUSRUDWHDOOVHLVPLF VDIHW\IHDWXUHVDVUHTXLUHG1HZGHYHORSPHQWZLOOFRQVLVWSULPDULO\RIQHZLQGXVWULDOEXLOGLQJV WKDWUHSODFHH[LVWLQJROGHUVWUXFWXUHVWKHQHZVWUXFWXUHVZLOO LQFRUSRUDWH LPSURYHG VHLVPLF VDIHW\IHDWXUHVDQGWKXVDEHQHILFLDOHIIHFWRILPSURYLQJVHLVPLFVDIHW\PD\UHVXOW7KH&LW\ HQIRUFHVVWULQJHQWVDIHW\FULWHULDIRUQHZFRQVWUXFWLRQLQFOXGLQJVLWHVSHFLILFVRLOVLQYHVWLJDWLRQ DQG WKH XVH RI HQJLQHHULQJ WHFKQLTXHV VSHFLILF WR HDFK VLWH WKDW RYHUFRPHV DQ\ SRWHQWLDO &DOLIRUQLD5HVRXUFHV$JHQF\'HSDUWPHQWRI&RQVHUYDWLRQ6WDWHRI&DOLIRUQLD6HLVPLF+D]DUG=RQHV6RXWK *DWH4XDGUDQJOH0DUFK &DOLIRUQLD5HVRXUFHV$JHQF\'HSDUWPHQWRI&RQVHUYDWLRQ6WDWHRI&DOLIRUQLD6HLVPLF+D]DUG=RQHV/RV $QJHOHV4XDGUDQJOH0DUFK 4 Evaluation of Environmental Impacts Focused General Plan and Zoning Ordinance Update 33 JHRWHFKQLFDOFRQVWUDLQWV7KHSURSRVHGSURMHFWZRXOGQRWPRGLI\DQ\RIWKHVHH[LVWLQJVWDQGDUGV DQGUHJXODWLRQVDQGLPSDFWVRIWKH3URSRVHG)RFXVHG8SGDWHZRXOGEHVLPLODUWRWKRVHLGHQWLILHG LQWKH*HQHUDO3ODQ(,5DQGZRXOGEHOHVVWKDQVLJQLILFDQW DLYNo Impact.7KH&LW\RI9HUQRQLVYLUWXDOO\IODW 1RSRUWLRQRIWKHSODQQLQJDUHDLVLQGLFDWHG WREHZLWKLQD6WDWHRI&DOLIRUQLD6HLVPLF+D]DUG=RQHODQGVOLGH]RQHRIUHTXLUHGLQYHVWLJDWLRQ 7KHSURSRVHGUHVLGHQWLDOSURMHFWDWQG'ULYHZRXOGEHFRQVWUXFWHGRQDIODWVLWHZLWKQR SRWHQWLDO IRU ODQGVOLGHV ,PSDFWV RI WKH 3URSRVHG )RFXVHG 8SGDWH ZRXOG EH VLPLODU WR WKRVH LGHQWLILHGLQWKH*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH3URJUDP(,5QRLPSDFWZRXOGRFFXU ELess than Significant Impact.7KH,QLWLDO6WXG\IRUWKH*HQHUDO3ODQDQG=RQLQJ 2UGLQDQFH3URJUDP(,5LQGLFDWHGWKDWSURSRVHGQHZFRQVWUXFWLRQSXUVXDQWWR*HQHUDO3ODQODQG XVHSROLF\FRXOGUHVXOWLQJUDGLQJDQGHDUWKZRUNWKDWZRXOGH[SRVHVRLOVLQFUHDVLQJWKHFKDQFH IRUVRLOHURVLRQ,PSOHPHQWDWLRQRIWKH3URSRVHG)RFXVHG8SGDWHZRXOGQRWFKDQJHDQ\RIWKHVH FRQGLWLRQV RU UHVXOW LQ PRUH VLJQLILFDQW LPSDFWV DV QR QHZ DUHDV WKDW ZHUH SUHYLRXVO\ XQGHYHORSHGZRXOGKDYHQHZSRWHQWLDOIRUGHYHORSPHQW2QO\WKHDOORZHGXVHVRQWKHVHVLWHVDQG RWKHUSURFHGXUDOUHTXLUHPHQWVKDYHEHHQUHYLVHGE\WKH3URSRVHG)RFXVHG8SGDWH :LWKUHJDUGWRQG'ULYHIXWXUHKRXVLQJFRQVWUXFWLRQRQWKLVVLWHLVVXEMHFWWR6&$40' 5XOHDQGWKHHURVLRQFRQWUROUHTXLUHPHQWVRIWKH&%&WRSUHYHQWZLQGEORZQDQGVWRUPZDWHU UHODWHGHURVLRQ5XOHZLOOPLQLPL]HZLQGEORZQHURVLRQE\UHTXLULQJVWDELOL]DWLRQRIGLVWXUEHG VRLOVGXULQJFRQVWUXFWLRQDFWLYLWLHVWKURXJKPHDVXUHVDVVXFKGDLO\ZDWHULQJ5HTXLUHGHURVLRQ FRQWUROSODQVZLOOHQVXUHWKDWPHDVXUHVDUHLPSOHPHQWHGDWSURMHFWVLWHVWRSUHYHQWRUPLQLPL]H HURVLRQGXHWRUDLQHQVXULQJWKDWGRZQVWUHDPZDWHUERGLHVDUHSURWHFWHGIURPVHGLPHQWDWLRQ 3URMHFWVZLOOFRQWLQXHWREHVXEMHFWWRVWDQGDUGHURVLRQFRQWURODQGHQJLQHHULQJWHFKQLTXHVVHW IRUWKLQWKH0XQLFLSDO&RGHLQFOXGLQJ1DWLRQDO3ROOXWLRQ'LVFKDUJH(OLPLQDWLRQ6\VWHP13'(6 UHTXLUHPHQWV,PSDFWVRIWKH3URSRVHG)RFXVHG8SGDWHZRXOGEHVLPLODUWRWKRVHLGHQWLILHGLQWKH *HQHUDO3ODQDQG=RQLQJ2UGLQDQFH3URJUDP(,5DQGZRXOGEHOHVVWKDQVLJQLILFDQW FGLess than Significant Impact.$VLQGLFDWHGDERYHLQDL ±DLYWKH3URSRVHG)RFXVHG 8SGDWHZRXOGUHVXOWLQOHVVWKDQVLJQLILFDQWLPSDFWV7KH,QLWLDO6WXG\IRUWKH*HQHUDO3ODQ DQG=RQLQJ2UGLQDQFH3URJUDP(,5QRWHGWKDWWKH&LW\UHTXLUHVJHRWHFKQLFDOLQYHVWLJDWLRQVIRUDOO QHZGHYHORSPHQWLQVHLVPLFDQGJHRORJLFKD]DUGDUHDV:KHUHGHYHORSPHQWZRXOGEHSURSRVHG RQ D JHRORJLF XQLW RU VRLO WKDW LV XQVWDEOH RU ORFDWHG RQ H[SDQVLYHVRLOWKHDSSOLFDQWZLOOEH UHTXLUHGWRXVHVSHFLILFHQJLQHHULQJDQGFRQVWUXFWLRQVWDQGDUGVDQGPXVWFRPSO\ZLWKWKH&LW\ DQGVWDWHEXLOGLQJFRGHV:LWKUHJDUGWRGHYHORSPHQWDWQG 'ULYH D SURMHFWVSHFLILF JHRWHFKQLFDO LQYHVWLJDWLRQ ZRXOG EH UHTXLUHG FRQVLVWHQW ZLWK VWDQGDUG &LW\ SURFHGXUHV 7KH UHFRPPHQGDWLRQV RI WKH JHRWHFKQLFDO UHSRUW ZLOO EH LPSOHPHQWHGGXULQJ VLWH SUHSDUDWLRQ DQG JUDGLQJ7KH&%&UHTXLUHVVSHFLDOGHVLJQFRQVLGHUDWLRQVIRUIRXQGDWLRQVRIVWUXFWXUHVEXLOWRQVRLOV ZLWKH[SDQVLRQLQGLFHVJUHDWHUWKDQ7KH&%&DOVRLQFOXGHVDUHTXLUHPHQWWKDWDQ\&LW\ DSSURYHG UHFRPPHQGDWLRQV FRQWDLQHG LQ WKH VRLO UHSRUW EH PDGH FRQGLWLRQV RI WKH EXLOGLQJ SHUPLW &RPSOLDQFH ZLWK H[LVWLQJ &%& UHJXODWLRQV ZRXOG OLPLW KD]DUGLPSDFWVDULVLQJIURP XQVWDEOH VRLOV WR OHVV WKDQ VLJQLILFDQW ,PSDFWV UHODWHG WR RQ RU RIIVLWH ODQGVOLGH ODWHUDO VSUHDGLQJVXEVLGHQFHOLTXHIDFWLRQFROODSVH RUH[SDQVLYHVRLOVZRXOG EHOHVVWKDQVLJQLILFDQW ZLWKLPSOHPHQWDWLRQRIWKHSURSRVHGJHRWHFKQLFDOUHFRPPHQGDWLRQV,PSDFWVRIWKH3URSRVHG )RFXVHG8SGDWHZRXOGEHVLPLODUWRWKRVHLGHQWLILHGLQWKH *HQHUDO 3ODQ DQG =RQLQJ 2UGLQDQFH3URJUDP(,5DQGZRXOGEHOHVVWKDQVLJQLILFDQW &DOLIRUQLD5HVRXUFHV$JHQF\'HSDUWPHQWRI&RQVHUYDWLRQ6WDWHRI&DOLIRUQLD6HLVPLF+D]DUG=RQHV6RXWK *DWH4XDGUDQJOH0DUFK &DOLIRUQLD5HVRXUFHV$JHQF\'HSDUWPHQWRI&RQVHUYDWLRQ6WDWHRI&DOLIRUQLD6HLVPLF+D]DUG=RQHV/RV $QJHOHV4XDGUDQJOH0DUFK 4 Evaluation of Environmental Impacts 34 Initial Study HNo Impact.1HZGHYHORSPHQWZRXOGEHUHTXLUHGWRFRQQHFWWRSXEOLFVHZHUVHUYLFHSXUVXDQW WR&LW\SROLFLHV1RLPSDFWZRXOGRFFXU1RQHZRUVXEVWDQWLDOO\PRUHVHYHUHLPSDFWVZRXOGRFFXU ZLWKLPSOHPHQWDWLRQRIWKH3URSRVHG)RFXVHG8SGDWH 4 Evaluation of Environmental Impacts Focused General Plan and Zoning Ordinance Update 35 4.7 – Greenhouse Gas Emissions Potentially Significant Impact Less Than Significant with Mitigation Incorporation Less Than Significant Impact No Impact D *HQHUDWHJUHHQKRXVHJDV HPLVVLRQVHLWKHUGLUHFWO\RU LQGLUHFWO\WKDWPD\KDYHD VLJQLILFDQWLPSDFWRQWKH HQYLURQPHQW" Ŀ Ŀ Ŀ E &RQIOLFWZLWKDQDSSOLFDEOHSODQ SROLF\RUUHJXODWLRQDGRSWHGIRUWKH SXUSRVHRIUHGXFLQJWKHHPLVVLRQV RIJUHHQKRXVHJDVHV"Ŀ Ŀ Ŀ DEPotentially Significant Impact.:KLOHLPSOHPHQWDWLRQRIWKH 3URSRVHG)RFXVHG8SGDWH ZRXOGOLNHO\KDYHOHVVWKDQVLJQLILFDQWJUHHQKRXVHJDVHPLVVLRQLPSDFWVWKH*HQHUDO3ODQDQG =RQLQJ$PHQGPHQWVSURSRVHFKDQJHVLQWKHODQGXVHGHVLJQDWLRQ]RQLQJRIVSHFLILFSDUFHOVDV LQGLFDWHGLQ([KLELWVDQGWKDWZRXOGUHVXOWLQDSRWHQWLDOLQFUHDVHLQGHYHORSPHQWLQWHQVLW\ DQGDFRUUHVSRQGLQJLQFUHDVHLQYHKLFOHWULSVDQGWUDIILFZKLFKFRXOGKDYHSRWHQWLDOO\VLJQLILFDQW JUHHQKRXVH JDV HPLVVLRQ LPSDFWV $V VXFK LPSOHPHQWDWLRQ RI WKH 3URSRVHG )RFXVHG 8SGDWH FRXOGUHVXOWLQDQHZVLJQLILFDQWLPSDFW7KHUHIRUHSRWHQWLDOJUHHQKRXVHJDVHPLVVLRQLPSDFWVZLOO EH IXOO\ DGGUHVVHG ZLWKLQ D 6XSSOHPHQWDO (,5 WR WKH 9HUQRQ *HQHUDO 3ODQ DQG =RQLQJ 2UGLQDQFH3URJUDP(,5WREHSUHSDUHGIRUWKH3URSRVHG)RFXVHG8SGDWH 4 Evaluation of Environmental Impacts 36 Initial Study 4.8 – Hazards and Hazardous Materials Potentially Significant Impact Less Than Significant with Mitigation Incorporation Less Than Significant Impact No Impact D &UHDWHDVLJQLILFDQWKD]DUGWRWKH SXEOLFRUWKHHQYLURQPHQWWKURXJK WKHURXWLQHWUDQVSRUWXVHRU GLVSRVDORIKD]DUGRXVPDWHULDOV"Ŀ Ŀ Ŀ E &UHDWHDVLJQLILFDQWKD]DUGWRWKH SXEOLFRUWKHHQYLURQPHQWWKURXJK UHDVRQDEO\IRUHVHHDEOHXSVHWDQG DFFLGHQWFRQGLWLRQVLQYROYLQJWKH UHOHDVHRIKD]DUGRXVPDWHULDOVLQWR WKHHQYLURQPHQW" Ŀ Ŀ Ŀ F (PLWKD]DUGRXVHPLVVLRQVRUKDQGOH KD]DUGRXVRUDFXWHO\KD]DUGRXV PDWHULDOVVXEVWDQFHVRUZDVWH ZLWKLQRQHTXDUWHUPLOHRIDQ H[LVWLQJRUSURSRVHGVFKRRO" Ŀ Ŀ Ŀ G %HORFDWHGRQDVLWHZKLFKLV LQFOXGHGRQDOLVWRIKD]DUGRXV PDWHULDOVVLWHVFRPSLOHGSXUVXDQW WR*RYHUQPHQW&RGH6HFWLRQ DQGDVDUHVXOWZRXOGLW FUHDWHDVLJQLILFDQWKD]DUGWRWKH SXEOLFRUWKHHQYLURQPHQW" Ŀ Ŀ Ŀ H )RUDSURMHFWORFDWHGZLWKLQDQ DLUSRUWODQGXVHSODQRUZKHUH VXFKDSODQKDVQRWEHHQDGRSWHG ZLWKLQWZRPLOHVRIDSXEOLFDLUSRUW RUSXEOLFXVHDLUSRUWZRXOGWKH SURMHFWUHVXOWLQDVDIHW\KD]DUGIRU SHRSOHUHVLGLQJRUZRUNLQJLQWKH SURMHFWDUHD" Ŀ Ŀ Ŀ I )RUDSURMHFWZLWKLQWKHYLFLQLW\RID SULYDWHDLUVWULSZRXOGWKHSURMHFW UHVXOWLQDVDIHW\KD]DUGIRUSHRSOH UHVLGLQJRUZRUNLQJLQWKHSURMHFW DUHD" Ŀ Ŀ Ŀ J ,PSDLULPSOHPHQWDWLRQRIRU SK\VLFDOO\LQWHUIHUHZLWKDQDGRSWHG HPHUJHQF\UHVSRQVHSODQRU HPHUJHQF\HYDFXDWLRQSODQ" Ŀ ĿĿ 4 Evaluation of Environmental Impacts Focused General Plan and Zoning Ordinance Update 37 Potentially Significant Impact Less Than Significant with Mitigation Incorporation Less Than Significant Impact No Impact K ([SRVHSHRSOHRUVWUXFWXUHVWRD VLJQLILFDQWULVNRIORVVLQMXU\RU GHDWKLQYROYLQJZLOGODQGILUHV LQFOXGLQJZKHUHZLOGODQGVDUH DGMDFHQWWRXUEDQL]HGDUHDVRU ZKHUHUHVLGHQFHVDUHLQWHUPL[HG ZLWKZLOGODQGV" Ŀ Ŀ Ŀ DFPotentially Significant Impact.+D]DUGRXVPDWHULDOVDUHURXWLQHO\XVHGDQGWUDQVSRUWHG WKURXJKRXW9HUQRQRQWKHORFDOVWUHHWVDQGYLDUDLO&XUUHQWDQGIXWXUHXVHVZLOOFRQWLQXHWREH H[SRVHGWRKD]DUGVIURPWKHURXWLQHXVHGLVSRVDODQGWUDQVSRUW RIKD]DUGRXVPDWHULDOV ,Q DGGLWLRQIXWXUHGHYHORSPHQWFRXOGSURGXFHKD]DUGRXVPDWHULDOVDQGZDVWH%HFDXVHRIWKHQHZ SRWHQWLDOO\ VLJQLILFDQW LPSDFW DVVRFLDWHG ZLWK WKHVH LVVXHV KD]DUGRXV PDWHULDOV ZLOO EH IXOO\ DGGUHVVHGZLWKLQD6XSSOHPHQWDO(,5WRWKH 9HUQRQ*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH 3URJUDP(,5WREHSUHSDUHGIRUWKH3URSRVHG)RFXVHG8SGDWH GPotentially Significant Impact.6HYHUDOVLWHVZLWKLQ9HUQRQDUHLQFOXGHGRQWKH'HSDUWPHQW RI 7R[LF 6XEVWDQFHV &RQWURO +D]DUGRXV :DVWH DQG 6XEVWDQFH /LVW&RUWHVH /LVW RI KD]DUGRXV PDWHULDOV VLWHV 5HGHYHORSPHQW RI LQGXVWULDO VLWHV KDV WKH SRWHQWLDO WR UHVXOW LQ GLVFRYHU\ RI FRQWDPLQDWHGVRLOVDQGRWKHUKD]DUGRXVPDWHULDOV%HFDXVHRIWKH QHZ SRWHQWLDOO\ VLJQLILFDQW LPSDFW DVVRFLDWHG ZLWK WKHVH LVVXHV KD]DUGRXV ZDVWH VLWHV ZLOO EH IXOO\ DGGUHVVHG ZLWKLQ D 6XSSOHPHQWDO(,5WRWKH9HUQRQ*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH3URJUDP(,5WREH SUHSDUHGIRUWKH3URSRVHG)RFXVHG8SGDWH HINo Impact. 1RDLUSRUWODQGXVHSODQDSSOLHVZLWKLQWKHSODQQLQJDUHD7KHQHDUHVWDLUSRUWLV &RPSWRQ$LUSRUWORFDWHGDSSUR[LPDWHO\HLJKWPLOHVWRWKHVRXWK1RFKDQJHVDVVRFLDWHGZLWKWKH 3URSRVHG)RFXVHG8SGDWHZRXOGLPSDFWDLUWUDIILF 1RDGYHUVHLPSDFWVDVVRFLDWHGZLWKDLUSRUW RSHUDWLRQV ZRXOG UHVXOW 1R QHZ RU VXEVWDQWLDOO\ PRUH VHYHUH LPSDFWV ZRXOG RFFXU ZLWK LPSOHPHQWDWLRQRIWKH3URSRVHG8SGDWHWKDQDVLGHQWLILHGLQWKH*HQHUDO3ODQDQG=RQLQJ 2UGLQDQFH3URJUDP(,5 JLess than Significant Impact. 7KHSURMHFWSURSRVHVQRFKDQJHVWRWKH&LW\¶V6WDQGDUGL]HG (PHUJHQF\0DQDJHPHQW6\VWHP6(060XOWL+D]DUG)XQFWLRQDO3ODQ0+)3DQGWKXVZRXOG QRWLPSDLULPSOHPHQWDWLRQRIWKH6(06RU0+)3 3URSRVHGGHYHORSPHQW XQGHU WKH 3URSRVHG )RFXVHG8SGDWHZRXOGEHVXEMHFWWRUHYLHZE\WKH&LW\RI9HUQRQ3ROLFHDQG)LUH'HSDUWPHQWVIRU FRPSOLDQFHZLWKHPHUJHQF\UHVSRQVHVWDQGDUGVDQGDGRSWHGHPHUJHQF\UHVSRQVHSODQV,PSDFWV ZRXOGEHVLPLODUWRWKRVHLGHQWLILHGLQWKH*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH3URJUDP(,5 DQGZRXOGEHOHVVWKDQVLJQLILFDQW KNo Impact.7KH&LW\RI9HUQRQLVDIXOO\EXLOWRXWFRPPXQLW\DQGGRHVQRWFRQWDLQQRULV DGMDFHQWWRDQ\ZLOGODQGV,PSDFWVZRXOGEHVLPLODUWRWKRVHLGHQWLILHGLQWKH*HQHUDO3ODQ DQG=RQLQJ2UGLQDQFH3URJUDP(,5QRLPSDFWZRXOGRFFXU 4 Evaluation of Environmental Impacts 38 Initial Study 4.9 – Hydrology and Water Quality Potentially Significant Impact Less Than Significant with Mitigation Incorporation Less Than Significant Impact No Impact D 9LRODWHDQ\ZDWHUTXDOLW\VWDQGDUGV RUZDVWHGLVFKDUJHUHTXLUHPHQWV"Ŀ ĿĿ E 6XEVWDQWLDOO\GHSOHWHJURXQGZDWHU VXSSOLHVRULQWHUIHUHVXEVWDQWLDOO\ ZLWKJURXQGZDWHUUHFKDUJHVXFK WKDWWKHUHZRXOGEHDQHWGHILFLWLQ DTXLIHUYROXPHRUDORZHULQJRIWKH ORFDOJURXQGZDWHUWDEOHOHYHOHJ WKHSURGXFWLRQUDWHRISUHH[LVWLQJ QHDUE\ZHOOVZRXOGGURSWRDOHYHO ZKLFKZRXOGQRWVXSSRUWH[LVWLQJ ODQGXVHVRUSODQQHGXVHVIRUZKLFK SHUPLWVKDYHEHHQJUDQWHG" Ŀ ĿĿ F 6XEVWDQWLDOO\DOWHUWKHH[LVWLQJ GUDLQDJHSDWWHUQRIWKHVLWHRUDUHD LQFOXGLQJWKURXJKWKHDOWHUDWLRQRI WKHFRXUVHRIDVWUHDPRUULYHULQD PDQQHUZKLFKZRXOGUHVXOWLQ VXEVWDQWLDOHURVLRQRUVLOWDWLRQRQ RURIIVLWH" Ŀ ĿĿ G 6XEVWDQWLDOO\DOWHUWKHH[LVWLQJ GUDLQDJHSDWWHUQRIWKHVLWHRUDUHD LQFOXGLQJWKURXJKWKHDOWHUDWLRQRI WKHFRXUVHRIDVWUHDPRUULYHURU VXEVWDQWLDOO\LQFUHDVHWKHUDWHRU DPRXQWRIVXUIDFHUXQRIILQD PDQQHUZKLFKZRXOGUHVXOWLQ IORRGLQJRQRURIIVLWH" Ŀ ĿĿ H &UHDWHRUFRQWULEXWHUXQRIIZDWHU ZKLFKZRXOGH[FHHGWKHFDSDFLW\RI H[LVWLQJRUSODQQHGVWRUPZDWHU GUDLQDJHV\VWHPVRUSURYLGH VXEVWDQWLDODGGLWLRQDOVRXUFHVRI SROOXWHGUXQRII" Ŀ ĿĿ I 2WKHUZLVHVXEVWDQWLDOO\GHJUDGH ZDWHUTXDOLW\"Ŀ ĿĿ J 3ODFHKRXVLQJZLWKLQD\HDU IORRGKD]DUGDUHDDVPDSSHGRQD IHGHUDO)ORRG+D]DUG%RXQGDU\RU )ORRG,QVXUDQFH5DWH0DSRURWKHU IORRGKD]DUGGHOLQHDWLRQPDS" Ŀ ĿĿ 4 Evaluation of Environmental Impacts Focused General Plan and Zoning Ordinance Update 39 Potentially Significant Impact Less Than Significant with Mitigation Incorporation Less Than Significant Impact No Impact K 3ODFHZLWKLQD\HDUIORRG KD]DUGDUHDVWUXFWXUHVZKLFKZRXOG LPSHGHRUUHGLUHFWIORRGIORZV"Ŀ ĿĿ L ([SRVHSHRSOHRUVWUXFWXUHVWRD VLJQLILFDQWULVNRIORVVLQMXU\RU GHDWKLQYROYLQJIORRGLQJLQFOXGLQJ IORRGLQJDVDUHVXOWRIWKHIDLOXUHRI DOHYHHRUGDP" Ŀ ĿĿ M ,QXQGDWLRQE\VHLFKHWVXQDPLRU PXGIORZ"Ŀ Ŀ Ŀ DLess than Significant.$VDQDO\]HGLQWKH*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH3URJUDP (,5LPSOHPHQWDWLRQRIH[LVWLQJUHJXODWLRQVDQG*HQHUDO3ODQSROLFLHVZRXOGHQVXUHWKDWZDWHU TXDOLW\VWDQGDUGVDQGZDVWHGLVFKDUJHUHTXLUHPHQWVDUHQRWYLRODWHG $V D FRSHUPLWWHH XQGHU /RV $QJHOHV &RXQW\¶V 06 1DWLRQDO 3ROOXWDQW 'LVFKDUJH (OLPLQDWLRQ 6\VWHP13'(6SHUPLWWKH&LW\LVUHTXLUHGWRLPSOHPHQWDOOSHUWLQHQW UHJXODWLRQV RI WKH SURJUDP WR FRQWURO SROOXWLRQ GLVFKDUJHV IURP QHZ GHYHORSPHQW 7KHVH UHJXODWLRQV UHGXFH SROOXWDQWORDGLQJWKURXJKWKHLPSOHPHQWDWLRQRI%HVW0DQDJHPHQW3UDFWLFHV%03VDQGRWKHU FRQWURO PHDVXUHV WKDW PLQLPL]H RU HOLPLQDWH SROOXWDQWV IURP XUEDQUXQRIIWKHUHE\SURWHFWLQJ GRZQVWUHDP ZDWHU UHVRXUFHV %03V LPSOHPHQWHG WR DGGUHVV FRPPHUFLDO SROOXWDQW VRXUFHV JHQHUDOO\ LQYROYH PDLQWHQDQFH RI VWRUP GUDLQ IDFLOLWLHV SDUNLQJ ORWV YHJHWDWHG DUHDV DQG HGXFDWLRQDOSURJUDPV9LRODWLRQVRIZDWHUTXDOLW\VWDQGDUGVGXHWRXUEDQUXQRIIFDQEHSUHYHQWHG WKURXJK WKH FRQWLQXHG LPSOHPHQWDWLRQ RI H[LVWLQJ UHJLRQDO ZDWHUTXDOLW\UHJXODWLRQV7KH SURSRVHG SURMHFW LQFOXGLQJ UHYLVLRQV WR WKH *HQHUDO 3ODQ DQG =RQLQJ 2UGLQDQFH ZRXOG QRW LQWHUIHUHZLWKWKHLPSOHPHQWDWLRQRI13'(6ZDWHUTXDOLW\UHJXODWLRQVDQGVWDQGDUGV 7KH SURSRVHG UHVLGHQWLDO GHYHORSPHQW SURMHFW DW QG'ULYHZRXOGGLVWXUEDSSUR[LPDWHO\ DFUHVRIODQGDQGWKHUHIRUHZLOOEHVXEMHFWWR1DWLRQDO3ROOXWDQW 'LVFKDUJH (OLPLQDWLRQ 6\VWHP 13'(6 SHUPLW UHTXLUHPHQWV GXULQJ FRQVWUXFWLRQ DFWLYLWLHV LQ DGGLWLRQ WR VWDQGDUG 13'(6RSHUDWLRQDOUHTXLUHPHQWV7KHSURSRVHGSURMHFWZLOOUHTXLUHVXEPLWWDORID6WRUP:DWHU 3ROOXWLRQ 3UHYHQWLRQ 3ODQ 6:333 ZKLFK ZLOO LQFOXGH %03V WR SURWHFWZDWHUTXDOLW\GXULQJ FRQVWUXFWLRQDFWLYLWLHV7KH&LW\ZLOOUHTXLUH%03VDVOLVWHGLQWKH&DOLIRUQLD6WRUPZDWHU4XDOLW\ $VVRFLDWLRQ¶V &DOLIRUQLD 6WRUP :DWHU %HVW 0DQDJHPHQW 3UDFWLFH +DQGERRNV 7KHVH PHDVXUHV ZKLFK LQFOXGH UHVLGHQWRZQHU HGXFDWLRQ DFWLYLW\ UHVWULFWLRQVSDUNLQJ ORW VZHHSLQJ EDVLQ LQVSHFWLRQ ODQGVFDSLQJ URRI UXQRII FRQWUROV HIILFLHQW LUULJDWLRQ VORSH DQG FKDQQHO SURWHFWLRQ VWRUPGUDLQVLJQDJHWUDVKUDFNVDQGWUDVKVWRUDJHDUHDVZLOOUHGXFHSROOXWDQWVLQVWRUPZDWHU UXQRII DQG UHGXFH QRQVWRUP ZDWHU GLVFKDUJHV WR WKH &LW\ V VWRUPZDWHU GUDLQDJH WKURXJK FRQWUROOLQJWKHGLVFKDUJHRISROOXWDQWV2SHUDWLRQDO%03VZLOOEHLGHQWLILHGLQD6WRUPZDWHU5XQRII 0DQDJHPHQW3ODQWKDWZLOOEHVXEPLWWHGWRWKH&LW\IRUUHYLHZDQGDSSURYDO,PSDFWVUHODWHGWR YLRODWLRQRIZDWHUTXDOLW\VWDQGDUGVZLOOEHOHVVWKDQVLJQLILFDQW ZLWK LPSOHPHQWDWLRQ RI WKHVH H[LVWLQJUHJXODWLRQV ,PSDFWV ZRXOG EH VLPLODU WR WKRVH LGHQWLILHG LQ WKH *HQHUDO 3ODQ DQG =RQLQJ 2UGLQDQFH 3URJUDP(,5DQGZRXOGEHOHVVWKDQVLJQLILFDQW 4 Evaluation of Environmental Impacts 40 Initial Study ELess than Significant Impact. :DWHU VHUYLFH IRU 9HUQRQ LV SURYLGHG E\ WKUHH VHUYLFH SURYLGHUV&LW\RI9HUQRQ:DWHU'HSDUWPHQW&DOLIRUQLD:DWHU6HUYLFH&RPSDQ\&DO:DWHU (DVW/RV$QJHOHV'LVWULFWDQG0D\ZRRG0XWXDO:DWHU&RPSDQ\1XPEHU6RPHRIWKHZDWHU VXSSOLHGZLWKLQWKHSODQQLQJDUHDFRPHVIURPJURXQGZDWHUZHOOV7KH*HQHUDO3ODQ$PHQGPHQW DQG=RQLQJ0DSSURSRVHFKDQJHVLQWKHODQGXVHGHVLJQDWLRQRIVSHFLILFSDUFHOVZLWKLQWURGXFWLRQ RIWZRQHZ*HQHUDO3ODQRYHUOD\GLVWULFWVH[SDQVLRQRIDQRWKHURYHUOD\GLVWULFWDQGWKUHHQHZ =RQLQJ2YHUOD\'LVWULFWVDVLOOXVWUDWHGLQ([KLELWVDQGDOORZDQFHRIQHZXVHVFRXOGUHVXOWLQ DQLQFUHDVHLQGHYHORSPHQWLQWHQVLW\ +RZHYHUWKHSURSRVHGDOORZHGQHZXVHVZRXOGOLNHO\XVHVXEVWDQWLDOO\OHVVZDWHUWKDQLQGXVWULDO XVHVZKLFKDUHLQJHQHUDOFRQVLGHUHGWREHKLJKLQWHQVLW\ZDWHUXVHUV%DVHGRQZDWHUGHPDQG IDFWRUVSURYLGHGLQWKH8UEDQ:DWHU0DQDJHPHQW3ODQIRU&DO:DWHU¶V(DVW/RV$QJHOHV 'LVWULFWWKH\HDUSURMHFWHGZDWHUGHPDQGDWDPHWHUHGVHUYLFHRIDPXOWLIDPLO\UHVLGHQWLDO GHYHORSPHQWLVDFUHIHHW\HDU7KHSURMHFWHGGHPDQGIRUWKHDYHUDJHPHWHUHGLQGXVWULDO XVHULVDFUHIHHW\HDU *LYHQWKDWSURSRVHGUHVLGHQWLDOXVHVDQGFRPPHUFLDOXVHVZLOOLQ JHQHUDOFRQVXPHIDUOHVVZDWHUDQQXDOO\WKDWWKHDYHUDJHLQGXVWULDOXVHDSSUR[LPDWHO\DFUH IHHW\HDUDQGDFUHIHHWSHU\HDUUHVSHFWLYHO\LPSDFWRIWKHODQGXVHFKDQJHVZLOOEHOHVV WKDQVLJQLILFDQW 7KHSURMHFWVLWHDWQG'ULYHLVVHUYHGE\0D\ZRRG0XWXDO:DWHU&RPSDQ\1XPEHU$V RI$XJXVW0D\ZRRG0XWXDO:DWHU&RPSDQ\1XPEHUKDGDQDGMXGLFDWHGVXSSO\RI DFUHIHHWDQGDGHPDQGRIDSSUR[LPDWHO\DFUHIHHWZLWKDUHVLGXDOVXSSO\RIDWOHDVW DFUHIHHWRIZDWHU 7KLVZRXOGEHPRUHWKDQDPSOHWRDFFRPPRGDWHWKHSURSRVHGGHYHORSPHQW DWQG'ULYH,PSDFWVZRXOGEHVLPLODUDQGOHVVVHYHUHWKDQWKRVHLGHQWLILHGLQWKH *HQHUDO3ODQDQG=RQLQJ2UGLQDQFH3URJUDP(,5DQGZRXOGFRQWLQXHWREHOHVVWKDQVLJQLILFDQW FLess than Significant Impact.$VLJQLILFDQWLPSDFWZRXOGRFFXULIWKHSURSRVHGSURMHFW VXEVWDQWLDOO\DOWHUHGWKHGUDLQDJHSDWWHUQRIDQH[LVWLQJVWUHDPRUULYHUVRWKDWHURVLRQRUVLOWDWLRQ ZRXOGUHVXOW1RQDWXUDOQRQFRQFUHWHOLQHGULYHUVWUDYHUVHWKH&LW\RI9HUQRQ7KH/RV$QJHOHV 5LYHULVDVLJQLILFDQWZDWHUIHDWXUHKRZHYHULWLVIXOO\FRQFUHWHOLQHGDQGLWVFRXUVHZRXOGQRWEH DOWHUHGLQDQ\ZD\YLDWKHSURMHFW7KHSURMHFWLQYROYHVQRFKDQJHVWRWKLVIORRGFRQWUROFKDQQHO :LWKUHJDUGWRIXWXUHGHYHORSPHQWSURMHFWSURSRVHGSXUVXDQWWR/DQG8VHDQG+RXVLQJ(OHPHQW SROLF\VLWHGUDLQDJHSODQVDUHUHTXLUHGE\WKH&LW\RI9HUQRQDQGZRXOGEHUHYLHZHGE\WKH&LW\ (URVLRQDQGVLOWDWLRQUHGXFWLRQPHDVXUHVZRXOGEHUHTXLUHGGXULQJFRQVWUXFWLRQFRQVLVWHQWZLWKDQ DSSURYHG 6WRUPZDWHU 3ROOXWLRQ 3UHYHQWLRQ 3ODQ 6:333 WR GHPRQVWUDWH FRPSOLDQFH ZLWK WKH &LW\¶V13'(6SHUPLW:LWKUHJDUGWRQG'ULYHLQSDUWLFXODUQRVXEVWDQWLDOJUDGLQJLV SURSRVHGWRWKHUHODWLYHO\IODWVLWHWKXVGUDLQDJHSDWWHUQVZRXOGQRWEHGLVUXSWHG(URVLRQDQG VLOWDWLRQUHGXFWLRQPHDVXUHVZRXOGEHUHTXLUHG$WWKHFRPSOHWLRQRIFRQVWUXFWLRQWKHSURMHFW ZRXOGFRQVLVWRILPSHUYLRXVVXUIDFHVDQGODQGVFDSHGDUHDVDQGZRXOGWKHUHIRUHQRWEHSURQHWR VXEVWDQWLDOHURVLRQ,PSDFWVZRXOGEHVLPLODUWRWKRVHLGHQWLILHGLQWKH*HQHUDO3ODQDQG =RQLQJ2UGLQDQFH3URJUDP(,5DQGZRXOGEHOHVVWKDQVLJQLILFDQW GHLess than Significant Impact. $VZDVSUHYLRXVO\GLVFXVVHGLQ6HFWLRQFDERYHWKH SURSRVHGSURMHFWZRXOGQRWUHVXOWLQDQDOWHUDWLRQRIWKHGUDLQDJHSDWWHUQRULQFUHDVHLQIORZVWKDW ZRXOGUHVXOWLQIORRGLQJRQRURIIVLWHEHFDXVHWKH&LW\RI9HUQRQLVIXOO\GHYHORSHGZLWKEXLOGLQJV SDYHPHQWDQGRWKHULPSHUYLRXVVXUIDFHV$Q\QHZGHYHORSPHQWZRXOGEHUHTXLUHGWRFRPSO\ &DOLIRUQLD:DWHU6HUYLFH&RPSDQ\8UEDQ:DWHU0DQDJHPHQW3ODQ(DVW/RV$QJHOHV'LVWULFW 7DEOH3URMHFWHG:DWHU'HOLYHULHV 7HOHSKRQHFRPPXQLFDWLRQZLWK%RE5RWK&LW\RI0D\ZRRG0XQLFLSDO:DWHU'LVWULFWHQJLQHHU$XJXVW 4 Evaluation of Environmental Impacts Focused General Plan and Zoning Ordinance Update 41 ZLWK13'(6UHJXODWLRQV7KHH[LVWLQJVWRUPGUDLQV\VWHPLVDGHTXDWH WR DFFRPPRGDWH VWRUPZDWHUUXQRII,PSDFWVZRXOGEHVLPLODUWRRUOHVVWKDQWKRVHLGHQWLILHGLQWKH*HQHUDO 3ODQDQG=RQLQJ2UGLQDQFH3URJUDP(,5DQGZRXOGEHOHVVWKDQVLJQLILFDQW ILess than Significant Impact.$OO IXWXUHGHYHORSPHQWSURMHFWVSXUVXDQWWR*HQHUDO3ODQDQG =RQLQJ2UGLQDQFHSROLF\ZLOOEHUHTXLUHGWRFRPSO\ZLWKZDWHUTXDOLW\UHTXLUHPHQWVRIWKH86 (3$/RV$QJHOHV5:4&%DQGWKH&LW\RI9HUQRQ&RPSOLDQFHZLWKH[LVWLQJUHTXLUHPHQWVZRXOG UHGXFHZDWHUTXDOLW\LPSDFWVWRDOHVVWKDQVLJQLILFDQWOHYHO,PSDFWVZRXOGEHVLPLODUWRWKRVH LGHQWLILHGLQWKH*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH(,5DQGZRXOGEHOHVVWKDQVLJQLILFDQW JKLess than Significant Impact.$VLQGLFDWHGLQWKH*HQHUDO3ODQ6DIHW\(OHPHQWQRSRUWLRQ RIWKHSODQQLQJDUHDOLHVZLWKLQD\HDUIORRG]RQH$YHU\VPDOOSRUWLRQRIWKH&LW\LQWKH VRXWKHDVWHUQ FRUQHU LV LGHQWLILHG E\ )(0$ WR EH ZLWKLQ D \HDU IORRG ]RQH WKLV DUHD GRHV LQFOXGHWKH+RXVLQJ2YHUOD\DQGSURSRVHGGHYHORSPHQWDWQG'ULYH6LQFHQRDUHDVRIWKH &LW\DUHORFDWHGZLWKLQD\HDUIORRG]RQHLPSDFWVDVVRFLDWHG ZLWK WKH SURMHFW UHODWHG WR KRXVLQJRUIORRGKD]DUGDUHDVWUXFWXUHVZRXOGEHOHVVWKDQVLJQLILFDQW1RQHZRUPRUHVHYHUH LPSDFWVWKDQWKRVHLGHQWLILHGLQWKH*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH3URJUDP(,5ZRXOG RFFXU LLess than Significant Impact. $VLQGLFDWHGLQWKH *HQHUDO3ODQ6DIHW\(OHPHQWQHDUO\DOORI 9HUQRQOLHVZLWKLQWKHSRWHQWLDOLQXQGDWLRQDUHDVIRU+DQVHQ'DPDQGRU6HSXOYHGD'DPZKLFK DUHORFDWHGPRUHWKDQPLOHVQRUWKZHVWRIWKH&LW\,QWKHXQOLNHO\HYHQWWKDWDFDWDVWURSKLF HDUWKTXDNHFDXVHVWKHFROODSVHRIHLWKHURIWKHVHGDPVZDWHUDQGGHEULVZRXOGIORZWRDQGWKHQ JHQHUDOO\DORQJWKH/RV$QJHOHV5LYHULQDIDLUO\QDUURZVWUHDPEHIRUHVSUHDGLQJRXWRYHUDVZDWK RIWKHFRDVWDOSODLQVHYHUDOPLOHVZLGHLQFOXGLQJ9HUQRQ,QWKLVFDVHWKHIORZZRXOGWDNHWR KRXUVWRUHDFKWKH &LW\$V VXFKULVNWRKXPDQ OLIHLVPLQLPDODVWKHORQJGHOD\VKRXOGJLYH DPSOHWLPHIRUHPHUJHQF\ UHVSRQGHUVWRUHVSRQG 3URFHGXUHVDUHRXWOLQHGLQWKH&LW\¶V 6(06 0XOWL+D]DUG)XQFWLRQDO3ODQ0+)3,PSDFWVZRXOGEHVLPLODUWRWKRVHLGHQWLILHGLQWKH *HQHUDO3ODQDQG=RQLQJ2UGLQDQFH3URJUDP(,5DQGZRXOGEHOHVVWKDQVLJQLILFDQW MNo Impact. 7KH &LW\ RI 9HUQRQ OLHV DSSUR[LPDWHO\ PLOHV IURP WKH 3DFLILF2FHDQDQG WKHUHIRUHLVQRWVXEMHFWWRWVXQDPLV1RODUJHZDWHUERGLHVH[LVWLQWKH&LW\WKDWZRXOGSUHVHQW VHLFKHKD]DUGV7RSRJUDSK\LQWKH&LW\LVYLUWXDOO\IODW1RQDWXUDO IHDWXUHV H[LVW WKDW ZRXOG FUHDWHPXGIORZV,PSDFWVZRXOGEHVLPLODUWRWKRVHLGHQWLILHGLQ WKH *HQHUDO 3ODQ DQG =RQLQJ2UGLQDQFH3URJUDP(,5DQGZRXOGEHOHVVWKDQVLJQLILFDQW 4 Evaluation of Environmental Impacts 42 Initial Study 4.10 – Land Use and Planning :RXOGWKHSURMHFW Potentially Significant Impact Less Than Significant with Mitigation Incorporation Less Than Significant Impact No Impact D 3K\VLFDOO\GLYLGHDQHVWDEOLVKHG FRPPXQLW\"Ŀ Ŀ Ŀ E &RQIOLFWZLWKDQ\DSSOLFDEOHODQG XVHSODQSROLF\RUUHJXODWLRQRIDQ DJHQF\ZLWKMXULVGLFWLRQRYHUWKH SURMHFWLQFOXGLQJEXWQRWOLPLWHG WRWKHJHQHUDOSODQVSHFLILFSODQ ORFDOFRDVWDOSURJUDPRU]RQLQJ RUGLQDQFHDGRSWHGIRUWKHSXUSRVH RIDYRLGLQJRUPLWLJDWLQJDQ HQYLURQPHQWDOHIIHFW" Ŀ ĿĿ F &RQIOLFWZLWKDQ\DSSOLFDEOHKDELWDW FRQVHUYDWLRQSODQRUQDWXUDO FRPPXQLW\FRQVHUYDWLRQSODQ"Ŀ Ŀ Ŀ DNo Impact. 7KH SURSRVHG SURMHFW ZRXOG QRW SK\VLFDOO\ GLYLGH DQ HVWDEOLVKHG FRPPXQLW\ &LW\ZLGHWKH*HQHUDO3ODQDQG=RQLQJ2UGLQDQFHXSGDWHVZLOOFRQWLQXHWRDOORZWKHUHF\FOLQJRI HVWDEOLVKHGLQGXVWULDOXVHVWRQHZLQGXVWULDOXVHVDQGFRPPHUFLDOXVHV7KH+RXVLQJ(OHPHQW DOVR LGHQWLILHV WZR VLWHV ZKHUH KRXVLQJ FRXOG EH FRQVLGHUHG DQG RQH VLWH ZKLFK FRXOG DFFRPPRGDWHDSRWHQWLDOHPHUJHQF\VKHOWHU$WDVLQJOHVLWHDWQG'ULYHUHVLGHQWLDOXVHV ZLOOEHSHUPLWWHGYLDWKHSURSRVHG+RXVLQJ2YHUOD\SXUVXDQWWRWKHSURSRVHG*HQHUDO3ODQDQG =RQLQJPDSV$WWKHQRUWKZHVWFRUQHURIWKH&LW\WKH(PHUJHQF\6KHOWHU2YHUOD\ZLOODSSO\WRD VLQJOHSURSHUW\ 7KH VLWH DW QG 'ULYH LV VXUURXQGHG E\ UHVLGHQWLDO XVHV WR WKH VRXWK LQ WKH &LW\ RI 0D\ZRRG DQG LQGXVWULDO XVHV WR WKH QRUWK *LYHQ WKDW WKH VLWHLVORFDWHGDW9HUQRQ¶VVRXWK ERUGHUWKHSURSRVHGSURMHFW ZLOOQRWGLYLGHDQHVWDEOLVKHGLQGXVWULDOFRPPXQLW\7KHSURMHFW GRHV QRW SURSRVH FRQVWUXFWLRQ RI DQ\ URDGZD\ IORRG FRQWURO FKDQQHO RU RWKHU VWUXFWXUH WKDW ZRXOG SK\VLFDOO\ GLYLGH DQ\ SRUWLRQ RI WKH FRPPXQLW\ ,PSDFWVZRXOG EH VLPLODU WR WKRVH LGHQWLILHGLQWKH*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH3URJUDP(,5QRLPSDFWZLOORFFXU ELess than Significant Impact.7KHSURSRVHGSURMHFWLQYROYHVIRFXVHGXSGDWHVRIWKH*HQHUDO 3ODQDQG=RQLQJ2UGLQDQFHZLWKWKHVHREMHFWLYHVDOORZIRUDOLPLWHGQXPEHURIQHZKRXVLQJ XQLWVSXUVXDQWWRWKH&LW\¶VJRRGJRYHUQDQFHLQLWLDWLYHH[SDQGDOORZHGXVHVLQWKHQRUWKSDUW RI9HUQRQE\FUHDWLQJDQHZ7UXFNLQJDQG)UHLJKW2YHUOD\H[WHQGWKH&RPPHUFLDO2YHUOD\ 'LVWULFW WR DOORZ DGGLWLRQDO FRPPHUFLDO GHYHORSPHQW WR VXSSRUWLQGXVWULDO XVHUV DQG SHUPLW DQFLOODU\ FRPPHUFLDO XVHV RQ ZHHNHQGV DQG SURYLGH FODULILFDWLRQVLQWKH=RQLQJ2UGLQDQFH WH[W7KHLQWHQWRIWKHVLPXOWDQHRXV*HQHUDO3ODQDQG=RQLQJ2UGLQDQFHXSGDWHVLVWRSURYLGHIRU FRQVLVWHQF\EHWZHHQWKHWZRGRFXPHQWV1RRWKHUDJHQF\KDVMXULVGLFWLRQRYHUODQGXVHLVVXHVLQ 9HUQRQ ,PSDFWV ZRXOG EH VLPLODU WR WKRVH LGHQWLILHG LQ WKH *HQHUDO 3ODQ DQG =RQLQJ 2UGLQDQFH3URJUDP(,5DQGZRXOGEHOHVVWKDQVLJQLILFDQW 4 Evaluation of Environmental Impacts Focused General Plan and Zoning Ordinance Update 43 FNo Impact.$VGLVFXVVHGLQ&KHFNOLVW5HVSRQVHIDERYHWKHSODQQLQJDUHDLVQRWSDUWRI DQ\ KDELWDW FRQVHUYDWLRQ SODQ QDWXUDO FRPPXQLW\ FRQVHUYDWLRQ SODQ RU RWKHU DSSURYHG ORFDO UHJLRQDORUVWDWHKDELWDWFRQVHUYDWLRQSODQ$VVXFKQRLPSDFW ZLOO RFFXU 1R QHZ RU VXEVWDQWLDOO\ PRUH VHYHUH LPSDFWV ZRXOG RFFXU ZLWK LPSOHPHQWDWLRQ RI WKH 3URSRVHG )RFXVHG 8SGDWH 4 Evaluation of Environmental Impacts 44 Initial Study 4.11 – Mineral Resources :RXOGWKHSURMHFW Potentially Significant Impact Less Than Significant with Mitigation Incorporation Less Than Significant Impact No Impact D 5HVXOWLQWKHORVVRIDYDLODELOLW\RID NQRZQPLQHUDOUHVRXUFHWKDWZRXOG EHRIYDOXHWRWKHUHJLRQDQGWKH UHVLGHQWVRIWKHVWDWH" Ŀ Ŀ Ŀ E 5HVXOWLQWKHORVVRIDYDLODELOLW\RID ORFDOO\LPSRUWDQWPLQHUDOUHVRXUFH UHFRYHU\VLWHGHOLQHDWHGRQDORFDO JHQHUDOSODQVSHFLILFSODQRURWKHU ODQGXVHSODQ" Ŀ Ŀ Ŀ DENo Impact.7KH&LW\LVDIXOO\XUEDQL]HGDUHDZLWKSUHGRPLQDQWO\LQGXVWULDO XVHV $V LQGLFDWHGLQWKH,QLWLDO6WXG\IRUWKH*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH(,5QRPLQHUDOUHVRXUFH DUHDVH[LVWLQ9HUQRQ7KH&LW\¶V*HQHUDO3ODQGRHVQRWLGHQWLI\DQ\ORFDOO\LPSRUWDQWPLQHUDO UHVRXUFHVDQGWKHUHDUHQRNQRZQPLQLQJRSHUDWLRQVZLWKLQWKHFLW\RULWVLPPHGLDWHYLFLQLW\ 'HYHORSPHQW SXUVXDQW WR WKH SURSRVHG SURMHFW ZLOO QRW UHVXOW LQWKHORVVRIDNQRZQPLQHUDO UHVRXUFH1RLPSDFWZLOOUHVXOW1RQHZRUVXEVWDQWLDOO\PRUHVHYHUHLPSDFWVZRXOGRFFXUZLWK LPSOHPHQWDWLRQRIWKH3URSRVHG)RFXVHG8SGDWH 4 Evaluation of Environmental Impacts Focused General Plan and Zoning Ordinance Update 45 4.12 – Noise :RXOGWKHSURMHFWUHVXOWLQ Potentially Significant Impact Less Than Significant with Mitigation Incorporation Less Than Significant Impact No Impact D ([SRVXUHRISHUVRQVWRRU JHQHUDWLRQRIQRLVHOHYHOVLQH[FHVV RIVWDQGDUGVHVWDEOLVKHGLQWKHORFDO JHQHUDOSODQRUQRLVHRUGLQDQFHRU DSSOLFDEOHVWDQGDUGVRIRWKHU DJHQFLHV" Ŀ Ŀ Ŀ E ([SRVXUHRISHUVRQVWRRU JHQHUDWLRQRIH[FHVVLYH JURXQGERUQHYLEUDWLRQRU JURXQGERUQHQRLVHOHYHOV"Ŀ Ŀ Ŀ F $VXEVWDQWLDOSHUPDQHQWLQFUHDVHLQ DPELHQWQRLVHOHYHOVLQWKHSURMHFW YLFLQLW\DERYHOHYHOVH[LVWLQJ ZLWKRXWWKHSURMHFW"Ŀ Ŀ Ŀ G $VXEVWDQWLDOWHPSRUDU\RUSHULRGLF LQFUHDVHLQDPELHQWQRLVHOHYHOVLQ WKHSURMHFWYLFLQLW\DERYHOHYHOV H[LVWLQJZLWKRXWWKHSURMHFW"Ŀ Ŀ Ŀ H )RUDSURMHFWORFDWHGZLWKLQDQ DLUSRUWODQGXVHSODQRUZKHUH VXFKDSODQKDVQRWEHHQDGRSWHG ZLWKLQWZRPLOHVRIDSXEOLFDLUSRUW RUSXEOLFXVHDLUSRUWZRXOGWKH SURMHFWH[SRVHSHRSOHUHVLGLQJRU ZRUNLQJLQWKHSURMHFWDUHDWR H[FHVVLYHQRLVHOHYHOV" Ŀ Ŀ Ŀ I )RUDSURMHFWZLWKLQWKHYLFLQLW\RID SULYDWHDLUVWULSZRXOGWKHSURMHFW H[SRVHSHRSOHUHVLGLQJRUZRUNLQJ LQWKHSURMHFWDUHDWRH[FHVVLYH QRLVHOHYHOV" Ŀ Ŀ Ŀ DGPotentially Significant Impact. 7KH*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH3URJUDP(,5 DQDO\]HGSRWHQWLDOQRLVHLPSDFWVUHODWHGWRQHZGHYHORSPHQWSHUPLWWHGXQGHUWKH*HQHUDO3ODQ DQG IRXQG SRWHQWLDO LPSDFWV WR EH OHVV WKDQ VLJQLILFDQW ZLWK LPSOHPHQWDWLRQ RI *HQHUDO 3ODQ SROLFLHV DQG (,5 PLWLJDWLRQ PHDVXUHV 7KH SURSRVHG SURMHFW LQFOXGHV FKDQJHV WR ODQG XVH GHVLJQDWLRQVRIVSHFLILFSDUFHOVVKRZQLQ([KLELWVDQGWKDWFRXOGUHVXOWLQDQLQFUHDVHLQ GHYHORSPHQWLQWHQVLW\DQGQHZVHQVLWLYHUHFHSWRUV7KHSRWHQWLDOGHYHORSPHQWSURMHFWVUHVXOWLQJ IURPWKHVHSURSRVHGODQGXVHGHVLJQDWLRQFKDQJHVLQFOXGLQJSURSRVHGUHVLGHQWLDOGHYHORSPHQWDW QG'ULYHDQGDQHPHUJHQF\VKHOWHUFRXOGWULJJHUSRWHQWLDOO\VLJQLILFDQWQRLVHLPSDFWVQRW 4 Evaluation of Environmental Impacts 46 Initial Study SUHYLRXVO\ DQDO\]HG LQ WKH 3URJUDP (,5 7KHUHIRUH QRLVH LPSDFWV ERWK VKRUWWHUP DQG ORQJWHUP ZLOO EH IXUWKHU DQDO\]HG LQ WKH 6XSSOHPHQWDO (,5 WREH SUHSDUHG IRU WKH 3URSRVHG )RFXVHG8SGDWH HINo Impact.$VLQGLFDWHGLQWKH,QLWLDO6WXG\FRPSOHWHGIRUWKH*HQHUDO3ODQDQG=RQLQJ 2UGLQDQFH3URJUDP(,5QRSDUWRI9HUQRQLVORFDWHGZLWKLQDQDUHDFRYHUHGE\DQDLUSRUWODQG XVHSODQDQGQRSDUWRIWKH&LW\LVORFDWHGZLWKLQWKHYLFLQLW\RIDSULYDWHDLUVWULS7KHQHDUHVW DLUSRUWLVLQ&RPSWRQDSSUR[LPDWHO\HLJKWPLOHVWRWKHVRXWK7KXVDGRSWLRQDQGLPSOHPHQWDWLRQ RIWKH3URSRVHG)RFXVHG8SGDWHZLOOQRWUHVXOWLQDLUSRUWQRLVHLPSDFWVRQSHRSOHUHVLGLQJRU ZRUNLQJZLWKLQWKH3ODQQLQJ$UHD1RQHZRUVXEVWDQWLDOO\PRUHVHYHUHLPSDFWVZRXOGRFFXUZLWK LPSOHPHQWDWLRQRIWKH3URSRVHG)RFXVHG8SGDWH 4 Evaluation of Environmental Impacts Focused General Plan and Zoning Ordinance Update 47 4.13 – Population and Housing :RXOGWKHSURMHFW Potentially Significant Impact Less Than Significant with Mitigation Incorporation Less Than Significant Impact No Impact D ,QGXFHVXEVWDQWLDOSRSXODWLRQ JURZWKLQDQDUHDHLWKHUGLUHFWO\ IRUH[DPSOHE\SURSRVLQJQHZ KRPHVDQGEXVLQHVVHVRULQGLUHFWO\ IRUH[DPSOHWKURXJKH[WHQVLRQRI URDGVRURWKHULQIUDVWUXFWXUH" Ŀ ĿĿ E 'LVSODFHVXEVWDQWLDOQXPEHUVRI H[LVWLQJKRXVLQJQHFHVVLWDWLQJWKH FRQVWUXFWLRQRIUHSODFHPHQW KRXVLQJHOVHZKHUH" Ŀ Ŀ Ŀ F 'LVSODFHVXEVWDQWLDOQXPEHUVRI SHRSOHQHFHVVLWDWLQJWKH FRQVWUXFWLRQRIUHSODFHPHQW KRXVLQJHOVHZKHUH" Ŀ Ŀ Ŀ DLess than Significant Impact. 7KH SURSRVHG *HQHUDO 3ODQ $PHQGPHQW LQFOXGHV JRDOV SROLFLHVDQGLPSOHPHQWDWLRQSURJUDPVWKDWZLOODOORZIRUYHU\OLPLWHG KRXVLQJGHYHORSPHQWDW VSHFLILFORFDWLRQV:KLOHWKH&LW\KDVKDGDORQJVWDQGLQJSROLF\WRSURKLELWDQ\QHZUHVLGHQWLDO XVHV GXH WR H[WHQVLYH LQGXVWULDO RSHUDWLRQV WKURXJKRXW 9HUQRQWKH &LW\¶V JRRG JRYHUQDQFH LQLWLDWLYHDQGWKH5HJLRQDO+RXVLQJ1HHGV$OORFDWLRQRIWZRXQLWVKDYHOHGWKH&LW\WRSURSRVHWZR RYHUOD\ ]RQHV WKDW ZLOO DOORZ OLPLWHG KRXVLQJ %HWZHHQ DQG QHZ XQLWV FRXOG EH DFFRPPRGDWHGDVZHOODVDQHPHUJHQF\VKHOWHU7KHHPHUJHQF\KRPHOHVVVKHOWHUZRXOGQRW KRXVHSHUPDQHQWUHVLGHQWV :LWKLPSOHPHQWDWLRQRIWKLVSROLF\WKH9HUQRQ3ODQQLQJ$UHDKDVWKHSRWHQWLDOWRDFFRPPRGDWHD SRSXODWLRQRIDSSUR[LPDWHO\UHVLGHQWV DWEXLOGRXWWKLVUHSUHVHQWVPRUHDOPRVWDWULSOLQJRI WKHFXUUHQWHVWLPDWHGSRSXODWLRQRI&HQVXV7KLVOHYHORIJURZWKKDVQRW\HWEHHQ DFFRXQWHG IRU LQ UHJLRQDO SODQQLQJ GRFXPHQWV DV WKH &LW\¶V JRRG JRYHUQDQFH LQLWLDWLYH DQG HIIRUWV WR LQFUHDVH WKH YRWLQJ SRSXODFH LQ 9HUQRQ DUH UHFHQW FKDQJHV 7KHVH FKDQJHV ZLOO EH UHIOHFWHGLQIXWXUHUHJLRQDOSODQQLQJGRFXPHQWV7KXVZKLOHWKHSRWHQWLDOWULSOLQJRIWKHORFDO SRSXODWLRQPD\VHHPVLJQLILFDQWLQSHUFHQWDJHWHUPVWKHDFWXDO SRSXODWLRQ LQFUHDVH LQ UHDO QXPEHUV LV VPDOO 7KH SRWHQWLDOLQFUHDVH LV GLUHFWO\ UHVSRQVLYH WR WKH &LW\¶V JRRG JRYHUQDQFH SROLF\WRLQFUHDVHWKHORFDOSRSXODFHDQGIRVWHUIDLUYRWLQJSURFHGXUHV$OVRLQWHUPVRIVHFRQGDU\ LPSDFWV DVVRFLDWHG ZLWK WKH DQWLFLSDWHG SRSXODWLRQ LQFUHDVH WKH DQDO\VLV LQ WKLV ,QLWLDO 6WXG\ LQGLFDWHVWKDWWKHQHZKRXVLQJDQGUHVLGHQWVZLOOQRWFUHDWHVLJQLILFDQWHQYLURQPHQWDOLPSDFWV 7KLVSRSXODWLRQSURMHFWLRQDVVXPHVXQLWVSXUVXDQWWRSURSRVHGODQGXVHSROLF\DQGH[WUDSRODWHV EDVHGRQH[LVWLQJKRXVHKROGVL]HZKLFKLVHVWLPDWHGDWSHUVRQVSHUKRXVHKROG 4 Evaluation of Environmental Impacts 48 Initial Study EFNo Impact. 7KH UHF\FOLQJ RI XVHV SHUPLWWHG E\ ODQG XVH SROLF\ ZRXOG QRW UHPRYH DQ\ H[LVWLQJKRXVLQJ7KH&LW\RZQVYLUWXDOO\DOORIWKHH[LVWLQJKRXVLQJLQ9HUQRQDQGKDVLQGLFDWHGLWV LQWHQWLRQWRUHWDLQWKHXQLWV7KH+RXVLQJ(OHPHQWLQFOXGHVSROLFLHVWKDWSURYLGHIRUWKHUHWHQWLRQ RIWKHH[LVWLQJKRXVLQJXQLWVLQWKH&LW\WKDWDUHHFRQRPLFDOO\DQGSK\VLFDOO\VRXQG3URSRVHG GHYHORSPHQWDWQG'ULYHZRXOGWDNHSODFHRQDQH[LVWLQJYDFDQWSDUFHODQGZRXOGQRW GLVSODFHKRXVLQJRUSHRSOH,PSOHPHQWDWLRQRIWKH3URSRVHG)RFXVHG8SGDWHZRXOGQRWGLVSODFH VXEVWDQWLDOQXPEHUVRIH[LVWLQJKRXVLQJRUSHRSOH,PSDFWVZRXOGEHVLPLODUWRRUOHVVWKDQWKRVH LGHQWLILHGLQWKH*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH3URJUDP(,5DQGZRXOGEHOHVVWKDQ VLJQLILFDQW 4 Evaluation of Environmental Impacts Focused General Plan and Zoning Ordinance Update 49 4.14 – Public Services :RXOG WKH SURMHFW UHVXOW LQ VXEVWDQWLDO DGYHUVH SK\VLFDO LPSDFWV DVVRFLDWHG ZLWK WKH SURYLVLRQRIQHZRUSK\VLFDOO\DOWHUHGJRYHUQPHQWDOIDFLOLWLHVQHHGIRUQHZRUSK\VLFDOO\ DOWHUHGJRYHUQPHQWDOIDFLOLWLHVWKHFRQVWUXFWLRQRIZKLFKFRXOG FDXVH VLJQLILFDQW HQYLURQPHQWDOLPSDFWVLQRUGHUWRPDLQWDLQDFFHSWDEOHVHUYLFHUDWLRVUHVSRQVHWLPHVRU RWKHUSHUIRUPDQFHREMHFWLYHVIRUDQ\RIWKHSXEOLFVHUYLFHV Potentially Significant Impact Less Than Significant with Mitigation Incorporation Less Than Significant Impact No Impact D )LUHSURWHFWLRQ"Ŀ ĿĿ E 3ROLFHSURWHFWLRQ"Ŀ ĿĿ F 6FKRROV"Ŀ ĿĿ G 3DUNV"Ŀ ĿĿ H 2WKHUSXEOLFIDFLOLWLHV"Ŀ ĿĿ DELess than Significant Impact.$VLQGLFDWHGLQWKH,QLWLDO6WXG\FRPSOHWHGIRUWKH *HQHUDO3ODQDQG=RQLQJ2UGLQDQFH3URJUDP(,5GHYHORSPHQWSXUVXDQWWRSURSRVHG*HQHUDO3ODQ SROLF\DQG]RQLQJUHJXODWLRQVZLOOQRWVXEVWDQWLDOO\LQFUHDVHWKHEXVLQHVVSRSXODWLRQLQ9HUQRQ VLQFHOLPLWHGYDFDQWODQGH[LVWV1HZGHYHORSPHQWZLOOFRQVLVWRIWKHUHF\FOLQJRIGHYHORSPHQWRQ H[LVWLQJSURSHUWLHV7KLVFRQGLWLRQFRQWLQXHVWREHWUXHIRUWKH3URSRVHG)RFXVHG8SGDWH$VD JHQHUDOSUDFWLFH&LW\VWDIIH[DPLQHVHDFKGHYHORSPHQWDSSOLFDWLRQWRGHWHUPLQHVLWHVSHFLILFILUH SURWHFWLRQ DQG RWKHU VDIHW\ QHHGV &LW\ VWDII ZLOO UHYLHZ WKHVLWH SODQ IRU DQ\ SRWHQWLDO GHYHORSPHQWDWQG'ULYHDQGHQVXUHLWPHHWVHPHUJHQF\DFFHVVUHTXLUHPHQWV 9HUQRQPDLQWDLQVLWVRZQILUHDQGSROLFHGHSDUWPHQWVDQGDVSDUWRIWKHEXGJHWLQJSURFHVVHDFK \HDUSURYLGHVIXQGLQJWRHQVXUHWKDWVHUYLFHVDGHTXDWHO\PHHWDQ\FKDQJLQJQHHGVLQWKH&LW\ 7KHUHIRUHWKHSRWHQWLDOLPSDFWRQILUHDQGSROLFHVHUYLFHVZLOOFRQWLQXHWRUHYLHZHGZLWKHDFK GHYHORSPHQWSURSRVDODQGDQQXDOO\7KURXJKH[LVWLQJSUDFWLFHVDQGSURFHGXUHVWKH&LW\ZLOOEH DEOHWRPHHWDQGPDLQWDLQDFFHSWDEOHVHUYLFHUDWLRV,PSDFWVZRXOGEHVLPLODUWRWKRVHLGHQWLILHG LQWKH*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH3URJUDP(,5DQGZRXOGEHOHVVWKDQVLJQLILFDQW FLess than Significant Impact. 7KHRQO\VFKRROORFDWHGLQ9HUQRQLV9HUQRQ&LW\(OHPHQWDU\ 6FKRRO0D\ZRRG(OHPHQWDU\6FKRROLVORFDWHGFORVHE\LQWKH&LW\RI0D\ZRRG %RWKVFKRROVDUH ORFDWHGZLWKLQWKH/RV$QJHOHV8QLILHG6FKRRO'LVWULFW3URSRVHG UHVLGHQWLDO GHYHORSPHQW FRPSOHWHGSXUVXDQWWR*HQHUDO3ODQDQG=RQLQJ2UGLQDQFHSROLF\ZRXOGEHOLPLWHGWRWKH+RXVLQJ 2YHUOD\OLPLWHGWRSRWHQWLDOKRXVLQJVLWHVLGHQWLILHGLQWKH+RXVLQJ(OHPHQWDQGFRQVLVWHQWZLWK /DQG8VHSROLF\7KHSURSRVHGUHVLGHQWLDOSURMHFWZLOOUHVXOWLQLQFUHPHQWDOSRSXODWLRQJURZWKDQG SRWHQWLDODVVRFLDWHGJURZWKLQVWXGHQWVZLWKLQWKH/RV$QJHOHV8QLILHG 6FKRRO 'LVWULFW , Q DFFRUGDQFHZLWKWKH&DOLIRUQLD*RYHUQPHQW&RGHVWDQGDUGVFKRROIDFLOLW\LPSDFWIHHVZLOOEHSDLG WRRIIVHWDQ\LQFUHPHQWDOLPSDFWVRIWKHSURSRVHGSURMHFW:LWKWKHSD\PHQWRIWKHIHHLPSDFWV WR VFKRRO IDFLOLWLHV ZRXOG EH OHVV WKDQ VLJQLILFDQW *LYHQ WKH OLPLWHG VFDOH RI WKH SURSRVHG 4 Evaluation of Environmental Impacts 50 Initial Study UHVLGHQWLDOODQGXVHFKDQJHVLPSDFWVZRXOGEHVLPLODUWRWKRVHLGHQWLILHGLQWKH*HQHUDO 3ODQDQG=RQLQJ2UGLQDQFH3URJUDP(,5DQGZRXOGEHOHVVWKDQVLJQLILFDQW GHLess than Significant Impact. 7KH SURSRVHG SURMHFW ZRXOG LQWURGXFH D QHZ +RXVLQJ 2YHUOD\LQWKH*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH7KHRYHUOD\ZRXOGDOORZIRUDOLPLWHGQXPEHU RIQHZKRXVLQJXQLWVPD[LPXPRISRWHQWLDOXQLWVWRWDO7KHSURSRVHGUHVLGHQWLDOSURMHFWDW QG 'ULYH ZLOO UHVXOW LQ SRSXODWLRQ JURZWK WKDW ZRXOG LQFUHPHQWDOO\ LPSDFW UHFUHDWLRQ IDFLOLWLHVJLYHQWKHSRWHQWLDOWRQHZKRXVLQJXQLWVWKDWFRXOGEHVXSSRUWHGRQWKHVLWH (DFKRIWKHSURSRVHGGHYHORSPHQWVFKHPHVWKH&LW\KDVUHFHLYHGSURYLGHVIRURQVLWHRSHQVSDFH DUHDVIRUXVHE\IXWXUHUHVLGHQWV7KH&LW\KDVQRRWKHUH[LVWLQJUHFUHDWLRQIDFLOLWLHV$VVXFKLW FDQ EH DVVXPHG WKDW RWKHU H[LVWLQJ UHFUHDWLRQ IDFLOLWLHV LQ QHLJKERULQJ MXULVGLFWLRQV ZRXOG SRWHQWLDOO\EHXWLOL]HGE\WKHSURSRVHGSURMHFW¶VUHVLGHQWV $VSDUWRIWKHJRRGJRYHUQDQFHUHIRUPPHDVXUHVWKH9HUQRQ&LW\&RXQFLODGRSWHGD5HVROXWLRQ RQ$XJXVWZKLFKHVWDEOLVKHGDIXQGIRU5HJLRQDO&RPPXQLW\5HFUHDWLRQDO )DFLOLWLHVDQG(QYLURQPHQWDODQG&RPPXQLW\%HQHILW)XQG$WRWDORIPLOOLRQKDVEHHQVHW DVLGHLQWKH&LW\EXGJHWIRUWKHIXQGDQGIRUIXQGLQJUHJLRQDOUHFUHDWLRQDOIDFLOLWLHV 1HJRWLDWLRQVKDYHEHHQRQJRLQJEHWZHHQ9HUQRQRIILFLDOVDQGUHSUHVHQWDWLYHVIURPWKH&LW\RI +XQWLQJWRQ 3DUN DQG /RV $QJHOHV &RXQW\ UHODWLYH WR WKH XQLQFRUSRUDWHG FRPPXQLW\ RI %R\OH +HLJKWV:KLOHWKH&LW\GRHVQRWKDYHDSURFHVVWRDVVHVVSDUNVIHHVGXHWRWKHOLPLWHGSRWHQWLDO IRUQHZKRXVLQJLQWKH&LW\DQ\SRWHQWLDOLPSDFWRQUHFUHDWLRQDO IDFLOLWLHV LQ QHLJKERULQJ MXULVGLFWLRQV UHVXOWLQJ IURP LQFUHDVLQJ WKH UHVLGHQWLDO SRSXODWLRQ RI 9HUQRQ E\ XS WR QHZ KRXVLQJXQLWVZRXOGEHDGGUHVVHGWKURXJKWKLVH[LVWLQJIXQGDQGZRXOGEHOHVVWKDQVLJQLILFDQW ,PSDFWVWRDQ\RWKHUSXEOLFIDFLOLWLHVVXFKDVOLEUDULHVZRXOGVLPLODUO\EHOHVVWKDQVLJQLILFDQW VLQFH WKH OLPLWHG LQFUHDVH LQ SRSXODWLRQ LV QRW RI D VL]H WKDWZRXOGUHTXLUHG WKH H[SDQVLRQ RI H[LVWLQJRUFRQVWUXFWLRQRIQHZSXEOLFIDFLOLWLHV,PSDFWVZRXOGEHVLPLODUWRWKRVHLGHQWLILHGLQWKH *HQHUDO3ODQDQG=RQLQJ2UGLQDQFH3URJUDP(,5 4 Evaluation of Environmental Impacts Focused General Plan and Zoning Ordinance Update 51 4.15 – Recreation Potentially Significant Impact Less Than Significant with Mitigation Incorporation Less Than Significant Impact No Impact D :RXOGWKHSURMHFWLQFUHDVHWKHXVH RIH[LVWLQJQHLJKERUKRRGDQG UHJLRQDOSDUNVRURWKHUUHFUHDWLRQDO IDFLOLWLHVVXFKWKDWVXEVWDQWLDO SK\VLFDOGHWHULRUDWLRQRIWKHIDFLOLW\ ZRXOGRFFXURUEHDFFHOHUDWHG" Ŀ ĿĿ E 'RHVWKHSURMHFWLQFOXGH UHFUHDWLRQDOIDFLOLWLHVRUUHTXLUHWKH FRQVWUXFWLRQRUH[SDQVLRQRI UHFUHDWLRQDOIDFLOLWLHVZKLFKPLJKW KDYHDQDGYHUVHSK\VLFDOHIIHFWRQ WKHHQYLURQPHQW" Ŀ ĿĿ DLess than Significant Impact.5HIHUWRWKHGLVFXVVLRQLQ6HFWLRQGDERYH,PSDFWVWR UHFUHDWLRQZRXOGEHVLPLODUWRWKRVHLGHQWLILHGLQWKH*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH 3URJUDP(,5DQGZRXOGEHOHVVWKDQVLJQLILFDQW ELess Than Significant Impact. 7KHSURMHFWWKURXJKQHZODQGXVHSROLFLHVDQGWKHSRWHQWLDO GHYHORSPHQWDWQG'ULYHZRXOGLQFUHPHQWDOO\LQFUHDVHWKHORFDOSRSXODWLRQDQGWKHUHIRUH SRWHQWLDOO\LPSDFWVXUURXQGLQJDQGUHJLRQDOSDUNV+RZHYHUJLYHQWKHSURMHFWVFDOHDQGOLPLWHG DOORZDQFHIRUQHZUHVLGHQWLDOXQLWVLQWKH&LW\DQGIXUWKHUSURYLGHGWKDWWKH&LW\ZLOOUHTXLUHRQ VLWHRSHQVSDFHIRUDQ\QHZKRXVLQJSURMHFWVWKHSURMHFWGRHVQRWQHFHVVLWDWHWKHFRQVWUXFWLRQRI QHZSDUNV$Q\H[SDQVLRQRUQHZFRQVWUXFWLRQRIUHFUHDWLRQIDFLOLWLHVZRXOGEHVXEMHFWWRLWVRZQ HQYLURQPHQWDOUHYLHZSXUVXDQWWR&(4$,PSDFWVZRXOGEHOHVVWKDQVLJQLILFDQW 4 Evaluation of Environmental Impacts 52 Initial Study 4.16 – Transportation and Traffic :RXOGWKHSURMHFW Potentially Significant Impact Less Than Significant with Mitigation Incorporation Less Than Significant Impact No Impact D &RQIOLFWZLWKDQDSSOLFDEOHSODQ RUGLQDQFHRUSROLF\HVWDEOLVKLQJ PHDVXUHVRIHIIHFWLYHQHVVIRUWKH SHUIRUPDQFHRIWKHFLUFXODWLRQ V\VWHPWDNLQJLQWRDFFRXQWDOO PRGHVRIWUDQVSRUWDWLRQLQFOXGLQJ PDVVWUDQVLWDQGQRQPRWRUL]HG WUDYHODQGUHOHYDQWFRPSRQHQWVRI WKHFLUFXODWLRQV\VWHPLQFOXGLQJ EXWQRWOLPLWHGWRLQWHUVHFWLRQV VWUHHWVKLJKZD\VDQGIUHHZD\V SHGHVWULDQDQGELF\FOHSDWKVDQG PDVVWUDQVLW" Ŀ Ŀ Ŀ E &RQIOLFWZLWKDQDSSOLFDEOH FRQJHVWLRQPDQDJHPHQWSURJUDP LQFOXGLQJEXWQRWOLPLWHGWROHYHORI VHUYLFHVWDQGDUGVDQGWUDYHO GHPDQGPHDVXUHVRURWKHU VWDQGDUGVHVWDEOLVKHGE\WKHFRXQW\ FRQJHVWLRQPDQDJHPHQWDJHQF\IRU GHVLJQDWHGURDGVRUKLJKZD\V" Ŀ Ŀ Ŀ F 5HVXOWLQDFKDQJHLQDLUWUDIILF SDWWHUQVLQFOXGLQJHLWKHUDQ LQFUHDVHLQWUDIILFOHYHOVRUDFKDQJH LQORFDWLRQWKDWUHVXOWVLQ VXEVWDQWLDOVDIHW\ULVNV" Ŀ Ŀ Ŀ G 6XEVWDQWLDOO\LQFUHDVHKD]DUGVGXH WRDGHVLJQIHDWXUHHJVKDUS FXUYHVRUGDQJHURXVLQWHUVHFWLRQV RULQFRPSDWLEOHXVHVHJIDUP HTXLSPHQW" Ŀ Ŀ Ŀ H 5HVXOWLQLQDGHTXDWHHPHUJHQF\ DFFHVV"Ŀ ĿĿ 4 Evaluation of Environmental Impacts Focused General Plan and Zoning Ordinance Update 53 I &RQIOLFWZLWKDGRSWHGSROLFLHV SODQVRUSURJUDPVUHJDUGLQJSXEOLF WUDQVLWELF\FOHRUSHGHVWULDQ IDFLOLWLHVRURWKHUZLVHGHFUHDVHWKH SHUIRUPDQFHRUVDIHW\RIVXFK IDFLOLWLHV" Ŀ ĿĿ DEPotentially Significant Impact. 7KH*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH3URJUDP(,5 LGHQWLILHGLPSDFWVRQWUDIILFRQORFDOVXUIDFHVWUHHWVDQGIUHHZD\VDVVLJQLILFDQWDQGXQDYRLGDEOH DWWKHSURJUDPDQGFXPXODWLYHOHYHOV0LWLJDWLRQZDVLQFOXGHGWRUHGXFHLPSDFWVLQFOXGLQJ FRQGXFWLQJDVWXG\WRGHWHUPLQHLIDQ$XWRPDWHG7UDIILF6XUYHLOODQFHDQG&RQWURO6\VWHP$76$& ZRXOG EH D EHQHILFLDO DQG FRVWHIIHFWLYH PHWKRG IRU WKH &LW\ WRRSHUDWHDQGPDLQWDLQ FRRUGLQDWLRQ ZLWK ORFDO MXULVGLFWLRQV UDLO FRPSDQLHV DQG 0HWURSROLWDQ 7UDQVSRUWDWLRQ $XWKRULW\ UHJDUGLQJWUDQVSRUWDWLRQLPSURYHPHQWVFRRUGLQDWLRQZLWK&DOWUDQVDQGRWKHUORFDOJRYHUQPHQW DVVRFLDWLRQVUHJDUGLQJ,IUHHZD\LPSURYHPHQWV6RWR6WUHHWZLGHQLQJDQGULJKWRIZD\ GHGLFDWLRQVWRPHHW&LUFXODWLRQDQG,QIUDVWUXFWXUH(OHPHQWJRDOVDQGFDSDFLW\HQKDQFHPHQWV DW6DQWD)H$YHQXHDQGWK6WUHHW+RZHYHUIXOOLPSOHPHQWDWLRQRIWKHVHPHDVXUHVZRXOGEH FRQWLQJHQWXSRQDFWLRQVE\RXWVLGHDJHQFLHVRUIXQGLQJWKDWKDVQRW\HWEHHQVHFXUHGDVVXFK LPSDFWVZHUHIRXQGWREHVLJQLILFDQWDQGXQDYRLGDEOH 7KHSURSRVHGSURMHFWLQFOXGHV*HQHUDO3ODQDQG=RQLQJ0DSDPHQGPHQWVWRHVWDEOLVKD7UXFNDQG )UHLJKW 7HUPLQDO 2YHUOD\ GLVWULFW H[SDQG WKH ERXQGDULHV RI WKH &RPPHUFLDO 2YHUOD\ GLVWULFW SHUPLWKRXVLQJDWQG 'ULYH DFFRPPRGDWH HPHUJHQF\ KRXVLQJ ZLWKLQ WKH (PHUJHQF\ +RXVLQJ 2YHUOD\ DQG SHUPLW KRXVLQJ DWLGHQWLILHG VLWHV LQ WKH+RXVLQJ (OHPHQW DV VKRZQ LQ ([KLELWVDQG2YHUWKHORQJWHUPGHYHORSPHQWSXUVXDQWWRODQGXVHSROLF\DQG]RQLQJ UHJXODWLRQVFRXOGUHVXOWLQDQLQFUHDVHLQGHYHORSPHQWLQWHQVLW\DQGDFRUUHVSRQGLQJLQFUHDVHLQ YHKLFOHWULSVDQGWUDIILFLQFHUWDLQDUHDVRI9HUQRQ$FFRUGLQJO\SRWHQWLDOO\QHZRUVXEVWDQWLDOO\ PRUHVHYHUHVLJQLILFDQWWUDQVSRUWDWLRQLPSDFWVFRXOGRFFXUZLWKWKHDGRSWLRQRIWKH*HQHUDO3ODQ DQG=RQLQJ2UGLQDQFH0DS$PHQGPHQWVWKDWZLOOQHHGWREHIXUWKHUDQDO\]HGLQD6XSSOHPHQWDO (,5WREHSUHSDUHGIRUWKH3URSRVHG)RFXVHG8SGDWH FNo Impact.1RDLUSRUWODQGXVHSODQDSSOLHVWRDQ\DUHDRI9HUQRQ7KHQHDUHVWDLUSRUWLV &RPSWRQ$LUSRUWZKLFKLVORFDWHGDSSUR[LPDWHO\HLJKWPLOHVWRWKHVRXWK,PSOHPHQWDWLRQRIWKH 3URSRVHG8SGDWHZRXOGKDYHQRHIIHFWRQDLUWUDIILFSDWWHUQVDW&RPSWRQ$LUSRUW1RLPSDFWZRXOG RFFXU1RQHZRUVXEVWDQWLDOO\PRUHVHYHUHLPSDFWVZRXOGRFFXU GNo Impact.7KH3URSRVHG)RFXVHG8SGDWHGRHVQRWSURSRVHDQ\FKDQJHVWRWKH*HQHUDO3ODQ &LUFXODWLRQ DQG ,QIUDVWUXFWXUH (OHPHQW 7KH H[LVWLQJ =RQLQJ 2UGLQDQFH LQFOXGHV SODQQLQJ DQG SURMHFW GHVLJQ VWDQGDUGV LQWHQGHG WR DGGUHVV VXFK LVVXHV DV WUDIILF KD]DUGV IRU LQGLYLGXDO GHYHORSPHQW SURSRVDOV 7KH 3URSRVHG )RFXVHG 8SGDWH LQFOXGHV DGGLWLRQDO ODQJXDJH WR HQVXUH WUXFNPDQHXYHULQJGRHVQRWRFFXUQHDUGULYHZD\VWROLPLWSRWHQWLDOWUDIILFKD]DUGV1RFKDQJHV DUH SURSRVHG WR URDGZD\V EH\RQG WKRVH FRQVLGHUHG LQ WKH *HQHUDO 3ODQ DQG =RQLQJ 2UGLQDQFH3URJUDP(,50LQRUHGLWVWRWKH=RQLQJ2UGLQDQFHZRXOGLQFUHDVHWUDIILFVDIHW\LQWKH YLFLQLW\ RI GHYHORSPHQW VLWHV 1R QHZ RU VXEVWDQWLDOO\ PRUH VHYHUH LPSDFWV ZRXOG RFFXU DV D UHVXOWRISURMHFWDGRSWLRQDQGLPSOHPHQWDWLRQ HLess Than Significant Impact. $VLQGLFDWHGLQGDERYHQRFKDQJHVDUHSURSRVHGWR WKH &LUFXODWLRQ DQG ,QIUDVWUXFWXUH (OHPHQWV DQG UHYLVLRQV WR WKH =RQLQJ 2UGLQDQFH UHJDUGLQJ SDUNLQJDQGORDGLQJDUHLQWHQGHGWRHQKDQFHWUDIILFVDIHW\DQGHPHUJHQF\DFFHVV:LWKUHJDUGWR WKHSURSRVHGUHVLGHQWLDOGHYHORSPHQWSURMHFWDWQG'ULYHSURMHFWDFFHVVZLOOEHYLDQG 'ULYH7KURXJKUHYLHZRIWKHSURMHFWVLWHSODQWKH&LW\ZLOOFRQILUP WKDW WXUQLQJ UDGLL IRU HPHUJHQF\YHKLFOHVDFFHVVLQJWKHVLWHDQGDUHDGHTXDWHVHUYHWKHXVH7KHUHIRUHWKHSURMHFW 4 Evaluation of Environmental Impacts 54 Initial Study ZRXOGKDYHOHVVWKDQVLJQLILFDQWLPSDFWVRQWKHSURYLVLRQRIDGHTXDWHHPHUJHQF\DFFHVV1RQHZ RUVXEVWDQWLDOO\PRUHVHYHUHLPSDFWVZRXOGRFFXUZLWKLPSOHPHQWDWLRQRIWKH3URSRVHG)RFXVHG 8SGDWH ILess than Significant Impact. 7KH3URSRVHG)RFXVHG8SGDWHGRHVQRWLQFOXGHDQ\SURSRVHG UHYLVLRQVWRWKH&LUFXODWLRQDQG,QIUDVWUXFWXUH(OHPHQWV$VQRWHGLQWKH,QLWLDO6WXG\IRUWKH *HQHUDO3ODQDQG=RQLQJ2UGLQDQFH3URJUDP(,5WKH*HQHUDO3ODQLQFOXGHVSROLFLHVWRFRRUGLQDWH WUDQVSRUWDWLRQDFFHVVDQGSXEOLFWUDQVLW1RFKDQJHVDUHSURSRVHGWRWKHVHSROLFLHV7KXVWKH 3URSRVHG)RFXVHG8SGDWHZRXOGQRWFRQIOLFWZLWKVXFKSROLFLHVDQGQRLPSDFWZRXOGRFFXU1R QHZ RU VXEVWDQWLDOO\ PRUH VHYHUH LPSDFWV ZRXOG RFFXU ZLWK LPSOHPHQWDWLRQ RI WKH 3URSRVHG )RFXVHG8SGDWH 4 Evaluation of Environmental Impacts Focused General Plan and Zoning Ordinance Update 55 4.17 – Utilities and Service Systems :RXOGWKHSURMHFW Potentially Significant Impact Less Than Significant with Mitigation Incorporation Less Than Significant Impact No Impact D ([FHHGZDVWHZDWHUWUHDWPHQW UHTXLUHPHQWVRIWKHDSSOLFDEOH 5HJLRQDO:DWHU4XDOLW\&RQWURO %RDUG" Ŀ Ŀ Ŀ E 5HTXLUHRUUHVXOWLQWKHFRQVWUXFWLRQ RIQHZZDWHURUZDVWHZDWHU WUHDWPHQWIDFLOLWLHVRUH[SDQVLRQRI H[LVWLQJIDFLOLWLHVWKHFRQVWUXFWLRQ RIZKLFKFRXOGFDXVHVLJQLILFDQW HQYLURQPHQWDOHIIHFWV" Ŀ Ŀ Ŀ F 5HTXLUHRUUHVXOWLQWKHFRQVWUXFWLRQ RIQHZVWRUPZDWHUGUDLQDJH IDFLOLWLHVRUH[SDQVLRQRIH[LVWLQJ IDFLOLWLHVWKHFRQVWUXFWLRQRIZKLFK FRXOGFDXVHVLJQLILFDQW HQYLURQPHQWDOHIIHFWV" Ŀ Ŀ Ŀ G +DYHVXIILFLHQWZDWHUVXSSOLHV DYDLODEOHWRVHUYHWKHSURMHFWIURP H[LVWLQJHQWLWOHPHQWVDQG UHVRXUFHVRUDUHQHZRUH[SDQGHG HQWLWOHPHQWVQHHGHG" Ŀ ĿĿ H 5HVXOWLQDGHWHUPLQDWLRQE\WKH ZDVWHZDWHUWUHDWPHQWSURYLGHU ZKLFKVHUYHVRUPD\VHUYHWKH SURMHFWWKDWLWKDVDGHTXDWH FDSDFLW\WRVHUYHWKHSURMHFW¶V SURMHFWHGGHPDQGLQDGGLWLRQWRWKH SURYLGHU¶VH[LVWLQJFRPPLWPHQWV" Ŀ ĿĿ I %HVHUYHGE\DODQGILOOZLWK VXIILFLHQWSHUPLWWHGFDSDFLW\WR DFFRPPRGDWHWKHSURMHFW¶VVROLG ZDVWHGLVSRVDOQHHGV" Ŀ Ŀ Ŀ J &RPSO\ZLWKIHGHUDOVWDWHDQG ORFDOVWDWXWHVDQGUHJXODWLRQV UHODWHGWRVROLGZDVWH"Ŀ Ŀ Ŀ 4 Evaluation of Environmental Impacts 56 Initial Study DLess than Significant Impact.$OOQHZGHYHORSPHQWZLOOEHUHTXLUHGWRFRPSO\ZLWK ZDVWHZDWHU WUHDWPHQW UHTXLUHPHQWV VHW IRUWK E\ 5HJLRQDO :DWHU 4XDOLW\ &RQWURO %RDUG /RV $QJHOHV5HJLRQDQG6DQLWDWLRQ'LVWULFWVRI/RV$QJHOHV&RXQW\$VLQGLFDWHGLQWKH,QLWLDO6WXG\ FRPSOHWHGIRUWKH*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH3URJUDP(,5LPSDFWVZRXOGEHOHVV WKDQ VLJQLILFDQW :LWK UHJDUG WR SURSRVHG GHYHORSPHQW DW QG 'ULYH WKH SURMHFW ZRXOG LQYROYHUHSODFLQJDYDFDQWORWIRUPHUO\RFFXSLHGE\DQLQGXVWULDOXVHUZLWKUHVLGHQWLDOGZHOOLQJ XQLWV7KHSURSRVHGUHVLGHQWLDOXQLWVZLOOGLVFKDUJHFRPPRQZDVWHZDWHU IURP ODYDWRU\ DQG NLWFKHQDFWLYLWLHV6XFKGLVFKDUJHVZLOOQRWUHTXLUHXSJUDGHVRUQHZWHFKQRORJ\WREHLQVWDOOHGDW WKH ZDVWHZDWHU WUHDWPHQW IDFLOLW\ WR HQVXUH FRQWLQXHG FRPSOLDQFH ZLWK ZDVWHZDWHU GLVFKDUJH UHTXLUHPHQWV ,PSDFWV ZLOO EH VLPLODU DQG QR PRUH VHYHUH WKDQWKRVH LGHQWLILHG LQ WKH *HQHUDO3ODQDQG=RQLQJ2UGLQDQFH3URJUDP(,5DQGZRXOGFRQWLQXHWREHOHVVWKDQVLJQLILFDQW EFHLess than Significant Impact. $VLQGLFDWHGLQWKH,QLWLDO6WXG\FRPSOHWHGIRUWKH *HQHUDO3ODQDQG=RQLQJ2UGLQDQFH3URJUDP(,5QHZGHYHORSPHQWSXUVXDQWWR*HQHUDO3ODQODQG XVH SROLF\ FRXOG LQWHQVLI\ VRPH XVHV RQ SURSHUWLHV +RZHYHU WKH &LW\ ZLOO UHTXLUH WKDW HDFK LQGLYLGXDOSURMHFWEHDGHTXDWHO\VHUYHGE\ZDWHUVHZHUDQGGUDLQDJH LPSURYHPHQWV DQG FRQQHFWLRQIHHVIRUUHJLRQDOIDFLOLWLHVZRXOGEHSDLG&RQQHFWLRQIHHVFRQWULEXWHWRFRQVWUXFWLRQRI QHZUHJLRQDOV\VWHPVDQGIDFLOLWLHVDVQHHGWRDFFRPPRGDWHJURZWK,PSDFWZRXOGFRQWLQXHWR EHOHVVWKDQVLJQLILFDQW GLess than Significant Impact.7KUHHZDWHUDJHQFLHVVXSSO\ZDWHUWRSURSHUWLHVLQ9HUQRQ WKH&LW\RI9HUQRQ:DWHU'HSDUWPHQW&DOLIRUQLD:DWHU6HUYLFH&RPSDQ\&DO:DWHU(DVW/RV $QJHOHV 'LVWULFW DQG 0D\ZRRG 0XWXDO :DWHU &RPSDQ\ 1XPEHU ,QGXVWULDO EXVLQHVVHV ZLOO FRQWLQXHWREHWKHSUHSRQGHUDQWZDWHUXVHUVLQ9HUQRQFRQVLVWHQWZLWKFXUUHQWODQGXVHSROLF\ +RZHYHUSURSRVHG*HQHUDO3ODQODQGXVHSROLF\FKDQJHVZRXOGDOORZ IRU VRPH FRQYHUVLRQ RI LQGXVWULDOWRFRPPHUFLDODQGUHVLGHQWLDOXVHVLQFOXGLQJWKHSURSRVHG PXOWLIDPLO\ UHVLGHQWLDO GHYHORSPHQWDWQG'ULYH%DVHGRQZDWHUGHPDQGIDFWRUVSURYLGHGLQWKH8UEDQ :DWHU0DQDJHPHQW3ODQIRU&DO:DWHU¶V(DVW/RV$QJHOHV'LVWULFWWKH\HDUSURMHFWHGZDWHU GHPDQGDWDPHWHUHGVHUYLFHRIDPXOWLIDPLO\UHVLGHQWLDOGHYHORSPHQWLVDFUHIHHW\HDU7KH SURMHFWHGGHPDQGIRUWKHDYHUDJHPHWHUHGLQGXVWULDOXVHULVDFUHIHHW\HDU$VLQGLFDWHG LQEDERYHJLYHQWKDWDFRPPHUFLDORUUHVLGHQWLDOXVHZLOOFRQVXPHIDUOHVVZDWHUDQQXDOO\ WKDWWKHDYHUDJHLQGXVWULDOXVHLPSDFWRIWKHODQGXVHFKDQJHV ZLOO EH OHVV WKDQ VLJQLILFDQW )XUWKHUPRUHWKHSURMHFWVLWHDWQG'ULYHLVVHUYHGE\0D\ZRRG0XWXDO:DWHU&RPSDQ\ 1XPEHU$VRI$XJXVW0D\ZRRG0XWXDO:DWHU&RPSDQ\1XPEHUKDGDQDGMXGLFDWHG VXSSO\RIDFUHIHHWDQGDGHPDQGRIDSSUR[LPDWHO\DFUHIHHWZLWKDUHVLGXDOVXSSO\ RIDWOHDVWDFUHIHHWRIZDWHU 7KLVZRXOGEHPRUHWKDQDPSOHWRDFFRPPRGDWHWKHSURSRVHG GHYHORSPHQWDWQG'ULYHJLYHQZDWHUXVDJHHVWLPDWHV,PSDFWVZRXOGEHVLPLODUDQGOHVV VHYHUHWKDQWKRVHLGHQWLILHGLQWKH*HQHUDO3ODQDQG=RQLQJ2UGLQDQFH3URJUDP(,5DQG ZRXOGFRQWLQXHWREHOHVVWKDQVLJQLILFDQW IJLess than Significant Impact.$OOGHYHORSPHQWSXUVXDQWWR*HQHUDO3ODQSROLF\DQGWKH =RQLQJ2UGLQDQFHZLOOEHUHTXLUHGWRFRPSO\ZLWKIHGHUDOVWDWHDQGORFDOVWDWXWHVDQGUHJXODWLRQV UHODWHGWRWKHGLVSRVDORIVROLGZDVWH:LWKUHJDUGWRZDVWHYROXPHWKHYHU\OLPLWHGDOORZDQFHIRU UHVLGHQWLDOXVHDWQG'ULYHDVRSSRVHGWRLQGXVWULDOXQGHUWKHSURSRVHG*HQHUDO3ODQ $PHQGPHQW LV QRW DQWLFLSDWHG WR JHQHUDWH VLJQLILFDQW DGGLWLRQDOVROLGZDVWHLQIDFWWKH UHVLGHQWLDOXVHZRXOGJHQHUDWHOHVVZDVWH$VFRQFOXGHGLQWKH9HUQRQ*HQHUDO3ODQDQG =RQLQJ2UGLQDQFH3URJUDP(,5ORQJWHUPLPSOHPHQWDWLRQRIODQGXVHSROLF\OHVVWKDQVLJQLILFDQW &DOLIRUQLD:DWHU6HUYLFH&RPSDQ\8UEDQ:DWHU0DQDJHPHQW3ODQ(DVW/RV$QJHOHV'LVWULFW 7DEOH3URMHFWHG:DWHU'HOLYHULHV 7HOHSKRQHFRPPXQLFDWLRQZLWK%RE5RWK&LW\RI0D\ZRRG0XQLFLSDO:DWHU'LVWULFWHQJLQHHU$XJXVW 4 Evaluation of Environmental Impacts Focused General Plan and Zoning Ordinance Update 57 LPSDFWVUHODWLYHWRVROLGZDVWH,PSDFWVZRXOGEHVLPLODUWRWKRVHLGHQWLILHGLQWKH3URJUDP (,5DQGZRXOGEHOHVVWKDQVLJQLILFDQW 4 Evaluation of Environmental Impacts 58 Initial Study 4.18 – Mandatory Findings of Significance Potentially Significant Impact Less Than Significant with Mitigation Incorporation Less Than Significant Impact No Impact D 'RHVWKHSURMHFWKDYHWKHSRWHQWLDO WRGHJUDGHWKHTXDOLW\RIWKH HQYLURQPHQWVXEVWDQWLDOO\UHGXFH WKHKDELWDWRIDILVKRUZLOGOLIH VSHFLHVFDXVHDILVKRUZLOGOLIH SRSXODWLRQWRGURSEHORZVHOI VXVWDLQLQJOHYHOVWKUHDWHQWR HOLPLQDWHDSODQWRUDQLPDO FRPPXQLW\UHGXFHWKHQXPEHURU UHVWULFWWKHUDQJHRIDUDUHRU HQGDQJHUHGSODQWRUDQLPDORU HOLPLQDWHLPSRUWDQWH[DPSOHVRI WKHPDMRUSHULRGVRI&DOLIRUQLD KLVWRU\RUSUHKLVWRU\" Ŀ ĿĿ E 'RHVWKHSURMHFWKDYHLPSDFWVWKDW DUHLQGLYLGXDOO\OLPLWHGEXW FXPXODWLYHO\FRQVLGHUDEOH"Ŀ Ŀ Ŀ F 'RHVWKHSURMHFWKDYH HQYLURQPHQWDOHIIHFWVZKLFKZLOO FDXVHVXEVWDQWLDODGYHUVHHIIHFWV RQKXPDQEHLQJVHLWKHUGLUHFWO\RU LQGLUHFWO\" Ŀ Ŀ Ŀ DLess Than Significant Impact. $VGLVFXVVHGLQ6HFWLRQ%LRORJLFDO5HVRXUFHVDQG6HFWLRQ &XOWXUDO5HVRXUFHVWKH3URSRVHG8SGDWHGRHVQRWKDYHWKHSRWHQWLDOWRVXEVWDQWLDOO\UHGXFH WKHKDELWDWRIDILVKRUZLOGOLIHVSHFLHVFDXVHDILVKRUZLOGOLIHSRSXODWLRQWRGURSEHORZVHOI VXVWDLQLQJOHYHOVHOLPLQDWHDSODQWRUDQLPDOFRPPXQLW\UHGXFHWKHQXPEHURUUHVWULFWWKHUDQJH RIDUDUHRUHQGDQJHUHGSODQWRUDQLPDORUHOLPLQDWHLPSRUWDQWH[DPSOHVRIWKHPDMRUSHULRGVRI &DOLIRUQLDKLVWRU\RUSUHKLVWRU\,PSDFWVZRXOGEHVLPLODUWRWKRVHLGHQWLILHGLQWKH*HQHUDO 3ODQDQG=RQLQJ2UGLQDQFH3URJUDP(,5DQGZRXOGEHOHVVWKDQVLJQLILFDQW EPotentially Significant Impact.:KLOHVLJQLILFDQWFXPXODWLYHJURZWKLPSDFWVUHODWLYHWRDLU TXDOLW\ JUHHQKRXVH JDV HPLVVLRQV QRLVH DQG WUDQVSRUWDWLRQ DUH QRW DQWLFLSDWHG GXH WR LPSOHPHQWDWLRQRIWKH*HQHUDO3ODQ$PHQGPHQWV=RQLQJ0DSDQG=RQLQJ2UGLQDQFHUHYLVLRQVRU WKHSURSRVHGSURMHFWDWQG'ULYHQHZVLJQLILFDQWRUVXEVWDQWLDOO\PRUHVHYHUHFXPXODWLYH LPSDFWVLQWKHVHDUHDVFRXOGRFFXUDVDUHVXOWRIWKH3URSRVHG)RFXVHG8SGDWHZKLFKSURSRVH FKDQJHVLQWKHODQGXVHGHVLJQDWLRQRIVSHFLILFSDUFHOV7KHVHFKDQJHVFRXOGUHVXOWLQDQLQFUHDVH LQGHYHORSPHQWLQWHQVLW\DQGUHVXOWLQJLQFUHDVHLQDLUTXDOLW\LPSDFWVJUHHQKRXVHJDVHPLVVLRQV WKHH[SRVXUHRISHUVRQVWRKD]DUGVDQGKD]DUGRXVPDWHULDOVWKHH[SRVXUHRISHUVRQVWRQRLVH DQG WUDQVSRUWDWLRQ V\VWHP LPSDFWV $FFRUGLQJO\ VXFK LPSDFWV FRXOGEHSRWHQWLDOO\QHZRU 4 Evaluation of Environmental Impacts Focused General Plan and Zoning Ordinance Update 59 VXEVWDQWLDOO\PRUHVHYHUHVLJQLILFDQWLPSDFWVDQGZLOOEHDQDO\]HGLQD6XSSOHPHQWDO(,5WREH SUHSDUHGIRUWKH3URSRVHG)RFXVHG8SGDWH FPotentially Significant Impact.$VGLVFXVVHGLQ6HFWLRQ$LU4XDOLW\6HFWLRQ *UHHQKRXVH *DV (PLVVLRQV6HFWLRQ+D]DUGVDQG+D]DUGRXV0DWHULDOV6HFWLRQ1RLVH DQG 6HFWLRQ 7UDQVSRUWDWLRQ7UDIILF SRWHQWLDO LPSDFWV LQ WKHVH DUHDV FRXOG FUHDWH QHZ RU VXEVWDQWLDOO\PRUHVHYHUHHQYLURQPHQWDOHIIHFWVWKDWZRXOGDGYHUVHO\DIIHFWKXPDQEHLQJV6XFK HIIHFWVZLOOEHDQDO\]HGLQD6XSSOHPHQWDO(,5WREHSUHSDUHGIRUWKH3URSRVHG)RFXVHG8SGDWH 4 Evaluation of Environmental Impacts 60 Initial Study 7KLV3DJH,QWHQWLRQDOO\/HIW%ODQN Focused General Plan and Zoning Ordinance Update 61 5 References 5.1 – List of Preparers &LW\RI9HUQRQ/HDG$JHQF\ 'HSWRI&RPPXQLW\6HUYLFHV :DWHU 6DQWD)H$YHQXH 9HUQRQ&$ &RQWDFW 6.HYLQ:LOVRQ'LUHFWRURI&RPPXQLW\6HUYLFHVDQG:DWHU +RJOH,UHODQG(QYLURQPHQWDO$QDO\VLV 15RVHPHDG%OYG6XLWH 3DVDGHQD&$ /DXUD6WHWVRQ$,&36HQLRU9LFH3UHVLGHQW *HQHYLHYH6KDUURZ$VVRFLDWH3URMHFW0DQDJHU,, 5 References 62 Initial Study 7KLV3DJH,QWHQWLRQDOO\/HIW%ODQN Lead agencies may include 15 hardcopies of this document when submitting electronic copies of Environmental Impact Reports, Negative Declarations, Mitigated Negative Declarations, or Notices of Preparation to the State Clearinghouse (SCH). The SCH also accepts other summaries, such as EIR Executive Summaries prepared pursuant to CEQA Guidelines Section 15123. Please include one copy of the Notice of Completion Form (NOC) with your submission and attach the summary to each electronic copy of the document. SCH #: Project Title: Lead Agency: Contact Name: Email: Project Location: Project Decription (Proposed actions, location, and/or consequences). Revised September 2011 Summary Form for Electronic Document Submittal City County Form F Identify the project's significant or potentially significant effects and briefly describe any proposed mitigation measures that would reduce or avoid that effect. Phone Number: City of Vernon Focused General Plan and Zoning Ordinance Update City of Vernon S. Kevin Wilson KWilson@ci.vernon.ca.us 323-583-8811 City of Vernon , Los Angeles County Print Form The proposed project consists of: 1) a comprehensive update to the Vernon General Plan Housing Element; 2) a related revision to the Land Use Element to introduce a new Housing Overlay (and permit a potential housing development at 4675 52nd St.) and an Emergency Shelter Overlay; 3) revisions to the Land Use, Noise, Safety, and Resources Elements to respond to newly adopted State Law; and 4) focused revisions to the Vernon Zoning Ordinance and Zoning Map, including introduction of a Housing Overlay, an Emergency Shelter Overlay, and a Truck and Freight Terminal Overlay; expansion of the Commercial Overlay and revisions to allowable commercial uses; and minor edits to clarify other provisions. Based on the findings of the Initial Study, the City has identified topics for further analysis in a Supplemental Environmental Impact Report (Supplemental EIR to the 2007 Vernon General Plan and Zoning Ordinance EIR, State Clearinghouse No. 2007061031). Other impact issues were found to have no effects or would result in less than significant impacts. No mitigation measures were proposed in the Initial Study. Potentially significant effects identified that will be further analyzed in the SEIR are: Air Quality, Greenhouse Gas Emissions, Hazards & Hazardous Materials, Noise, and Transportation/Traffic. Provide a list of the responsible or trustee agencies for the project. If applicable, describe any of the project’s areas of controversy known to the Lead Agency, including issues raised by agencies and the public. continued City of Vernon Vernon General PlanVernon General Planand Zoning Ordinance UpdateSupplemental EIR Scoping Meeting1 Purpose of the Scoping MeetingppggTo determine the scope and content of the environmental information to bethe environmental information to beincluded in the Supplemental Environmental Impact ReportEnvironmental Impact Report2 Supplemental EIRpp•General Plan and Zoning Ordinance EIR certified gin 2007Supplemental EIR (SEIR) CEQA Guidelines•Supplemental EIR (SEIR) CEQA Guidelines15162–Minor additions or changes would be necessary to make the previous EIR adequately apply to the proposedproject in the changed situationpp pj g3 Project DescriptionjpGeneral Plan AmendmentsGeneral Plan Amendments•Housing Element amendment–2014-2021 State-required update20142021 Staterequired update–Good governance: Allow up to 60 more units in the City•Land Use Element amendments –newHousing Overlay–newEmergency Shelter OverlayddlO l–expandedCommercialOverlay•Noise, Safety, & Resources Element amendmentsAB 162 SB 244 SB 375 d d t l t i f ti–AB 162,SB 244,SB 375, and updates relevantinformation4 Project DescriptionjpOther ComponentsOther Components•Zoning Ordinance and Map Amendments•Achieve consistency with General Plan amendmentsAchieve consistency with General Plan amendments–newHousing Overlay, newEmergency Shelter Overlay, expandedCommercial Overlay•newTruck and Freight Terminal Overlay District•Allow ancillary commercial uses on weekends5 Project DescriptionjpOther ComponentsOther Components•4675 52nd Street proposed housing developmentdevelopment•2.06-acre City-owned site •Anticipated 35-45 unitsp6 Planning Areag7 Draft Land Use Map8 Draft Zoning Map9 Project DescriptionjpGeneral Plan (Proposed)General Plan (Proposed)Land Use Capacity•No net increase in industrial building square footage or employment projections•Potential modest increase in commercial developmentdevelopment•Permit an additional 60 units of housing10(Estimated 216 additional residents) Purpose of the EIRp•Public disclosure of the environmental consequences of a proposed project or planIdentify mitigation measures and examine•Identify mitigation measures and examinealternatives to reduce or avoid potentially significant impacts•Planning tool to assist decision-makers in evaluating benefits/disadvantages of theevaluating benefits/disadvantages of theproposed General Plan and Zoning Code amendments11 SEIR Process and ScheduleMilestones Estimated Completion DatesScoping Process September 26, 2012Draft EIR Distributed for Public Review & Comment (45 days)Late November 2012 Review & Comment (45 days)End of Draft EIR Public Review PeriodJanuary 2013P epa e Responses to CommentsPrepare Responses to Commentson DEIRJanuary 2013Prepare Final EIR Certification DtJanuary 2013DocumentsJanuary 2013Public Hearings/Final Certification February 201312 Topics Included in the SEIRTopics Included in the SEIR•Air Quality•Greenhouse Gases•Hazards/Hazardous Materials•Noise•Transportation/Trafficp/•Cumulative and Growth Inducing Impacts•Alternatives•Irreversible Environmental Changes13 Focus of Requested Comments on Scope of the EIRon Scope of the EIR•Specifickinds of impacts of concern—e.g. traffic congestion at particular locationstraffic congestion at particular locations,local greenhouse gas emissions, noise or hazardous conditions from specifichazardous conditions from specificsources, etc.14 Focus of Requested Comments on Scope of the EIRon Scope of the EIR•Specificconcerns about effectiveness of existing City policies and planning and engineering programs that deal with environmental protection and protection from hazards15 Focus of Requested Comments on Scope of the EIRon Scope of the EIR•Suggestions about ways to improve or change City policies and programs tochange City policies and programs tobetter address specific environmental concernsconcerns16 Focus of Requested Comments on Scope of the EIRon Scope of the EIR•Air Quality/GHG:Industrial uses andAir Quality/GHG:Industrial uses andtransportation sources•Hazards and Hazardous Materials: Industrial uses; active earthquake faults•Noise:Business/industrial noise; traffic and train noisei / ffibl d k•Transportation/Traffic:Automobile and trucktraffic; train impacts17 Vernon General PlanVernon General Planand Zoning Ordinance UpdateSupplemental EIR Scoping Meeting18 STATE OF CALIFORNIA Edmund G. Brown Jr.,Governor PUBLIC UTILITIES COMMISSION 320 WEST 4TH STREET, SUITE 500 LOS ANGELES, CA 90013 September 21, 2012 S. Kevin Wilson City of Vernon 4305 Santa Fe Avenue Vernon, CA 90058 Dear Mr. Wilson: Re: SCH# 2007061031 Focused General Plan and Zoning Ordinance Update The California Public Utilities Commission (Commission) has jurisdiction over the safety of highway- rail crossings (crossings) in California. The California Public Utilities Code requires Commission approval for the construction or alteration of crossings and grants the Commission exclusive power on the design, alteration, and closure of crossings in California. The Commission Rail Crossings Engineering Section (RCES) is in receipt of the Notice of Preparation (NOP) from the State Clearinghouse for the proposed City of Vernon (City) Focused General Plan and Zoning Ordinance Update project. Previously on June 26 and October 5, 2007, RCES issued two (2) comment letters on the matter. RCES recommends that the City add language to the General Plan so that any future development adjacent to or near the shared railroad/light rail right-of-way is planned with the safety of the rail corridor in mind. New developments may increase traffic volumes not only on streets and at intersections, but also at at-grade highway-rail crossings. This includes considering pedestrian circulation patterns/destinations with respect to railroad right-of-way and compliance with the Americans with Disabilities Act. Mitigation measures to consider include, but are not limited to, the planning for grade separations for major thoroughfares, improvements to existing at-grade highway-rail crossings due to increase in traffic volumes and continuous vandal resistant fencing or other appropriate barriers to limit the access of trespassers onto the railroad right-of-way. If you have any questions, please contact Ken Chiang at 213-576-7076, email at ykc@cpuc.ca.gov. Sincerely, Ken Chiang, PE Utilities Engineer Rail Crossings Engineering Section Consumer Protection & Safety Division C: State Clearinghouse City of Huntington Park Planning Department 6550 Miles Avenue Huntington Park, CA 90255 Lucille Roybal-Allard Congresswoman 255 E. Temple St., Ste 1860 Los Angeles, CA 90012 John Kinas United States Aluminum 3663 Bandini Boulevard Vernon, CA 90023 L.A. County Board of Supervisors Director of Planning James Hertl – Room 1390 320 W. Temple Street Los Angeles, CA 90012 Gloria Molina Board of Supervisors 500 W. Temple St., Ste 856 Los Angeles, CA 90012 Ms. Gutierrez 924 S. Mott Street Los Angeles, CA 90023 South Coast Air Quality Mgmt District (AQMD) 21865 E. Copley Drive Diamond Bar, CA 91765 City of Long Beach Office of the City Manager 333 W. Ocean Blvd., 13th floor Long Beach, CA 90802 James H. Hillands Heger Realty Corp. 5657 E. Washington Blvd. Los Angeles, CA 90040 Brian Scanlon L.A. County Public Works Mapping & Property Mgmt. 900 S. Fremont Avenue, 10th Floor Alhambra, CA 91803 E.J. Contreras Owens-Brockway 2901 Fruitland Avenue Vernon, CA 90058 Joseph R. Garruba California Portland Cement Co. 2025 E. Financial Way Glendora, CA 91740 City of Commerce Planning Department 2535 Commerce Way Commerce, CA 90040 California Water Service Comp. 3316 West Beverly Boulevard Montebello, CA 90640 J.J. Little J.J. Little Company, Inc. 9945 Malgar Drive Whittier, CA 90603 City of Bell Planning Department 6330 Pine Street Bell, CA 90201 Marisa Olguin Chamber of Commerce 3801 Santa Fe Avenue Vernon, CA 90058 L.R. Luppen Metal Products Engineering 3050 Leonis Boulevard Vernon, CA 90058 City of Cudahy Planning Department 5220 Santa Ana Street Cudahy, CA 90201 State Clearinghouse P.O. Box 3044 Sacramento, CA 95812-3044 Ellen Orlando Karen Lehrer 2300 E. 11th Street Los Angeles, CA 90021 L.A. County Sanitation District P.O. Box 4998 Whittier, CA 90607 L.A. County Flood Control District 900 S. Fremont Avenue, 8th Floor Alhambra, CA 91803 Maywood Mutual Water Co. 3 6151 Heliotrope Avenue Maywood, CA 90270 City of Maywood Planning Department 4319 Slauson Avenue Maywood, CA 90270 L.A. Unified School District Office of Environmental Health & Safety 333 South Beaudry Ave., 20th Floor Los Angeles, CA 90017 Attention: Glenn Striegler So. Cal Edison 1924 Cashdan Street Compton, CA 90220 Attn: Mike Frazier City of Los Angeles Planning Department 200 North Spring St. Los Angeles, CA 90012 Suk Chon County of Los Angeles Department of Public Works Land Development Division P.O. Box 1460 Alhambra, CA 91802-1460 Dave Karrker California Water Service 5243 E. Sheila Street Commerce, CA 90022 Reynan L. Ledesma Department of Water & Power L.A. 111 N. Hope Street Los Angeles, CA 90012 AT&T 100 W. Alondra Blvd., Rm 202A Gardena, CA 90248 Attn: Leslie Donaldson The Gas Company (So. Cal Gas Co.) P.O. Box 3150 San Dimas, CA 91773 Burlington Northern Santa Fe Railroad 3770 E. Washington Blvd. Los Angeles, CA 90023 Attn: Dick Ebel L.A. Junction Railroad 4433 Exchange Avenue Vernon, CA 90058 Attn: Marion Alexander L.A. County Sanitation District P.O. Box 4998 Whittier, CA 90607 Suk Chon County of Los Angeles Department of Public Works Land Development Division P.O. Box 1460 Alhambra, CA 91802-1460 The Gas Company (So. Cal Gas Co.) P.O. Box 3150 San Dimas, CA 91773 L.A. County Sanitation District P.O. Box 4998 Whittier, CA 90607 Suk Chon County of Los Angeles Department of Public Works Land Development Division P.O. Box 1460 Alhambra, CA 91802-1460 The Gas Company (So. Cal Gas Co.) P.O. Box 3150 San Dimas, CA 91773 L.A. County Sanitation District P.O. Box 4998 Whittier, CA 90607 Suk Chon County of Los Angeles Department of Public Works Land Development Division P.O. Box 1460 Alhambra, CA 91802-1460 The Gas Company (So. Cal Gas Co.) P.O. Box 3150 San Dimas, CA 91773 Appendix B Air Quality Data 7KLV3DJH,QWHQWLRQDOO\/HIW%ODQN EXISTINGOUTPUT ThisPageIntentionallyLeftBlank 0.00 0.00 0.00 0.00 0.000.00 0.00 0.00 0.00 0.00 0.00PercentReduction0.00 0.00 0.00 0.00 0.00Bio- CO2 NBio-CO2 Total CO2 CH4 N20 CO2eFugitivePM10ExhaustPM10PM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotaltblLandUse LotAcreage 2,612.99 2,613.002.0 Emissions SummaryROG NOx CO SO2tblConstructionPhase NumDays 10,000.00 0.00tblLandUse LandUseSquareFeet 113,822,000.00 113,822,280.00Table Name Column Name Default Value New Value1.3 User Entered Comments & Non-Default DataProject Characteristics - Land Use - acreageConstruction Phase - No construction proposed.CO2 Intensity (lb/MWhr)630.89CH4 Intensity (lb/MWhr)0.029N2O Intensity (lb/MWhr)0.00631Climate Zone12Operational Year2014Utility CompanySouthern California Edison1.2 Other Project CharacteristicsUrbanizationUrbanWind Speed (m/s)2.2Precipitation Freq (Days)PopulationGeneral Light Industry 113,822.28 1000sqft 2,613.00 113,822,280.00 01.1 Land UsageLand Uses Size Metric Lot Acreage Floor Surface AreaCalEEMod Version: CalEEMod.2013.2.2 Page 1 of 1 Date: 12/16/2013 2:55 PMCity of Vernon Supplemental EIR ExistingSouth Coast Air Basin, Summer1.0 Project Characteristics 0.00 0.00 0.00 0.00 0.00 0.000.00 0.00 0.00 0.00 0.00 0.00NBio-CO2 Total CO2 CH4 N20 CO2ePercentReduction0.00 0.00 0.00 0.00ExhaustPM10PM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO2ROG NOx CO SO2 Fugitive PM1010,850,999.345210,850,999.3452457.7331 12.6516 10,864,533.73937,444.6167256.6843 7,701.30091,988.6281 239.2728 2,227.9008Total 7,033.3991 13,687.040653,666.7966113.087510,160,886.735710,160,886.7357444.4319 10,170,219.80647,444.6167212.9344 7,657.55111,988.6281 195.5229 2,184.1510Mobile 3,992.5407 13,111.849153,171.5850109.6362690,087.6992690,087.699213.2267 12.6516 694,287.457943.7056 43.7056 43.7056 43.7056Energy 63.2580 575.0731 483.0614 3.450424.9103 24.9103 0.0745 26.47500.0443 0.0443 0.0443 0.0443Area 2,977.6003 0.1184 12.1503 8.7000e-004Total CO2 CH4 N2O CO2eCategory lb/daylb/dayPM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO2 NBio- CO2Mitigated OperationalROG NOx CO SO2 Fugitive PM10ExhaustPM1010,850,999.345210,850,999.3452457.7331 12.6516 10,864,533.73937,444.6167256.6843 7,701.30091,988.6281 239.2728 2,227.9008Total 7,033.3991 13,687.040653,666.7966113.087510,160,886.735710,160,886.7357444.4319 10,170,219.80647,444.6167212.9344 7,657.55111,988.6281 195.5229 2,184.1510Mobile 3,992.5407 13,111.849153,171.5850109.6362690,087.6992690,087.699213.2267 12.6516 694,287.457943.7056 43.7056 43.7056 43.7056Energy 63.2580 575.0731 483.0614 3.450424.9103 24.9103 0.0745 26.47500.0443 0.0443 0.0443 0.0443Area 2,977.6003 0.1184 12.1503 8.7000e-004CH4 N2O CO2eCategory lb/daylb/dayFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO2 NBio- CO2 Total CO2Unmitigated OperationalROG NOx CO SO2 Fugitive PM10ExhaustPM10PM10Total2.2 Overall Operational 6.90 20.00 LD_Mix HDT_Mix HHDT3.1 Mitigation Measures ConstructionDemolition 6 15.00 0.00 0.00 14.70Worker Trip LengthVendor Trip LengthHauling Trip LengthWorker Vehicle ClassVendorVehicle ClassHaulingVehicle ClassTrips and VMTPhase Name Offroad Equipment CountWorker Trip NumberVendor Trip NumberHauling Trip NumberDemolition Rubber Tired Dozers 2 8.00 255 0.40Demolition Excavators 3 8.00 162 0.38Load FactorDemolition Concrete/Industrial Saws 1 8.00 81 0.73OffRoad EquipmentPhase Name Offroad Equipment Type Amount Usage Hours Horse Power0Acres of Grading (Site Preparation Phase): 0Acres of Grading (Grading Phase): 0Acres of Paving: 0Residential Indoor: 0; Residential Outdoor: 0; Non-Residential Indoor: 0; Non-Residential Outdoor: 0 (Architectural Coating – sqft)End Date Num Days WeekNum Days Phase Description1 Demolition Demolition 1/1/2014 12/31/2013 53.0 Construction DetailConstruction PhasePhaseNumberPhase Name Phase Type Start Date 690,087.6992690,087.699213.2267 12.6516 694,287.457943.7056 43.7056 43.7056 43.7056NaturalGasUnmitigated63.2580 575.0731 483.0614 3.4504690,087.6992690,087.699213.2267 12.6516 694,287.457943.7056 43.7056 43.7056 43.7056NaturalGasMitigated63.2580 575.0731 483.0614 3.4504NBio- CO2 Total CO2 CH4 N2O CO2eCategory lb/daylb/dayExhaustPM10PM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO24.4 Fleet MixHistorical Energy Use: N5.1 Mitigation Measures EnergyROG NOx CO SO2 Fugitive PM100.001923 0.002530 0.004314 0.000602 0.0020755.0 Energy DetailSBUS MH0.516610 0.060517 0.179979 0.140587 0.041566 0.006616 0.015092 0.027587LHD2 MHD HHD OBUS UBUS MCY28.00 13.00 92 5 3LDA LDT1 LDT2 MDV LHD1H-S or C-C H-O or C-NW Primary Diverted Pass-byGeneral Light Industry 16.60 8.40 6.90 59.004.3 Trip Type InformationMiles Trip % Trip Purpose %Land Use H-W or C-W H-S or C-C H-O or C-NW H-W or C-WTotal 793,341.29 150,245.41 77,399.15 2,653,392,885 2,653,392,885Annual VMTGeneral Light Industry 793,341.29 150,245.41 77399.15 2,653,392,8852,653,392,8854.2 Trip Summary InformationAverage Daily Trip Rate Unmitigated MitigatedLand Use Weekday Saturday Sunday Annual VMT10,160,886.735710,160,886.7357444.4319 10,170,219.80647,444.6167212.9344 7,657.55111,988.6281 195.5229 2,184.1510Mitigated 3,992.5407 13,111.849153,171.5850109.636210,160,886.735710,160,886.7357444.4319 10,170,219.80647,444.6167212.9344 7,657.55111,988.6281 195.5229 2,184.1510Unmitigated 3,992.5407 13,111.849153,171.5850109.6362NBio- CO2 Total CO2 CH4 N2O CO2eCategory lb/daylb/dayExhaustPM10PM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO24.0 Operational Detail - Mobile4.1 Mitigation Measures MobileROG NOx CO SO2 Fugitive PM10 24.9103 24.9103 0.0745 26.47500.0443 0.0443 0.0443 0.0443Mitigated 2,977.6003 0.1184 12.1503 8.7000e-00424.9103 24.9103 0.0745 26.47500.0443 0.0443 0.0443 0.0443Unmitigated 2,977.6003 0.1184 12.1503 8.7000e-004NBio- CO2 Total CO2 CH4 N2O CO2eCategory lb/daylb/dayExhaustPM10PM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO26.0 Area Detail6.1 Mitigation Measures AreaROG NOx CO SO2 Fugitive PM10690,087.6992690,087.699213.2267 12.6516 694,287.457943.7056 43.7056 43.7056 43.7056Total 63.2580 575.0731 483.0614 3.4504690,087.6992690,087.699213.2267 12.6516 694,287.457943.7056 43.7056 43.7056 43.7056General Light Industry5865.75 63.2580 575.0731 483.0614 3.4504Total CO2 CH4 N2O CO2eLand Use kBTU/yr lb/daylb/dayPM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO2 NBio- CO2MitigatedNaturalGas UseROG NOx CO SO2 Fugitive PM10ExhaustPM10690,087.6992690,087.699213.2267 12.6516 694,287.457943.7056 43.7056 43.7056 43.7056Total 63.2580 575.0731 483.0614 3.4504690,087.6992690,087.699213.2267 12.6516 694,287.457943.7056 43.7056 43.7056 43.7056General Light Industry5.86575e+00663.2580 575.0731 483.0614 3.4504Total CO2 CH4 N2O CO2eLand Use kBTU/yr lb/daylb/dayPM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO2 NBio- CO25.2 Energy by Land Use - NaturalGasUnmitigatedNaturalGas UseROG NOx CO SO2 Fugitive PM10ExhaustPM10 Hours/Day Days/Year Horse Power Load Factor Fuel Type10.0 Vegetation7.0 Water Detail7.1 Mitigation Measures Water8.0 Waste Detail8.1 Mitigation Measures Waste9.0 Operational OffroadEquipment Type Number24.9103 24.9103 0.0745 26.47500.0443 0.0443 0.0443 0.0443Total 2,977.6003 0.1184 12.1503 8.7000e-00424.9103 24.9103 0.0745 26.47500.0443 0.0443 0.0443 0.0443Landscaping 1.2275 0.1184 12.1503 8.7000e-0040.0000 0.00000.0000 0.0000 0.0000 0.0000ConsumerProducts2,253.68110.0000 0.00000.0000 0.0000 0.0000 0.0000ArchitecturalCoating722.6917Total CO2 CH4 N2O CO2eSubCategory lb/daylb/dayPM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO2 NBio- CO2MitigatedROG NOx CO SO2 Fugitive PM10ExhaustPM1024.9103 24.9103 0.0745 26.47500.0443 0.0443 0.0443 0.0443Total 2,977.6003 0.1184 12.1503 8.7000e-00424.9103 24.9103 0.0745 26.47500.0443 0.0443 0.0443 0.0443Landscaping 1.2275 0.1184 12.1503 8.7000e-0040.0000 0.00000.0000 0.0000 0.0000 0.0000ConsumerProducts2,253.68110.0000 0.00000.0000 0.0000 0.0000 0.0000ArchitecturalCoating722.6917Total CO2 CH4 N2O CO2eSubCategory lb/daylb/dayPM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO2 NBio- CO26.2 Area by SubCategoryUnmitigatedROG NOx CO SO2 Fugitive PM10ExhaustPM10 0.00 0.00 0.00 0.00 0.000.00 0.00 0.00 0.00 0.00 0.00PercentReduction0.00 0.00 0.00 0.00 0.00Bio- CO2 NBio-CO2 Total CO2 CH4 N20 CO2eFugitivePM10ExhaustPM10PM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotaltblLandUse LotAcreage 2,612.99 2,613.002.0 Emissions SummaryROG NOx CO SO2tblConstructionPhase NumDays 10,000.00 0.00tblLandUse LandUseSquareFeet 113,822,000.00 113,822,280.00Table Name Column Name Default Value New Value1.3 User Entered Comments & Non-Default DataProject Characteristics - Land Use - acreageConstruction Phase - No construction proposed.CO2 Intensity (lb/MWhr)630.89CH4 Intensity (lb/MWhr)0.029N2O Intensity (lb/MWhr)0.00631Climate Zone12Operational Year2014Utility CompanySouthern California Edison1.2 Other Project CharacteristicsUrbanizationUrbanWind Speed (m/s)2.2Precipitation Freq (Days)PopulationGeneral Light Industry 113,822.28 1000sqft 2,613.00 113,822,280.00 01.1 Land UsageLand Uses Size Metric Lot Acreage Floor Surface AreaCalEEMod Version: CalEEMod.2013.2.2 Page 1 of 1 Date: 12/16/2013 2:57 PMCity of Vernon Supplemental EIR ExistingSouth Coast Air Basin, Winter1.0 Project Characteristics 0.00 0.00 0.00 0.00 0.00 0.000.00 0.00 0.00 0.00 0.00 0.00NBio-CO2 Total CO2 CH4 N20 CO2ePercentReduction0.00 0.00 0.00 0.00ExhaustPM10PM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO2ROG NOx CO SO2 Fugitive PM1010,347,944.271910,347,944.2719457.9380 12.6516 10,361,482.96847,444.6167257.7046 7,702.32131,988.6281 240.2114 2,228.8395Total 7,157.5012 14,404.025551,688.2921107.52339,657,831.66249,657,831.6624444.6368 9,667,169.03557,444.6167213.9547 7,658.57141,988.6281 196.4615 2,185.0896Mobile 4,116.6429 13,828.834051,193.0805104.0720690,087.6992690,087.699213.2267 12.6516 694,287.457943.7056 43.7056 43.7056 43.7056Energy 63.2580 575.0731 483.0614 3.450424.9103 24.9103 0.0745 26.47500.0443 0.0443 0.0443 0.0443Area 2,977.6003 0.1184 12.1503 8.7000e-004Total CO2 CH4 N2O CO2eCategory lb/daylb/dayPM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO2 NBio- CO2Mitigated OperationalROG NOx CO SO2 Fugitive PM10ExhaustPM1010,347,944.271910,347,944.2719457.9380 12.6516 10,361,482.96847,444.6167257.7046 7,702.32131,988.6281 240.2114 2,228.8395Total 7,157.5012 14,404.025551,688.2921107.52339,657,831.66249,657,831.6624444.6368 9,667,169.03557,444.6167213.9547 7,658.57141,988.6281 196.4615 2,185.0896Mobile 4,116.6429 13,828.834051,193.0805104.0720690,087.6992690,087.699213.2267 12.6516 694,287.457943.7056 43.7056 43.7056 43.7056Energy 63.2580 575.0731 483.0614 3.450424.9103 24.9103 0.0745 26.47500.0443 0.0443 0.0443 0.0443Area 2,977.6003 0.1184 12.1503 8.7000e-004CH4 N2O CO2eCategory lb/daylb/dayFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO2 NBio- CO2 Total CO2Unmitigated OperationalROG NOx CO SO2 Fugitive PM10ExhaustPM10PM10Total2.2 Overall Operational 6.90 20.00 LD_Mix HDT_Mix HHDT3.1 Mitigation Measures ConstructionDemolition 6 15.00 0.00 0.00 14.70Worker Trip LengthVendor Trip LengthHauling Trip LengthWorker Vehicle ClassVendorVehicle ClassHaulingVehicle ClassTrips and VMTPhase Name Offroad Equipment CountWorker Trip NumberVendor Trip NumberHauling Trip NumberDemolition Rubber Tired Dozers 2 8.00 255 0.40Demolition Excavators 3 8.00 162 0.38Load FactorDemolition Concrete/Industrial Saws 1 8.00 81 0.73OffRoad EquipmentPhase Name Offroad Equipment Type Amount Usage Hours Horse Power0Acres of Grading (Site Preparation Phase): 0Acres of Grading (Grading Phase): 0Acres of Paving: 0Residential Indoor: 0; Residential Outdoor: 0; Non-Residential Indoor: 0; Non-Residential Outdoor: 0 (Architectural Coating – sqft)End Date Num Days WeekNum Days Phase Description1 Demolition Demolition 1/1/2014 12/31/2013 53.0 Construction DetailConstruction PhasePhaseNumberPhase Name Phase Type Start Date 690,087.6992690,087.699213.2267 12.6516 694,287.457943.7056 43.7056 43.7056 43.7056NaturalGasUnmitigated63.2580 575.0731 483.0614 3.4504690,087.6992690,087.699213.2267 12.6516 694,287.457943.7056 43.7056 43.7056 43.7056NaturalGasMitigated63.2580 575.0731 483.0614 3.4504NBio- CO2 Total CO2 CH4 N2O CO2eCategory lb/daylb/dayExhaustPM10PM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO24.4 Fleet MixHistorical Energy Use: N5.1 Mitigation Measures EnergyROG NOx CO SO2 Fugitive PM100.001923 0.002530 0.004314 0.000602 0.0020755.0 Energy DetailSBUS MH0.516610 0.060517 0.179979 0.140587 0.041566 0.006616 0.015092 0.027587LHD2 MHD HHD OBUS UBUS MCY28.00 13.00 92 5 3LDA LDT1 LDT2 MDV LHD1H-S or C-C H-O or C-NW Primary Diverted Pass-byGeneral Light Industry 16.60 8.40 6.90 59.004.3 Trip Type InformationMiles Trip % Trip Purpose %Land Use H-W or C-W H-S or C-C H-O or C-NW H-W or C-WTotal 793,341.29 150,245.41 77,399.15 2,653,392,885 2,653,392,885Annual VMTGeneral Light Industry 793,341.29 150,245.41 77399.15 2,653,392,8852,653,392,8854.2 Trip Summary InformationAverage Daily Trip Rate Unmitigated MitigatedLand Use Weekday Saturday Sunday Annual VMT9,657,831.66249,657,831.6624444.6368 9,667,169.03557,444.6167213.9547 7,658.57141,988.6281 196.4615 2,185.0896Mitigated 4,116.6429 13,828.834051,193.0805104.07209,657,831.66249,657,831.6624444.6368 9,667,169.03557,444.6167213.9547 7,658.57141,988.6281 196.4615 2,185.0896Unmitigated 4,116.6429 13,828.834051,193.0805104.0720NBio- CO2 Total CO2 CH4 N2O CO2eCategory lb/daylb/dayExhaustPM10PM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO24.0 Operational Detail - Mobile4.1 Mitigation Measures MobileROG NOx CO SO2 Fugitive PM10 24.9103 24.9103 0.0745 26.47500.0443 0.0443 0.0443 0.0443Mitigated 2,977.6003 0.1184 12.1503 8.7000e-00424.9103 24.9103 0.0745 26.47500.0443 0.0443 0.0443 0.0443Unmitigated 2,977.6003 0.1184 12.1503 8.7000e-004NBio- CO2 Total CO2 CH4 N2O CO2eCategory lb/daylb/dayExhaustPM10PM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO26.0 Area Detail6.1 Mitigation Measures AreaROG NOx CO SO2 Fugitive PM10690,087.6992690,087.699213.2267 12.6516 694,287.457943.7056 43.7056 43.7056 43.7056Total 63.2580 575.0731 483.0614 3.4504690,087.6992690,087.699213.2267 12.6516 694,287.457943.7056 43.7056 43.7056 43.7056General Light Industry5865.75 63.2580 575.0731 483.0614 3.4504Total CO2 CH4 N2O CO2eLand Use kBTU/yr lb/daylb/dayPM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO2 NBio- CO2MitigatedNaturalGas UseROG NOx CO SO2 Fugitive PM10ExhaustPM10690,087.6992690,087.699213.2267 12.6516 694,287.457943.7056 43.7056 43.7056 43.7056Total 63.2580 575.0731 483.0614 3.4504690,087.6992690,087.699213.2267 12.6516 694,287.457943.7056 43.7056 43.7056 43.7056General Light Industry5.86575e+00663.2580 575.0731 483.0614 3.4504Total CO2 CH4 N2O CO2eLand Use kBTU/yr lb/daylb/dayPM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO2 NBio- CO25.2 Energy by Land Use - NaturalGasUnmitigatedNaturalGas UseROG NOx CO SO2 Fugitive PM10ExhaustPM10 Hours/Day Days/Year Horse Power Load Factor Fuel Type10.0 Vegetation7.0 Water Detail7.1 Mitigation Measures Water8.0 Waste Detail8.1 Mitigation Measures Waste9.0 Operational OffroadEquipment Type Number24.9103 24.9103 0.0745 26.47500.0443 0.0443 0.0443 0.0443Total 2,977.6003 0.1184 12.1503 8.7000e-00424.9103 24.9103 0.0745 26.47500.0443 0.0443 0.0443 0.0443Landscaping 1.2275 0.1184 12.1503 8.7000e-0040.0000 0.00000.0000 0.0000 0.0000 0.0000ConsumerProducts2,253.68110.0000 0.00000.0000 0.0000 0.0000 0.0000ArchitecturalCoating722.6917Total CO2 CH4 N2O CO2eSubCategory lb/daylb/dayPM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO2 NBio- CO2MitigatedROG NOx CO SO2 Fugitive PM10ExhaustPM1024.9103 24.9103 0.0745 26.47500.0443 0.0443 0.0443 0.0443Total 2,977.6003 0.1184 12.1503 8.7000e-00424.9103 24.9103 0.0745 26.47500.0443 0.0443 0.0443 0.0443Landscaping 1.2275 0.1184 12.1503 8.7000e-0040.0000 0.00000.0000 0.0000 0.0000 0.0000ConsumerProducts2,253.68110.0000 0.00000.0000 0.0000 0.0000 0.0000ArchitecturalCoating722.6917Total CO2 CH4 N2O CO2eSubCategory lb/daylb/dayPM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO2 NBio- CO26.2 Area by SubCategoryUnmitigatedROG NOx CO SO2 Fugitive PM10ExhaustPM10 tblLandUse LotAcreage 2,612.99 2,613.00tblConstructionPhase NumDays 10,000.00 0.00tblLandUse LandUseSquareFeet 113,822,000.00 113,822,280.00Table Name Column Name Default Value New Value1.3 User Entered Comments & Non-Default DataProject Characteristics - Land Use - acreageConstruction Phase - No construction proposed.CO2 Intensity (lb/MWhr)630.89CH4 Intensity (lb/MWhr)0.029N2O Intensity (lb/MWhr)0.00631Climate Zone12Operational Year2014Utility CompanySouthern California Edison1.2 Other Project CharacteristicsUrbanizationUrbanWind Speed (m/s)2.2Precipitation Freq (Days)PopulationGeneral Light Industry 113,822.28 1000sqft 2,613.00 113,822,280.00 01.1 Land UsageLand Uses Size Metric Lot Acreage Floor Surface AreaCalEEMod Version: CalEEMod.2013.2.2 Page 1 of 1 Date: 12/16/2013 2:52 PMCity of Vernon Supplemental EIR ExistingSouth Coast Air Basin, Annual1.0 Project Characteristics 37,000.54441,822,757.10851,859,757.65292,630.805826.9795 1,923,368.21391,004.719437.2759 1,041.9953268.7871 34.8806 303.6678Total 1,096.1672 2,044.2798 7,226.236515.10128,350.546198,078.0171106,428.5632862.0330 21.1521 131,088.40600.0000 0.0000 0.0000 0.0000Water28,649.99830.0000 28,649.99831,693.16640.0000 64,206.49270.0000 0.0000 0.0000 0.0000Waste0.0000 1,217,929.88521,217,929.885255.3664 0.0000 1,219,092.57931,004.719429.2941 1,034.0135268.7871 26.8988 295.6860Mobile 541.2811 1,939.3142 7,136.559114.47140.0000 506,746.3814506,746.381420.2316 5.8274 508,977.73377.9763 7.9763 7.9763 7.9763Energy 11.5446 104.9508 88.1587 0.62970.0000 2.8248 2.8248 8.4500e-0030.0000 3.00225.5400e-0035.5400e-0035.5400e-0035.5400e-003Area 543.3415 0.0148 1.5188 1.1000e-004Total CO2 CH4 N2O CO2eCategory tons/yrMT/yrPM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO2 NBio- CO2Mitigated OperationalROG NOx CO SO2 Fugitive PM10ExhaustPM1037,000.54441,822,757.10851,859,757.65292,630.962327.0119 1,923,381.53601,004.719437.2759 1,041.9953268.7871 34.8806 303.6678Total 1,096.1672 2,044.2798 7,226.236515.10128,350.546198,078.0171106,428.5632862.1895 21.1845 131,101.72810.0000 0.0000 0.0000 0.0000Water28,649.99830.0000 28,649.99831,693.16640.0000 64,206.49270.0000 0.0000 0.0000 0.0000Waste0.0000 1,217,929.88521,217,929.885255.3664 0.0000 1,219,092.57931,004.719429.2941 1,034.0135268.7871 26.8988 295.6860Mobile 541.2811 1,939.3142 7,136.559114.47140.0000 506,746.3814506,746.381420.2316 5.8274 508,977.73377.9763 7.9763 7.9763 7.9763Energy 11.5446 104.9508 88.1587 0.62970.0000 2.8248 2.8248 8.4500e-0030.0000 3.00225.5400e-0035.5400e-0035.5400e-0035.5400e-003Area 543.3415 0.0148 1.5188 1.1000e-004CH4 N2O CO2eCategory tons/yrMT/yrFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO2 NBio- CO2 Total CO2Unmitigated OperationalROG NOx CO SO2 Fugitive PM10ExhaustPM10PM10Total0.00 0.00 0.00 0.00 0.002.2 Overall Operational0.00 0.00 0.00 0.00 0.00 0.00PercentReduction0.00 0.00 0.00 0.00 0.00Bio- CO2 NBio-CO2 Total CO2 CH4 N20 CO2eFugitivePM10ExhaustPM10PM10TotalFugitivePM2.5ExhaustPM2.5PM2.5Total2.0 Emissions SummaryROG NOx CO SO2 6.90 20.00 LD_Mix HDT_Mix HHDT3.1 Mitigation Measures ConstructionDemolition 6 15.00 0.00 0.00 14.70Worker Trip LengthVendor Trip LengthHauling Trip LengthWorker Vehicle ClassVendorVehicle ClassHaulingVehicle ClassTrips and VMTPhase Name Offroad Equipment CountWorker Trip NumberVendor Trip NumberHauling Trip NumberDemolition Rubber Tired Dozers 2 8.00 255 0.40Demolition Excavators 3 8.00 162 0.38Load FactorDemolition Concrete/Industrial Saws 1 8.00 81 0.73OffRoad EquipmentPhase Name Offroad Equipment Type Amount Usage Hours Horse Power0Acres of Grading (Site Preparation Phase): 0Acres of Grading (Grading Phase): 0Acres of Paving: 0Residential Indoor: 0; Residential Outdoor: 0; Non-Residential Indoor: 0; Non-Residential Outdoor: 0 (Architectural Coating – sqft)End Date Num Days WeekNum Days Phase Description1 Demolition Demolition 1/1/2014 12/31/2013 53.0 Construction DetailConstruction PhasePhaseNumberPhase Name Phase Type Start Date0.00 0.00 0.00 0.01 0.12 0.000.00 0.00 0.00 0.00 0.00 0.00NBio-CO2 Total CO2 CH4 N20 CO2ePercentReduction0.00 0.00 0.00 0.00ExhaustPM10PM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO2ROG NOx CO SO2 Fugitive PM10 4.4 Fleet MixHistorical Energy Use: N0.001923 0.002530 0.004314 0.000602 0.0020755.0 Energy DetailSBUS MH0.516610 0.060517 0.179979 0.140587 0.041566 0.006616 0.015092 0.027587LHD2 MHD HHD OBUS UBUS MCY28.00 13.00 92 5 3LDA LDT1 LDT2 MDV LHD1H-S or C-C H-O or C-NW Primary Diverted Pass-byGeneral Light Industry 16.60 8.40 6.90 59.004.3 Trip Type InformationMiles Trip % Trip Purpose %Land Use H-W or C-W H-S or C-C H-O or C-NW H-W or C-WTotal 793,341.29 150,245.41 77,399.15 2,653,392,885 2,653,392,885Annual VMTGeneral Light Industry 793,341.29 150,245.41 77399.15 2,653,392,8852,653,392,8854.2 Trip Summary InformationAverage Daily Trip Rate Unmitigated MitigatedLand Use Weekday Saturday Sunday Annual VMT0.0000 1,217,929.88521,217,929.885255.3664 0.0000 1,219,092.57931,004.719429.2941 1,034.0135268.7871 26.8988 295.6860Unmitigated 541.2811 1,939.3142 7,136.559114.47140.0000 1,217,929.88521,217,929.885255.3664 0.0000 1,219,092.57931,004.719429.2941 1,034.0135268.7871 26.8988 295.6860Mitigated 541.2811 1,939.3142 7,136.559114.4714NBio- CO2 Total CO2 CH4 N2O CO2eCategory tons/yrMT/yrExhaustPM10PM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO24.0 Operational Detail - Mobile4.1 Mitigation Measures MobileROG NOx CO SO2 Fugitive PM10 114,251.7580114,251.75802.1898 2.0946 114,947.07517.9763 7.9763 7.9763 7.9763 0.00002.0946 114,947.0751Total 11.5446 104.9508 88.1587 0.62977.9763 7.9763 0.0000 114,251.7580114,251.75802.189888.1587 0.6297 7.9763 7.9763CO2eLand Use kBTU/yr tons/yrMT/yrGeneral Light Industry2.141e+00911.5446 104.9508PM2.5TotalBio- CO2 NBio- CO2 Total CO2 CH4 N2OSO2 Fugitive PM10ExhaustPM10PM10TotalFugitivePM2.5ExhaustPM2.5NaturalGas UseROG NOx CO114,251.75802.1898 2.0946 114,947.0751Mitigated7.9763 7.9763 7.9763 0.0000 114,251.7580114,947.0751Total 11.5446 104.9508 88.1587 0.6297 7.97637.9763 0.0000 114,251.7580114,251.75802.1898 2.09460.6297 7.9763 7.9763 7.9763General Light Industry2.141e+00911.5446 104.9508 88.1587NBio- CO2 Total CO2 CH4 N2O CO2eLand Use kBTU/yr tons/yrMT/yrExhaustPM10PM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO25.2 Energy by Land Use - NaturalGasUnmitigatedNaturalGas UseROG NOx CO SO2 Fugitive PM100.0000 392,494.6234392,494.623418.0417 3.7328 394,030.65860.0000 0.0000 0.0000 0.0000ElectricityUnmitigated0.0000 392,494.6234392,494.623418.0417 3.7328 394,030.65860.0000 0.0000 0.0000 0.0000Electricity Mitigated0.0000 114,251.7580114,251.75802.1898 2.0946 114,947.07517.9763 7.9763 7.9763 7.9763NaturalGasUnmitigated11.5446 104.9508 88.1587 0.62970.0000 114,251.7580114,251.75802.1898 2.0946 114,947.07517.9763 7.9763 7.9763 7.9763NaturalGasMitigated11.5446 104.9508 88.1587 0.6297NBio- CO2 Total CO2 CH4 N2O CO2eCategory tons/yrMT/yrExhaustPM10PM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO25.1 Mitigation Measures EnergyROG NOx CO SO2 Fugitive PM10 0.0000 2.8248 2.8248 8.4500e-0030.0000 3.00225.5400e-0035.5400e-0035.5400e-0035.5400e-003Unmitigated 543.3415 0.0148 1.5188 1.1000e-0040.0000 2.8248 2.8248 8.4500e-0030.0000 3.00225.5400e-0035.5400e-0035.5400e-0035.5400e-003Mitigated 543.3415 0.0148 1.5188 1.1000e-004NBio- CO2 Total CO2 CH4 N2O CO2eCategory tons/yrMT/yrExhaustPM10PM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO26.0 Area Detail6.1 Mitigation Measures AreaROG NOx CO SO2 Fugitive PM10394,030.6586Total 392,494.623418.0417 3.7328 394,030.6586Land Use kWh/yrtonMT/yrGeneral Light Industry1.37156e+009392,494.623418.0417 3.7328MitigatedElectricityUseTotal CO2 CH4 N2O CO2e394,030.6586Total 392,494.623418.0417 3.7328 394,030.6586Land Use kWh/yrtonMT/yrGeneral Light Industry1.37156e+009392,494.623418.0417 3.7328UnmitigatedElectricityUseTotal CO2 CH4 N2O CO2e5.3 Energy by Land Use - Electricity Mitigated 106,428.5632862.0330 21.1521 131,088.4060CategorytonMT/yrUnmitigated 106,428.5632862.1895 21.1845 131,101.72817.0 Water Detail7.1 Mitigation Measures WaterTotal CO2 CH4 N2O CO2e0.0000 2.8248 2.8248 8.4500e-0030.0000 3.00225.5400e-0035.5400e-0035.5400e-0035.5400e-003Total 543.3415 0.0148 1.5188 1.1000e-0040.0000 2.8248 2.8248 8.4500e-0030.0000 3.00225.5400e-0035.5400e-0035.5400e-0035.5400e-003Landscaping 0.1534 0.0148 1.5188 1.1000e-0040.0000 0.0000 0.0000 0.0000 0.0000 0.00000.0000 0.0000 0.0000 0.0000ConsumerProducts411.29680.0000 0.0000 0.0000 0.0000 0.0000 0.00000.0000 0.0000 0.0000 0.0000ArchitecturalCoating131.8912Total CO2 CH4 N2O CO2eSubCategory tons/yrMT/yrPM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO2 NBio- CO2MitigatedROG NOx CO SO2 Fugitive PM10ExhaustPM100.0000 2.8248 2.8248 8.4500e-0030.0000 3.00225.5400e-0035.5400e-0035.5400e-0035.5400e-003Total 543.3415 0.0148 1.5188 1.1000e-0040.0000 2.8248 2.8248 8.4500e-0030.0000 3.00225.5400e-0035.5400e-0035.5400e-0035.5400e-003Landscaping 0.1534 0.0148 1.5188 1.1000e-0040.0000 0.0000 0.0000 0.0000 0.0000 0.00000.0000 0.0000 0.0000 0.0000ConsumerProducts411.29680.0000 0.0000 0.0000 0.0000 0.0000 0.00000.0000 0.0000 0.0000 0.0000ArchitecturalCoating131.8912Total CO2 CH4 N2O CO2eSubCategory tons/yrMT/yrPM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO2 NBio- CO26.2 Area by SubCategoryUnmitigatedROG NOx CO SO2 Fugitive PM10ExhaustPM10 Unmitigated 28,649.99831,693.1664 0.0000 64,206.4927tonMT/yr Mitigated 28,649.99831,693.1664 0.0000 64,206.49278.0 Waste Detail8.1 Mitigation Measures WasteCategory/YearTotal CO2 CH4 N2O CO2e131,088.4060Total 106,428.5632862.0330 21.1521 131,088.4060Land Use MgaltonMT/yrGeneral Light Industry26321.3 / 0 106,428.5632862.0330 21.1521MitigatedIndoor/Outdoor UseTotal CO2 CH4 N2O CO2e131,101.7281Total 106,428.5632862.1895 21.1845 131,101.7281Land Use MgaltonMT/yrGeneral Light Industry26321.3 / 0 106,428.5632862.1895 21.18457.2 Water by Land UseUnmitigatedIndoor/Outdoor UseTotal CO2 CH4 N2O CO2e Load Factor Fuel Type10.0 Vegetation9.0 Operational OffroadEquipment Type Number Hours/Day Days/Year Horse Power64,206.4927Total 28,649.99831,693.16640.0000 64,206.4927Land Use tonstonMT/yrGeneral Light Industry141139 28,649.99831,693.16640.0000MitigatedWasteDisposedTotal CO2 CH4 N2O CO2e64,206.4927Total 28,649.99831,693.16640.0000 64,206.4927Land Use tonstonMT/yrGeneral Light Industry141139 28,649.99831,693.16640.00008.2 Waste by Land UseUnmitigatedWasteDisposedTotal CO2 CH4 N2O CO2e PROPOSEDOUTPUT ThisPageIntentionallyLeftBlank 0.00 0.00 0.00 0.00 0.000.00 0.00 0.00 0.00 0.00 0.00PercentReduction0.00 0.00 0.00 0.00 0.00Bio- CO2 NBio-CO2 Total CO2 CH4 N20 CO2eFugitivePM10ExhaustPM10PM10TotalFugitivePM2.5ExhaustPM2.5PM2.5Total2.0 Emissions SummaryROG NOx CO SO2tblConstructionPhase NumDays 10,000.00 0.00tblProjectCharacteristics OperationalYear 2014 2035Table Name Column Name Default Value New Value1.3 User Entered Comments & Non-Default DataProject Characteristics - Land Use - acreageConstruction Phase - No construction proposed.CO2 Intensity (lb/MWhr)630.89CH4 Intensity (lb/MWhr)0.029N2O Intensity (lb/MWhr)0.00631Climate Zone12Operational Year2035Utility CompanySouthern California Edison1.2 Other Project CharacteristicsUrbanizationUrbanWind Speed (m/s)2.2Precipitation Freq (Days)PopulationGeneral Light Industry 120,879.00 1000sqft 2,775.00 120,879,000.00 01.1 Land UsageLand Uses Size Metric Lot Acreage Floor Surface AreaCalEEMod Version: CalEEMod.2013.2.2 Page 1 of 1 Date: 12/16/2013 3:03 PMCity of Vernon Supplemental EIR ProposedSouth Coast Air Basin, Summer1.0 Project Characteristics 0.00 0.00 0.00 0.00 0.00 0.000.00 0.00 0.00 0.00 0.00 0.00NBio-CO2 Total CO2 CH4 N20 CO2ePercentReduction0.00 0.00 0.00 0.00ExhaustPM10PM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO2ROG NOx CO SO2 Fugitive PM109,460,450.80719,460,450.8071231.3761 13.4360 9,469,474.85807,930.0909206.3369 8,136.42782,120.4302193.9711 2,314.4014Total 5,086.3831 5,837.3249 24,463.1231126.08468,727,552.80058,727,552.8005217.2612 8,732,115.28607,930.0909159.8782 8,089.96912,120.4302147.5124 2,267.9427Mobile 1,857.1778 5,226.4884 23,937.8416122.4193732,871.5520732,871.552014.0467 13.4360 737,331.686146.4152 46.4152 46.4152 46.4152Energy 67.1799 610.7263 513.0101 3.664426.4547 26.4547 0.0682 27.88590.0435 0.0435 0.0435 0.0435Area 3,162.0255 0.1103 12.2715 9.2000e-004Total CO2 CH4 N2O CO2eCategory lb/daylb/dayPM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO2 NBio- CO2Mitigated OperationalROG NOx CO SO2 Fugitive PM10ExhaustPM109,460,450.80719,460,450.8071231.3761 13.4360 9,469,474.85807,930.0909206.3369 8,136.42782,120.4302193.9711 2,314.4014Total 5,086.3831 5,837.3249 24,463.1231126.08468,727,552.80058,727,552.8005217.2612 8,732,115.28607,930.0909159.8782 8,089.96912,120.4302147.5124 2,267.9427Mobile 1,857.1778 5,226.4884 23,937.8416122.4193732,871.5520732,871.552014.0467 13.4360 737,331.686146.4152 46.4152 46.4152 46.4152Energy 67.1799 610.7263 513.0101 3.664426.4547 26.4547 0.0682 27.88590.0435 0.0435 0.0435 0.0435Area 3,162.0255 0.1103 12.2715 9.2000e-004CH4 N2O CO2eCategory lb/daylb/dayFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO2 NBio- CO2Total CO2Unmitigated OperationalROG NOx CO SO2 Fugitive PM10ExhaustPM10PM10Total2.2 Overall Operational 6.90 20.00 LD_Mix HDT_Mix HHDT3.1 Mitigation Measures ConstructionDemolition 6 15.00 0.00 0.00 14.70Worker Trip LengthVendor Trip LengthHauling Trip LengthWorker Vehicle ClassVendorVehicle ClassHaulingVehicle ClassTrips and VMTPhase Name Offroad Equipment CountWorker Trip NumberVendor Trip NumberHauling Trip NumberDemolition Rubber Tired Dozers 2 8.00 255 0.40Demolition Excavators 3 8.00 162 0.38Load FactorDemolition Concrete/Industrial Saws 1 8.00 81 0.73OffRoad EquipmentPhase Name Offroad Equipment Type Amount Usage Hours Horse Power0Acres of Grading (Site Preparation Phase): 0Acres of Grading (Grading Phase): 0Acres of Paving: 0Residential Indoor: 0; Residential Outdoor: 0; Non-Residential Indoor: 0; Non-Residential Outdoor: 0 (Architectural Coating – sqft)End Date Num Days WeekNum Days Phase Description1 Demolition Demolition 1/1/2014 12/31/2013 53.0 Construction DetailConstruction PhasePhaseNumberPhase Name Phase Type Start Date 4.4 Fleet MixHistorical Energy Use: N0.002183 0.002612 0.003879 0.000535 0.0035215.0 Energy DetailSBUS MH0.475956 0.062534 0.188657 0.147142 0.045607 0.007258 0.017370 0.042746LHD2 MHD HHD OBUS UBUS MCY28.00 13.00 92 5 3LDA LDT1 LDT2 MDV LHD1H-S or C-C H-O or C-NW Primary Diverted Pass-byGeneral Light Industry 16.60 8.40 6.90 59.004.3 Trip Type InformationMiles Trip % Trip Purpose %Land Use H-W or C-W H-S or C-C H-O or C-NW H-W or C-WTotal 842,526.63 159,560.28 82,197.72 2,817,897,152 2,817,897,152Annual VMTGeneral Light Industry 842,526.63 159,560.28 82197.72 2,817,897,1522,817,897,1524.2 Trip Summary InformationAverage Daily Trip Rate Unmitigated MitigatedLand Use Weekday Saturday Sunday Annual VMT8,727,552.80058,727,552.8005217.2612 8,732,115.28607,930.0909159.8782 8,089.96912,120.4302147.5124 2,267.9427Mitigated 1,857.1778 5,226.4884 23,937.8416122.41938,727,552.80058,727,552.8005217.2612 8,732,115.28607,930.0909159.8782 8,089.96912,120.4302147.5124 2,267.9427Unmitigated 1,857.1778 5,226.4884 23,937.8416122.4193NBio-CO2Total CO2 CH4 N2O CO2eCategory lb/daylb/dayExhaustPM10PM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO24.0 Operational Detail - Mobile4.1 Mitigation Measures MobileROG NOx CO SO2 Fugitive PM10 26.4547 26.4547 0.0682 27.88590.0435 0.0435 0.0435 0.0435Mitigated 3,162.0255 0.1103 12.2715 9.2000e-00426.4547 26.4547 0.0682 27.88590.0435 0.0435 0.0435 0.0435Unmitigated 3,162.0255 0.1103 12.2715 9.2000e-004NBio-CO2Total CO2 CH4 N2O CO2eCategory lb/daylb/dayExhaustPM10PM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO26.0 Area Detail6.1 Mitigation Measures AreaROG NOx CO SO2 Fugitive PM10732,871.5520732,871.552014.0467 13.4360 737,331.686146.4152 46.4152 46.4152 46.4152Total 67.1799 610.7263 513.0101 3.6644732,871.5520732,871.552014.0467 13.4360 737,331.686146.4152 46.4152 46.4152 46.4152General Light Industry6229.41 67.1799 610.7263 513.0101 3.6644Total CO2 CH4 N2O CO2eLand Use kBTU/yr lb/daylb/dayPM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO2 NBio- CO2MitigatedNaturalGas UseROG NOx CO SO2 Fugitive PM10ExhaustPM10732,871.5520732,871.552014.0467 13.4360 737,331.686146.4152 46.4152 46.4152 46.4152Total 67.1799 610.7263 513.0101 3.6644732,871.5520732,871.552014.0467 13.4360 737,331.686146.4152 46.4152 46.4152 46.4152General Light Industry6.22941e+00667.1799 610.7263 513.0101 3.6644Total CO2 CH4 N2O CO2eLand Use kBTU/yr lb/daylb/dayPM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO2 NBio- CO25.2 Energy by Land Use - NaturalGasUnmitigatedNaturalGas UseROG NOx CO SO2 Fugitive PM10ExhaustPM10732,871.5520732,871.552014.0467 13.4360 737,331.686146.4152 46.4152 46.4152 46.4152NaturalGasUnmitigated67.1799 610.7263 513.0101 3.6644732,871.5520732,871.552014.0467 13.4360 737,331.686146.4152 46.4152 46.4152 46.4152NaturalGasMitigated67.1799 610.7263 513.0101 3.6644NBio-CO2Total CO2 CH4 N2O CO2eCategory lb/daylb/dayExhaustPM10PM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO25.1 Mitigation Measures EnergyROG NOx CO SO2 Fugitive PM10 Hours/Day Days/Year Horse Power Load Factor Fuel Type7.0 Water Detail7.1 Mitigation Measures Water8.0 Waste Detail8.1 Mitigation Measures Waste9.0 Operational OffroadEquipment Type Number26.4547 26.4547 0.0682 27.88590.0435 0.0435 0.0435 0.0435Total 3,162.0255 0.1103 12.2715 9.2000e-00426.4547 26.4547 0.0682 27.88590.0435 0.0435 0.0435 0.0435Landscaping 1.1224 0.1103 12.2715 9.2000e-0040.0000 0.00000.0000 0.0000 0.0000 0.0000ConsumerProducts2,393.40420.0000 0.00000.0000 0.0000 0.0000 0.0000ArchitecturalCoating767.4989Total CO2 CH4 N2O CO2eSubCategory lb/daylb/dayPM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO2 NBio- CO2MitigatedROG NOx CO SO2 Fugitive PM10ExhaustPM1026.4547 26.4547 0.0682 27.88590.0435 0.0435 0.0435 0.0435Total 3,162.0255 0.1103 12.2715 9.2000e-00426.4547 26.4547 0.0682 27.88590.0435 0.0435 0.0435 0.0435Landscaping 1.1224 0.1103 12.2715 9.2000e-0040.0000 0.00000.0000 0.0000 0.0000 0.0000ConsumerProducts2,393.40420.0000 0.00000.0000 0.0000 0.0000 0.0000ArchitecturalCoating767.4989Total CO2 CH4 N2O CO2eSubCategory lb/daylb/dayPM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO2 NBio- CO26.2 Area by SubCategoryUnmitigatedROG NOx CO SO2 Fugitive PM10ExhaustPM10 0.00 0.00 0.00 0.00 0.000.00 0.00 0.00 0.00 0.00 0.00PercentReduction0.00 0.00 0.00 0.00 0.00Bio- CO2 NBio-CO2 Total CO2 CH4 N20 CO2eFugitivePM10ExhaustPM10PM10TotalFugitivePM2.5ExhaustPM2.5PM2.5Total2.0 Emissions SummaryROG NOx CO SO2tblConstructionPhase NumDays 10,000.00 0.00tblProjectCharacteristics OperationalYear 2014 2035Table Name Column Name Default Value New Value1.3 User Entered Comments & Non-Default DataProject Characteristics - Land Use - acreageConstruction Phase - No construction proposed.CO2 Intensity (lb/MWhr)630.89CH4 Intensity (lb/MWhr)0.029N2O Intensity (lb/MWhr)0.00631Climate Zone12Operational Year2035Utility CompanySouthern California Edison1.2 Other Project CharacteristicsUrbanizationUrbanWind Speed (m/s)2.2Precipitation Freq (Days)PopulationGeneral Light Industry 120,879.00 1000sqft 2,775.00 120,879,000.00 01.1 Land UsageLand Uses Size Metric Lot Acreage Floor Surface AreaCalEEMod Version: CalEEMod.2013.2.2 Page 1 of 1 Date: 12/16/2013 3:05 PMCity of Vernon Supplemental EIR ProposedSouth Coast Air Basin, Winter1.0 Project Characteristics 0.00 0.00 0.00 0.00 0.00 0.000.00 0.00 0.00 0.00 0.00 0.00NBio-CO2 Total CO2 CH4 N20 CO2ePercentReduction0.00 0.00 0.00 0.00ExhaustPM10PM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO2ROG NOx CO SO2 Fugitive PM109,066,131.03619,066,131.0361231.7388 13.4360 9,075,162.70457,930.0909206.7113 8,136.80232,120.4302194.3156 2,314.7458Total 5,127.1632 6,081.1942 23,925.1402119.98778,333,233.02958,333,233.0295217.6240 8,337,803.13257,930.0909160.2526 8,090.34362,120.4302147.8568 2,268.2871Mobile 1,897.9578 5,470.3576 23,399.8587116.3224732,871.5520732,871.552014.0467 13.4360 737,331.686146.4152 46.4152 46.4152 46.4152Energy 67.1799 610.7263 513.0101 3.664426.4547 26.4547 0.0682 27.88590.0435 0.0435 0.0435 0.0435Area 3,162.0255 0.1103 12.2715 9.2000e-004Total CO2 CH4 N2O CO2eCategory lb/daylb/dayPM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO2 NBio- CO2Mitigated OperationalROG NOx CO SO2 Fugitive PM10ExhaustPM109,066,131.03619,066,131.0361231.7388 13.4360 9,075,162.70457,930.0909206.7113 8,136.80232,120.4302194.3156 2,314.7458Total 5,127.1632 6,081.1942 23,925.1402119.98778,333,233.02958,333,233.0295217.6240 8,337,803.13257,930.0909160.2526 8,090.34362,120.4302147.8568 2,268.2871Mobile 1,897.9578 5,470.3576 23,399.8587116.3224732,871.5520732,871.552014.0467 13.4360 737,331.686146.4152 46.4152 46.4152 46.4152Energy 67.1799 610.7263 513.0101 3.664426.4547 26.4547 0.0682 27.88590.0435 0.0435 0.0435 0.0435Area 3,162.0255 0.1103 12.2715 9.2000e-004CH4 N2O CO2eCategory lb/daylb/dayFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO2 NBio- CO2Total CO2Unmitigated OperationalROG NOx CO SO2 Fugitive PM10ExhaustPM10PM10Total2.2 Overall Operational 6.90 20.00 LD_Mix HDT_Mix HHDT3.1 Mitigation Measures ConstructionDemolition 6 15.00 0.00 0.00 14.70Worker Trip LengthVendor Trip LengthHauling Trip LengthWorker Vehicle ClassVendorVehicle ClassHaulingVehicle ClassTrips and VMTPhase Name Offroad Equipment CountWorker Trip NumberVendor Trip NumberHauling Trip NumberDemolition Rubber Tired Dozers 2 8.00 255 0.40Demolition Excavators 3 8.00 162 0.38Load FactorDemolition Concrete/Industrial Saws 1 8.00 81 0.73OffRoad EquipmentPhase Name Offroad Equipment Type Amount Usage Hours Horse Power0Acres of Grading (Site Preparation Phase): 0Acres of Grading (Grading Phase): 0Acres of Paving: 0Residential Indoor: 0; Residential Outdoor: 0; Non-Residential Indoor: 0; Non-Residential Outdoor: 0 (Architectural Coating – sqft)End Date Num Days WeekNum Days Phase Description1 Demolition Demolition 1/1/2014 12/31/2013 53.0 Construction DetailConstruction PhasePhaseNumberPhase Name Phase Type Start Date 4.4 Fleet MixHistorical Energy Use: N0.002183 0.002612 0.003879 0.000535 0.0035215.0 Energy DetailSBUS MH0.475956 0.062534 0.188657 0.147142 0.045607 0.007258 0.017370 0.042746LHD2 MHD HHD OBUS UBUS MCY28.00 13.00 92 5 3LDA LDT1 LDT2 MDV LHD1H-S or C-C H-O or C-NW Primary Diverted Pass-byGeneral Light Industry 16.60 8.40 6.90 59.004.3 Trip Type InformationMiles Trip % Trip Purpose %Land Use H-W or C-W H-S or C-C H-O or C-NW H-W or C-WTotal 842,526.63 159,560.28 82,197.72 2,817,897,152 2,817,897,152Annual VMTGeneral Light Industry 842,526.63 159,560.28 82197.72 2,817,897,1522,817,897,1524.2 Trip Summary InformationAverage Daily Trip Rate Unmitigated MitigatedLand Use Weekday Saturday Sunday Annual VMT8,333,233.02958,333,233.0295217.6240 8,337,803.13257,930.0909160.2526 8,090.34362,120.4302147.8568 2,268.2871Mitigated 1,897.9578 5,470.3576 23,399.8587116.32248,333,233.02958,333,233.0295217.6240 8,337,803.13257,930.0909160.2526 8,090.34362,120.4302147.8568 2,268.2871Unmitigated 1,897.9578 5,470.3576 23,399.8587116.3224NBio-CO2Total CO2 CH4 N2O CO2eCategory lb/daylb/dayExhaustPM10PM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO24.0 Operational Detail - Mobile4.1 Mitigation Measures MobileROG NOx CO SO2 Fugitive PM10 732,871.5520732,871.552014.0467 13.4360 737,331.686146.4152 46.4152 46.4152 46.4152Total 67.1799 610.7263 513.0101 3.6644732,871.5520732,871.552014.0467 13.4360 737,331.686146.4152 46.4152 46.4152 46.4152General Light Industry6229.41 67.1799 610.7263 513.0101 3.6644Total CO2 CH4 N2O CO2eLand Use kBTU/yr lb/daylb/dayPM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO2 NBio- CO2MitigatedNaturalGas UseROG NOx CO SO2 Fugitive PM10ExhaustPM10732,871.5520732,871.552014.0467 13.4360 737,331.686146.4152 46.4152 46.4152 46.4152Total 67.1799 610.7263 513.0101 3.6644732,871.5520732,871.552014.0467 13.4360 737,331.686146.4152 46.4152 46.4152 46.4152General Light Industry6.22941e+00667.1799 610.7263 513.0101 3.6644Total CO2 CH4 N2O CO2eLand Use kBTU/yr lb/daylb/dayPM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO2 NBio- CO25.2 Energy by Land Use - NaturalGasUnmitigatedNaturalGas UseROG NOx CO SO2 Fugitive PM10ExhaustPM10732,871.5520732,871.552014.0467 13.4360 737,331.686146.4152 46.4152 46.4152 46.4152NaturalGasUnmitigated67.1799 610.7263 513.0101 3.6644732,871.5520732,871.552014.0467 13.4360 737,331.686146.4152 46.4152 46.4152 46.4152NaturalGasMitigated67.1799 610.7263 513.0101 3.6644NBio-CO2Total CO2 CH4 N2O CO2eCategory lb/daylb/dayExhaustPM10PM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO25.1 Mitigation Measures EnergyROG NOx CO SO2 Fugitive PM10 26.4547 26.4547 0.0682 27.88590.0435 0.0435 0.0435 0.0435Total 3,162.0255 0.1103 12.2715 9.2000e-00426.4547 26.4547 0.0682 27.88590.0435 0.0435 0.0435 0.0435Landscaping 1.1224 0.1103 12.2715 9.2000e-0040.0000 0.00000.0000 0.0000 0.0000 0.0000ConsumerProducts2,393.40420.0000 0.00000.0000 0.0000 0.0000 0.0000ArchitecturalCoating767.4989Total CO2 CH4 N2O CO2eSubCategory lb/daylb/dayPM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO2 NBio- CO26.2 Area by SubCategoryUnmitigatedROG NOx CO SO2 Fugitive PM10ExhaustPM1026.4547 26.4547 0.0682 27.88590.0435 0.0435 0.0435 0.0435Mitigated 3,162.0255 0.1103 12.2715 9.2000e-00426.4547 26.4547 0.0682 27.88590.0435 0.0435 0.0435 0.0435Unmitigated 3,162.0255 0.1103 12.2715 9.2000e-004NBio-CO2Total CO2 CH4 N2O CO2eCategory lb/daylb/dayExhaustPM10PM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO26.0 Area Detail6.1 Mitigation Measures AreaROG NOx CO SO2 Fugitive PM10 Hours/Day Days/Year Horse Power Load Factor Fuel Type10.0 Vegetation7.0 Water Detail7.1 Mitigation Measures Water8.0 Waste Detail8.1 Mitigation Measures Waste9.0 Operational OffroadEquipment Type Number26.4547 26.4547 0.0682 27.88590.0435 0.0435 0.0435 0.0435Total 3,162.0255 0.1103 12.2715 9.2000e-00426.4547 26.4547 0.0682 27.88590.0435 0.0435 0.0435 0.0435Landscaping 1.1224 0.1103 12.2715 9.2000e-0040.0000 0.00000.0000 0.0000 0.0000 0.0000ConsumerProducts2,393.40420.0000 0.00000.0000 0.0000 0.0000 0.0000ArchitecturalCoating767.4989Total CO2 CH4 N2O CO2eSubCategory lb/daylb/dayPM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO2 NBio- CO2MitigatedROG NOx CO SO2 Fugitive PM10ExhaustPM10 0.00 0.00 0.00 0.00 0.000.00 0.00 0.00 0.00 0.00 0.00PercentReduction0.00 0.00 0.00 0.00 0.00Bio- CO2 NBio-CO2 Total CO2 CH4 N20 CO2eFugitivePM10ExhaustPM10PM10TotalFugitivePM2.5ExhaustPM2.5PM2.5Total2.0 Emissions SummaryROG NOx CO SO2tblConstructionPhase NumDays 10,000.00 0.00tblProjectCharacteristics OperationalYear 2014 2035Table Name Column Name Default Value New Value1.3 User Entered Comments & Non-Default DataProject Characteristics - Land Use - acreageConstruction Phase - No construction proposed.CO2 Intensity (lb/MWhr)630.89CH4 Intensity (lb/MWhr)0.029N2O Intensity (lb/MWhr)0.00631Climate Zone12Operational Year2035Utility CompanySouthern California Edison1.2 Other Project CharacteristicsUrbanizationUrbanWind Speed (m/s)2.2Precipitation Freq (Days)PopulationGeneral Light Industry 120,879.00 1000sqft 2,775.00 120,879,000.00 01.1 Land UsageLand Uses Size Metric Lot Acreage Floor Surface AreaCalEEMod Version: CalEEMod.2013.2.2 Page 1 of 1 Date: 12/16/2013 3:06 PMCity of Vernon Supplemental EIR ProposedSouth Coast Air Basin, Annual1.0 Project Characteristics 0.00 0.00 0.00 0.01 0.12 0.000.00 0.00 0.00 0.00 0.00 0.00NBio-CO2 Total CO2 CH4 N20 CO2ePercentReduction0.00 0.00 0.00 0.00ExhaustPM10PM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO2ROG NOx CO SO2 Fugitive PM1039,294.58991,691,861.05381,731,155.64362,762.195828.6522 1,798,043.93921,070.298530.4486 1,100.7471286.6214 28.7491 315.3704Total 839.0207 878.8231 3,344.501116.83618,868.2826104,158.8852113,027.1678915.4793 22.4635 139,215.92860.0000 0.0000 0.0000 0.0000Water30,426.30730.0000 30,426.30731,798.14330.0000 68,187.31550.0000 0.0000 0.0000 0.0000Waste0.0000 1,049,535.67531,049,535.675327.0797 0.0000 1,050,104.34851,070.298521.9724 1,092.2708286.6214 20.2729 306.8942Mobile 249.7553 767.3518 3,249.342816.16730.0000 538,163.4934538,163.493421.4859 6.1887 540,533.18448.4708 8.4708 8.4708 8.4708Energy 12.2603 111.4576 93.6243 0.66880.0000 2.9999 2.9999 7.7300e-0030.0000 3.16225.4400e-0035.4400e-0035.4400e-0035.4400e-003Area 577.0051 0.0138 1.5339 1.2000e-004Total CO2 CH4 N2O CO2eCategory tons/yrMT/yrPM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO2NBio- CO2Mitigated OperationalROG NOx CO SO2 Fugitive PM10ExhaustPM1039,294.58991,691,861.05381,731,155.64362,762.362028.6866 1,798,058.08731,070.298530.4486 1,100.7471286.6214 28.7491 315.3704Total 839.0207 878.8231 3,344.501116.83618,868.2826104,158.8852113,027.1678915.6455 22.4979 139,230.07670.0000 0.0000 0.0000 0.0000Water30,426.30730.0000 30,426.30731,798.14330.0000 68,187.31550.0000 0.0000 0.0000 0.0000Waste0.0000 1,049,535.67531,049,535.675327.0797 0.0000 1,050,104.34851,070.298521.9724 1,092.2708286.6214 20.2729 306.8942Mobile 249.7553 767.3518 3,249.342816.16730.0000 538,163.4934538,163.493421.4859 6.1887 540,533.18448.4708 8.4708 8.4708 8.4708Energy 12.2603 111.4576 93.6243 0.66880.0000 2.9999 2.9999 7.7300e-0030.0000 3.16225.4400e-0035.4400e-0035.4400e-0035.4400e-003Area 577.0051 0.0138 1.5339 1.2000e-004CH4 N2O CO2eCategory tons/yrMT/yrFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO2 NBio- CO2 Total CO2Unmitigated OperationalROG NOx CO SO2 Fugitive PM10ExhaustPM10PM10Total2.2 Overall Operational 6.90 20.00 LD_Mix HDT_Mix HHDT3.1 Mitigation Measures ConstructionDemolition 6 15.00 0.00 0.00 14.70Worker Trip LengthVendor Trip LengthHauling Trip LengthWorker Vehicle ClassVendorVehicle ClassHaulingVehicle ClassTrips and VMTPhase Name Offroad Equipment CountWorker Trip NumberVendor Trip NumberHauling Trip NumberDemolition Rubber Tired Dozers 2 8.00 255 0.40Demolition Excavators 3 8.00 162 0.38Load FactorDemolition Concrete/Industrial Saws 1 8.00 81 0.73OffRoad EquipmentPhase Name Offroad Equipment Type Amount Usage Hours Horse Power0Acres of Grading (Site Preparation Phase): 0Acres of Grading (Grading Phase): 0Acres of Paving: 0Residential Indoor: 0; Residential Outdoor: 0; Non-Residential Indoor: 0; Non-Residential Outdoor: 0 (Architectural Coating – sqft)End Date Num Days WeekNum Days Phase Description1 Demolition Demolition 1/1/2014 12/31/2013 53.0 Construction DetailConstruction PhasePhaseNumberPhase Name Phase Type Start Date 0.0000 416,828.3888416,828.388819.1603 3.9642 418,459.65460.0000 0.0000 0.0000 0.0000ElectricityUnmitigated0.0000 416,828.3888416,828.388819.1603 3.9642 418,459.65460.0000 0.0000 0.0000 0.0000Electricity Mitigated0.0000 121,335.1046121,335.10462.3256 2.2245 122,073.52988.4708 8.4708 8.4708 8.4708NaturalGasUnmitigated12.2603 111.4576 93.6243 0.66880.0000 121,335.1046121,335.10462.3256 2.2245 122,073.52988.4708 8.4708 8.4708 8.4708NaturalGasMitigated12.2603 111.4576 93.6243 0.6688NBio- CO2 Total CO2 CH4 N2O CO2eCategory tons/yrMT/yrExhaustPM10PM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO24.4 Fleet MixHistorical Energy Use: N5.1 Mitigation Measures EnergyROG NOx CO SO2 Fugitive PM100.002183 0.002612 0.003879 0.000535 0.0035215.0 Energy DetailSBUS MH0.475956 0.062534 0.188657 0.147142 0.045607 0.007258 0.017370 0.042746LHD2 MHD HHD OBUS UBUS MCY28.00 13.00 92 5 3LDA LDT1 LDT2 MDV LHD1H-S or C-C H-O or C-NW Primary Diverted Pass-byGeneral Light Industry 16.60 8.40 6.90 59.004.3 Trip Type InformationMiles Trip % Trip Purpose %Land Use H-W or C-W H-S or C-C H-O or C-NW H-W or C-WTotal 842,526.63 159,560.28 82,197.72 2,817,897,152 2,817,897,152Annual VMTGeneral Light Industry 842,526.63 159,560.28 82197.72 2,817,897,1522,817,897,1524.2 Trip Summary InformationAverage Daily Trip Rate Unmitigated MitigatedLand Use Weekday Saturday Sunday Annual VMT0.0000 1,049,535.67531,049,535.675327.0797 0.0000 1,050,104.34851,070.298521.9724 1,092.2708286.6214 20.2729 306.8942Unmitigated 249.7553 767.3518 3,249.342816.16730.0000 1,049,535.67531,049,535.675327.0797 0.0000 1,050,104.34851,070.298521.9724 1,092.2708286.6214 20.2729 306.8942Mitigated 249.7553 767.3518 3,249.342816.1673NBio- CO2 Total CO2 CH4 N2O CO2eCategory tons/yrMT/yrExhaustPM10PM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO24.0 Operational Detail - Mobile4.1 Mitigation Measures MobileROG NOx CO SO2 Fugitive PM10 418,459.6546Total 416,828.388819.1603 3.9642 418,459.6546Land Use kWh/yrtonMT/yrGeneral Light Industry1.45659e+009416,828.388819.1603 3.9642MitigatedElectricityUseTotal CO2 CH4 N2O CO2e418,459.6546Total 416,828.388819.1603 3.9642 418,459.6546Land Use kWh/yrtonMT/yrGeneral Light Industry1.45659e+009416,828.388819.1603 3.9642UnmitigatedElectricityUseTotal CO2 CH4 N2O CO2e121,335.1046121,335.10462.3256 2.2245 122,073.52985.3 Energy by Land Use - Electricity8.4708 8.4708 8.4708 8.4708 0.00002.2245 122,073.5298Total 12.2603 111.4576 93.6243 0.66888.4708 8.4708 0.0000 121,335.1046121,335.10462.325693.6243 0.6688 8.4708 8.4708CO2eLand Use kBTU/yr tons/yrMT/yrGeneral Light Industry2.27373e+00912.2603 111.4576PM2.5TotalBio- CO2 NBio- CO2 Total CO2 CH4 N2OSO2 Fugitive PM10ExhaustPM10PM10TotalFugitivePM2.5ExhaustPM2.5NaturalGas UseROG NOx CO121,335.10462.3256 2.2245 122,073.5298Mitigated8.4708 8.4708 8.4708 0.0000 121,335.1046122,073.5298Total 12.2603 111.4576 93.6243 0.6688 8.47088.4708 0.0000 121,335.1046121,335.10462.3256 2.22450.6688 8.4708 8.4708 8.4708General Light Industry2.27373e+00912.2603 111.4576 93.6243NBio- CO2 Total CO2 CH4 N2O CO2eLand Use kBTU/yr tons/yrMT/yrExhaustPM10PM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO25.2 Energy by Land Use - NaturalGasUnmitigatedNaturalGas UseROG NOx CO SO2 Fugitive PM10 0.0000 2.9999 2.9999 7.7300e-0030.0000 3.16225.4400e-0035.4400e-0035.4400e-0035.4400e-003Total 577.0051 0.0138 1.5339 1.2000e-0040.0000 2.9999 2.9999 7.7300e-0030.0000 3.16225.4400e-0035.4400e-0035.4400e-0035.4400e-003Landscaping 0.1403 0.0138 1.5339 1.2000e-0040.0000 0.0000 0.0000 0.0000 0.0000 0.00000.0000 0.0000 0.0000 0.0000ConsumerProducts436.79630.0000 0.0000 0.0000 0.0000 0.0000 0.00000.0000 0.0000 0.0000 0.0000ArchitecturalCoating140.0685Total CO2 CH4 N2O CO2eSubCategory tons/yrMT/yrPM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO2 NBio- CO2MitigatedROG NOx CO SO2 Fugitive PM10ExhaustPM100.0000 2.9999 2.9999 7.7300e-0030.0000 3.16225.4400e-0035.4400e-0035.4400e-0035.4400e-003Total 577.0051 0.0138 1.5339 1.2000e-0040.0000 2.9999 2.9999 7.7300e-0030.0000 3.16225.4400e-0035.4400e-0035.4400e-0035.4400e-003Landscaping 0.1403 0.0138 1.5339 1.2000e-0040.0000 0.0000 0.0000 0.0000 0.0000 0.00000.0000 0.0000 0.0000 0.0000ConsumerProducts436.79630.0000 0.0000 0.0000 0.0000 0.0000 0.00000.0000 0.0000 0.0000 0.0000ArchitecturalCoating140.0685Total CO2 CH4 N2O CO2eSubCategory tons/yrMT/yrPM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO2 NBio- CO26.2 Area by SubCategoryUnmitigatedROG NOx CO SO2 Fugitive PM10ExhaustPM100.0000 2.9999 2.9999 7.7300e-0030.0000 3.16225.4400e-0035.4400e-0035.4400e-0035.4400e-003Unmitigated 577.0051 0.0138 1.5339 1.2000e-0040.0000 2.9999 2.9999 7.7300e-0030.0000 3.16225.4400e-0035.4400e-0035.4400e-0035.4400e-003Mitigated 577.0051 0.0138 1.5339 1.2000e-004NBio- CO2 Total CO2 CH4 N2O CO2eCategory tons/yrMT/yrExhaustPM10PM10TotalFugitivePM2.5ExhaustPM2.5PM2.5TotalBio- CO26.0 Area Detail6.1 Mitigation Measures AreaROG NOx CO SO2 Fugitive PM10 139,215.9286Total 113,027.1678915.4793 22.4635 139,215.9286Land Use MgaltonMT/yrGeneral Light Industry27953.3 / 0 113,027.1678915.4793 22.4635MitigatedIndoor/Outdoor UseTotal CO2 CH4 N2O CO2e139,230.0767Total 113,027.1678915.6455 22.4979 139,230.0767Land Use MgaltonMT/yrGeneral Light Industry27953.3 / 0 113,027.1678915.6455 22.49797.2 Water by Land UseUnmitigatedIndoor/Outdoor UseTotal CO2 CH4 N2O CO2eMitigated 113,027.1678915.4793 22.4635 139,215.9286CategorytonMT/yrUnmitigated 113,027.1678915.6455 22.4979 139,230.07677.0 Water Detail7.1 Mitigation Measures WaterTotal CO2 CH4 N2O CO2e Load Factor Fuel Type10.0 Vegetation9.0 Operational OffroadEquipment Type Number Hours/Day Days/Year Horse Power68,187.3155Total 30,426.30731,798.14330.0000 68,187.3155Land Use tonstonMT/yrGeneral Light Industry149890 30,426.30731,798.14330.0000MitigatedWasteDisposedTotal CO2 CH4 N2O CO2e68,187.3155Total 30,426.30731,798.14330.0000 68,187.3155Land Use tonstonMT/yrGeneral Light Industry149890 30,426.30731,798.14330.00008.2 Waste by Land UseUnmitigatedWasteDisposedTotal CO2 CH4 N2O CO2e Unmitigated 30,426.30731,798.1433 0.0000 68,187.3155tonMT/yr Mitigated 30,426.30731,798.1433 0.0000 68,187.31558.0 Waste Detail8.1 Mitigation Measures WasteCategory/YearTotal CO2 CH4 N2O CO2e CITY OF VERNON GENERAL PLAN UPDATE TRAFFIC IMPACT ANALYSIS December 11, 2012 KKuunnzzmmaann AAssssoocciiaatteess,, IInncc.. CITYOFVERNONGENERALPLANUPDATE TRAFFICIMPACTANALYSIS December11,2012 Preparedby: AmyL.Kim,EIT, RobertKunzman, CarlBallard,LEEDGA,and WilliamKunzman,P.E. 1111Town&CountryRoad,Suite34 Orange,California92868 (714)973Ͳ8383 www.trafficͲengineer.com 5031 TableofContents I.IntroductionandSummary................................................................................................1 A.PurposeofReportandStudyObjectives..................................................................1 B.StudyArea..............................................................................................................1 C.DefinitionofDeficiencyandSignificantImpact........................................................2 D.PrincipalFindings....................................................................................................2 II.ExistingTrafficConditions.................................................................................................5 A.ExistingTravelLanesandIntersectionControls.......................................................5 B.ExistingAverageDailyTrafficVolumes....................................................................5 C.TruckPassengerCarEquivalents.............................................................................5 D.ExistingIntersectionCapacityUtilizationandLevelofService.................................5 E.PlannedTransportationImprovementsandRelationshiptoGeneralPlan...............6 III.CurrentGeneralPlanYear2035TrafficConditions...........................................................15 A.MethodofProjection............................................................................................15 B.CurrentGeneralPlanYear2035AverageDailyTrafficVolumes.............................15 C.CurrentGeneralPlanYear2035IntersectionCapacityUtilizationandLevelof Service..................................................................................................................15 IV.ProposedGeneralPlanYear2035TrafficConditions.......................................................20 A.MethodofProjection............................................................................................20 B.PotentialDevelopment.........................................................................................20 1.PotentialDevelopmentLocations......................................................................20 2.TripGeneration..................................................................................................20 3.TripDistribution..................................................................................................20 4.TripAssignment..................................................................................................21 C.ProposedGeneralPlanYear2035AverageDailyTrafficVolumes.........................21 D.ProposedGeneralPlanYear2035IntersectionCapacityUtilizationandLevelof Service..................................................................................................................21 E.SignificantImpact..................................................................................................21 V.Conclusions.....................................................................................................................45 APPENDICES AppendixA–GlossaryofTransportationTerms AppendixB–TrafficCountWorksheets AppendixC–TruckPercentageCalculations AppendixD–ExplanationandCalculationofIntersectionCapacityUtilization ListofTables Table1.ExistingIntersectionCapacityUtilizationandLevelofService.......................................7 Table2.CurrentGeneralPlanYear2035IntersectionCapacityUtilizationandLevelof Service...........................................................................................................................16 Table3.PotentialProposedDevelopmentTripGeneration.......................................................22 Table4.ProposedGeneralPlanYear2035IntersectionCapacityUtilizationandLevelof Service...........................................................................................................................23 Table5.ProposedGeneralPlanYear2035IntersectionCapacityUtilizationandLevelof Service...........................................................................................................................24 ListofFigures Figure1.LocationMap...................................................................................................................4 Figure2.ExistingThroughTravelLanesandIntersectionControls...............................................8 Figure3.ExistingIntersectionGeometrics....................................................................................9 Figure4.ExistingAverageDailyTrafficVolumes.........................................................................10 Figure5.ExistingMorningPeakHourIntersectionTurningMovementVolumes......................11 Figure6.ExistingEveningPeakHourIntersectionTurningMovementVolumes........................12 Figure7.CityofVernonGeneralPlanCirculationElement.........................................................13 Figure8.CityofVernonGeneralPlanRoadwayCrossͲSections..................................................14 Figure9.CurrentGeneralPlanYear2035AverageDailyTrafficVolumes..................................17 Figure10.CurrentGeneralPlanYear2035MorningPeakHourIntersectionTurning MovementVolumes......................................................................................................18 Figure11.CurrentGeneralPlanYear2035EveningPeakHourIntersectionTurning MovementVolumes......................................................................................................19 Figure12.PotentialDevelopmentSiteLocationMap...................................................................25 Figure13.PotentialDevelopmentNumber1TripDistribution.....................................................26 Figure14.PotentialDevelopmentNumber2TripDistribution.....................................................27 Figure15.PotentialDevelopmentNumber3TripDistribution.....................................................28 Figure16.PotentialDevelopmentNumber4TripDistribution.....................................................29 Figure17.PotentialDevelopmentNumber5TripDistribution.....................................................30 Figure18.PotentialDevelopmentNumber6TripDistribution.....................................................31 Figure19.PotentialDevelopmentNumber7TripDistribution.....................................................32 Figure20.PotentialDevelopmentNumber8TripDistribution.....................................................33 Figure21.PotentialDevelopmentNumber9TripDistribution.....................................................34 Figure22.PotentialDevelopmentNumber10TripDistribution...................................................35 Figure23.PotentialDevelopmentNumber11TripDistribution...................................................36 Figure24.PotentialDevelopmentNumber12TripDistribution...................................................37 Figure25.PotentialDevelopmentNumber13TripDistribution...................................................38 Figure26.PotentialDevelopmentAverageDailyTrafficVolumes................................................39 Figure27.PotentialDevelopmentMorningPeakHourIntersectionTurningMovement Volumes........................................................................................................................40 Figure28.PotentialDevelopmentEveningPeakHourIntersectionTurningMovement Volumes........................................................................................................................41 Figure29.ProposedGeneralPlanYear2035AverageDailyTrafficVolumes...............................42 Figure30.ProposedGeneralPlanYear2035MorningPeakHourIntersectionTurning MovementVolumes......................................................................................................43 Figure31.ProposedGeneralPlanYear2035EveningPeakHourIntersectionTurning MovementVolumes......................................................................................................44 I.IntroductionandSummary A.PurposeofReportandStudyObjectives Thepurposeofthisreportistoprovideanassessmentofthetrafficimpactsresultingfrom proposedresidentialandtruckingoverlaydistrictsintheCityofVernon,andtoidentifythe trafficmitigationmeasuresnecessarytomaintaintheestablishedLevelofServicestandard fortheelementsoftheimpactedroadwaysystem.Thetrafficissuesrelatedtothe proposedlandusesanddevelopmenthavebeenevaluatedinthecontextoftheCalifornia EnvironmentalQualityAct. TheCityofVernonistheleadagencyresponsibleforpreparationofthetrafficimpact analysis,inaccordancewiththeCaliforniaEnvironmentalQualityActauthorizinglegislation. ThisreportanalyzestrafficimpactsfortheExistingandYear2035trafficconditions. Althoughthisisatechnicalreport,everyefforthasbeenmadetowritethereportclearly andconcisely.Toassistthereaderwiththosetermsuniquetotransportationengineering, aglossaryoftermsisprovidedinAppendixA. B.StudyArea Thestudyareaintersectionsweredeterminedbyselectingtheintersectionsthatare projectedtooperateatunacceptableLevelsofServiceinthe2007CirculationPlanUpdate fortheCityofVernon(seeFigure1): AlamedaStreet(NS)at: VernonAvenue(EW)Ͳ#1 55thStreet(EW)Ͳ#2 SantaFeAvenue(NS)at: 25th/26thStreet(EW)Ͳ#3 38thStreet(EW)Ͳ#4 VernonAvenue(EW)Ͳ#5 VernonAvenue/PacificBoulevard(EW)Ͳ#6 SotoStreet(NS)at: 26thStreet(EW)Ͳ#7 BandiniBoulevard(EW)Ͳ#8 VernonAvenue(EW)Ͳ#9 LeonisBoulevard(EW)Ͳ#10 FruitlandAvenue(EW)Ͳ#11 BoyleAvenue(NS)at: SlausonAvenue(EW)Ͳ#12 2 DowneyRoad(NS)at: WashingtonBoulevard(EW)Ͳ#13 BandiniBoulevard(EW)Ͳ#14 SlausonAvenue(EW)Ͳ#15 AtlanticBoulevard(NS)at: BandiniBoulevard(EW)Ͳ#16 DistrictBoulevard(EW)Ͳ#17 C.DefinitionofDeficiencyandSignificantImpact TheCityofVernonhasanestablishedacceptableLevelofServiceofD.LevelofServiceE andFareunacceptable. BasedontheLosAngelesDepartmentofTransportationPoliciesandProcedures,animpact isconsideredsignificantiftheprojectͲrelatedincreaseinthevolumeͲtoͲcapacityratio equalsorexceedsthethresholdsshownbelow: SignificantImpactThresholdforIntersections LevelofServiceVolume/CapacityIncrementalIncrease C0.70Ͳ0.790.04ormore D0.80Ͳ0.890.02ormore E/F0.90Ͳmore0.01ormore D.PrincipalFindings ExistingLevelofService:ForExistingtrafficconditions,thestudyareaintersections currentlyoperatewithinacceptableLevelsofServiceduringthepeakhours,exceptforthe followingstudyareaintersectionsthatoperateatLevelsofServiceEtoFduringthepeak hours(seeTable1): AlamedaStreet(NS)at: VernonAvenue(EW)Ͳ#1 55thStreet(EW)Ͳ#2 SantaFeAvenue(NS)at: 25th/26thStreet(EW)Ͳ#3 38thStreet(EW)Ͳ#4 VernonAvenue(EW)Ͳ#5 VernonAvenue/PacificBoulevard(EW)Ͳ#6 SotoStreet(NS)at: 26thStreet(EW)Ͳ#7 BandiniBoulevard(EW)Ͳ#8 VernonAvenue(EW)Ͳ#9 3 BoyleAvenue(NS)at: SlausonAvenue(EW)Ͳ#12 DowneyRoad(NS)at: WashingtonBoulevard(EW)Ͳ#13 BandiniBoulevard(EW)Ͳ#14 SlausonAvenue(EW)Ͳ#15 AtlanticBoulevard(NS)at: BandiniBoulevard(EW)Ͳ#16 DistrictBoulevard(EW)Ͳ#17 CurrentGeneralPlanYear2035LevelofService:FortheCurrentGeneralPlanYear2035 trafficconditions,thestudyareaintersectionsareprojectedtooperateatLevelofServiceE toFduringthepeakhours,withoutimprovements(seeTable2). Allpotentialdevelopmentswithintheproposedhousingandtruckingoverlaydistrictshave beenindividuallyaccountedforbyanappropriatetripgenerationandtripdistribution. ProposedGeneralPlanYear2035LevelofService:FortheProposedGeneralPlanYear 2035trafficconditions,thestudyareaintersectionsareprojectedtooperateatLevelof ServiceEtoFduringthepeakhours,withoutimprovements(seeTable4). Table5depictstheProposedGeneralPlanYear2035trafficconditionsatthestudyarea intersections.Thestudyareaintersectionsarenotsignificantlyimpactedbytheproposed housingandtruckingoverlaydistricts. 5 II.ExistingTrafficConditions ThetrafficconditionsastheyexisttodayarediscussedbelowandillustratedonFigures2to8. A.ExistingTravelLanesandIntersectionControls Figures2and3identifytheexistingroadwayconditionswithintheCityofVernon.The numberofthroughtravellanesandintersectioncontrolsforexistingroadwaysare illustratedonFigure2andtheexistingintersectiongeometriesareidentifiedonFigure3. B.ExistingAverageDailyTrafficVolumes Figure4depicttheexistingaveragedailytrafficvolumesinthestudyarea.Existingmanual morningandeveningpeakhourintersectionturningmovementcountshavebeenobtained byKunzmanAssociates,Inc.inFebruaryandOctober2012(seeAppendixB).Theexisting averagedailytrafficvolumeshavebeenobtainedfrompeakhourcountsusingthefollowing formulaforeachintersectionleg: PMPeakHour(ApproachVolume+ExitVolume)x11.0=LegVolume. C.TruckPassengerCarEquivalents Toaccountforthenumberoftrucksthatareincludedinthetrafficcounts,atruckfactor hasbeendeveloped.Fourvehicleclassificationspotcountshavebeenconductedto calculatethepercentageofthevehiclemixthataretrucks.Thetruckpercentage calculationshowsthattherearecurrently22percenttrucksontheCityofVernonStreets (seeAppendixC).PertheCityofVernon,aPassengerCarEquivalentof2.5hasbeenused onthe22percenttrucks(seeAppendixC).Atruckfactorof1.33hasbeenappliedto accountforthecalculated22percenttrucksonthestudyarearoadways((1.00–0.22)+ (0.22X2.5)=1.33). D.ExistingIntersectionCapacityUtilizationandLevelofService ThetechniqueusedtoassessthecapacityneedsofanintersectionisknownasIntersection CapacityUtilization(seeAppendixD).TocalculateIntersectionCapacityUtilization,the volumeoftrafficusingtheintersectioniscomparedwiththecapacityoftheintersection. TheexistingIntersectionCapacityUtilizationandLevelofServiceforthestudyarea intersectionsareshowninTable1.ExistingIntersectionCapacityUtilizationisbasedupon manualmorningandeveningpeakhourintersectionturningmovementcountsobtainedby KunzmanAssociates,Inc.inFebruaryandOctober2012.Thefactoredtrafficcountsare presentedonFigures5and6. Therearetwopeakhoursinaweekday.Themorningpeakhourisbetween7:00AMand 9:00AM,andtheeveningpeakhourisbetween4:00PMand6:00PM.Theactualpeak hourwithinthetwohourintervalisthefourconsecutive15minuteperiodswiththehighest 6 totalvolumewhenallmovementsareaddedtogether.Thus,theeveningpeakhouratone intersectionmaybe4:45PMto5:45PMifthosefourconsecutive15minuteperiodshave thehighestcombinedvolume. ForExistingtrafficconditions,thestudyareaintersectionscurrentlyoperatewithin acceptableLevelsofServiceduringthepeakhours,exceptforthefollowingstudyarea intersectionsthatoperateatLevelsofServiceEtoFduringthepeakhours(seeTable1): AlamedaStreet(NS)at: VernonAvenue(EW)Ͳ#1 55thStreet(EW)Ͳ#2 SantaFeAvenue(NS)at: 25th/26thStreet(EW)Ͳ#3 38thStreet(EW)Ͳ#4 VernonAvenue(EW)Ͳ#5 VernonAvenue/PacificBoulevard(EW)Ͳ#6 SotoStreet(NS)at: 26thStreet(EW)Ͳ#7 BandiniBoulevard(EW)Ͳ#8 VernonAvenue(EW)Ͳ#9 BoyleAvenue(NS)at: SlausonAvenue(EW)Ͳ#12 DowneyRoad(NS)at: WashingtonBoulevard(EW)Ͳ#13 BandiniBoulevard(EW)Ͳ#14 SlausonAvenue(EW)Ͳ#15 AtlanticBoulevard(NS)at: BandiniBoulevard(EW)Ͳ#16 DistrictBoulevard(EW)Ͳ#17 ExistingdelayworksheetsareprovidedinAppendixD. E.PlannedTransportationImprovementsandRelationshiptoGeneralPlan TheCityofVernonGeneralPlanCirculationElementisshownonFigure7.Existingand futureroadwaysareincludedintheCirculationElementoftheGeneralPlanandare graphicallydepictedonFigure7.Thisfigureshowsthenatureandextentofarterial highwaysthatareneededtoadequatelyservetheultimatedevelopmentdepictedbythe LandUseElementoftheGeneralPlan.TheCityofVernonGeneralPlanroadwaycrossͲ sectionsisshownonFigure8. Control3 LTRLTRLTRLTRMorningEvening AlamedaStreet(NS)at: VernonAvenueͲWest(EW)Ͳ#1a TS 1 1.5 0.5 1 1.5 0.5 0.5 1 0.5 0.5 1 0.5 1.454ͲF 1.502ͲF VernonAvenueͲEast(EW)Ͳ#1b TS 0100100.510.50.51.511.334ͲF 1.097ͲF 55thStreetͲWest(EW)Ͳ#2a TS 1 1.5 0.5 1 1.5 0.5 0.5 0.5 d 0 1 0 1.186ͲF 1.521ͲF 55thStreetͲEast(EW)Ͳ#2b TS 0100100100.50.5d0.891ͲD 0.735ͲC SantaFeAvenue(NS)at: 25th/26thStreet(EW)Ͳ#3 TS 1 2 1>> 1 2 1>> 1 1 d 1 0.5 0.5 1.040ͲF 1.014ͲF 38thStreet(EW)Ͳ#4 TS 1 1.5 0.5 1 1.5 0.5 0.5 0.5 d 0 0 0 0.956ͲE 1.011ͲF VernonAvenue(EW)Ͳ#5 TS 1 1.5 0.5 1 1.5 0.5 0 1 0 0.5 1 0.5 0.972ͲE 0.923ͲE VernonAvenue/PacificBoulevard(EW)Ͳ#6 TS 1 1.5 0.5 1 1.5 0.5 1 2.5 0.5 1 2 2 0.919ͲE 0.957ͲE SotoStreet(NS)at: 26thStreet(EW)Ͳ#7 TS 121>>12110.50.510.50.51.009ͲF 1.181ͲF BandiniBoulevard(EW)Ͳ#8 TS 1 1.5 0.5 1 1.5 0.5 1 2.5 0.5 1 2.5 0.5 0.951ͲE 1.003ͲF VernonAvenue(EW)Ͳ#9 TS 1 1.5 0.5 1 1.5 0.5 0.5 1 0.5 0.5 1 0.5 0.861ͲD 0.948ͲE LeonisBoulevard(EW)Ͳ#10 TS 1 1.5 0.5 1 1.5 0.5 1 1.5 0.5 1 1.5 0.5 0.876ͲD 0.814ͲD FruitlandAvenue(EW)Ͳ#11 TS 1 1.5 0.5 1 1.5 0.5 1 0.5 0.5 1 0.5 0.5 0.806ͲD 0.879ͲD BoyleAvenue(NS)at: SlausonAvenue(EW)Ͳ#12 TS 1 1.5 0.5 1 1.5 0.5 1 1.5 0.5 1 1.5 0.5 1.081ͲF 1.202ͲF DowneyRoad(NS)at: WashingtonBoulevard(EW)Ͳ#13 TS 121121121>12d0.868ͲD 0.920ͲE BandiniBoulevard(EW)Ͳ#14 TS 12112112121.50.50.902ͲE .942ͲE SlausonAvenue(EW)Ͳ#15 TS 11110.50.511.50.50.510.50.974ͲE 0.970ͲE AtlanticBoulevard(NS)at: BandiniBoulevard(EW)Ͳ#16 TS 14113.51.5>>1.520.5112>>1.543ͲF 1.433ͲF DistrictBoulevard(EW)Ͳ#17 TS 1 2.5 0.5 1 3 1>> 2 1 1 0.5 1.5 1>> 0.858ͲD 0.975ͲE 1 2 3 TS=TrafficSignal Whenarightturnlaneisdesignated,thelanecaneitherbestripedorunstriped.Tofunctionasarightturnlanetheremustbesufficientwidthforrightturningvehiclestotravel outsidethethroughlanes.L=Left;T=Through;R=Right;d=DefactoTurnLane;>=RightTurnOverlap;>>=FreeRightTurn ICUͲLOS=IntersectionCapacityUtilizationͲLevelofService Eastbound Westbound ICUͲLOS2 Table1 ExistingIntersectionCapacityUtilizationandLevelofService Intersection Traffic IntersectionApproachLanes1 PeakHour Northbound Southbound 7 15 III.CurrentGeneralPlanYear2035TrafficConditions Inthissection,CurrentGeneralPlanYear2035trafficconditionsarediscussed.Figures9and11 illustratetheCurrentGeneralPlanYear2035trafficconditions. A. MethodofProjection Baseduponthe2007CityofVernonGeneralPlanUpdated,anambientannualgrowth rateof0.5percentisusedinthisanalysis.Thisproducesagrowthfactorof1.12for Year2035conditions. B.CurrentGeneralPlanYear2035AverageDailyTrafficVolumes CurrentGeneralPlanYear2035averagedailytrafficvolumesaredepictedonFigure9. C.CurrentGeneralPlanYear2035IntersectionCapacityUtilizationandLevelofService Thetechniqueusedtoassessthecapacityneedsofanintersectionisknownas IntersectionCapacityUtilization(seeAppendixD).TocalculateIntersectionCapacity Utilization,thevolumeoftrafficusingtheintersectioniscomparedwiththecapacityof theintersection. TheCurrentGeneralPlanYear2035morningandeveningpeakhourturningmovement volumesareprovidedonFigures10and11,respectively. FortheCurrentGeneralPlanYear2035trafficconditions,thestudyareaintersections areprojectedtooperateatLevelofServiceEtoFduringthepeakhours,without improvements(seeTable2).CurrentGeneralPlanYear2035IntersectionCapacity UtilizationworksheetsareprovidedinAppendixD. Control3 LTRLTRLTRLTRMorningEvening AlamedaStreet(NS)at: VernonAvenueͲWest(EW)Ͳ#1a TS 1 1.5 0.5 1 1.5 0.5 0.5 1 0.5 0.5 1 0.5 1.617ͲF 1.671ͲF VernonAvenueͲEast(EW)Ͳ#1b TS 0100100.510.50.51.511.217ͲF 1.317ͲF 55thStreetͲWest(EW)Ͳ#2a TS 1 1.5 0.5 1 1.5 0.5 0.5 0.5 d 0 1 0 1.482ͲF 1.692ͲF 55thStreetͲEast(EW)Ͳ#2b TS 0100100100.50.5d0.811ͲD 1.153ͲF SantaFeAvenue(NS)at: 25th/26thStreet(EW)Ͳ#3 TS 1 2 1>> 1 2 1>> 1 1 d 1 0.5 0.5 0.986ͲE 1.124ͲF 38thStreet(EW)Ͳ#4 TS 1 1.5 0.5 1 1.5 0.5 0.5 0.5 d 0 0 0 1.059ͲF 1.121ͲF VernonAvenue(EW)Ͳ#5 TS 1 1.5 0.5 1 1.5 0.5 0 1 0 0.5 1 0.5 1.077ͲF 1.022ͲF VernonAvenue/PacificBoulevard(EW)Ͳ#6 TS 1 1.5 0.5 1 1.5 0.5 1 2.5 0.5 1 2 2 1.017ͲF 1.061ͲF SotoStreet(NS)at: 26thStreet(EW)Ͳ#7 TS 121>>12110.50.510.50.51.118ͲF 1.311ͲF BandiniBoulevard(EW)Ͳ#8 TS 1 1.5 0.5 1 1.5 0.5 1 2.5 0.5 1 2.5 0.5 1.053ͲF 1.111ͲF VernonAvenue(EW)Ͳ#9 TS 1 1.5 0.5 1 1.5 0.5 0.5 1 0.5 0.5 1 0.5 0.953ͲE 1.050ͲF LeonisBoulevard(EW)Ͳ#10 TS 1 1.5 0.5 1 1.5 0.5 1 1.5 0.5 1 1.5 0.5 0.960ͲE 0.899ͲD FruitlandAvenue(EW)Ͳ#11 TS 1 1.5 0.5 1 1.5 0.5 1 0.5 0.5 1 0.5 0.5 0.891ͲD 0.973ͲE BoyleAvenue(NS)at: SlausonAvenue(EW)Ͳ#12 TS 1 1.5 0.5 1 1.5 0.5 1 1.5 0.5 1 1.5 0.5 1.199ͲF 1.353ͲF DowneyRoad(NS)at: WashingtonBoulevard(EW)Ͳ#13 TS 121121121>12d0.960ͲE 1.019ͲF BandiniBoulevard(EW)Ͳ#14 TS 12112112121.50.50.998ͲE 1.043ͲF SlausonAvenue(EW)Ͳ#15 TS 11110.50.511.50.50.510.51.079ͲF 1.075ͲF AtlanticBoulevard(NS)at: BandiniBoulevard(EW)Ͳ#16 TS 14113.51.5>>1.520.5112>>1.717ͲF 1.594ͲF DistrictBoulevard(EW)Ͳ#17 TS 1 2.5 0.5 1 3 1>> 2 1 1 0.5 1.5 1>> 0.949ͲE 1.081ͲF 1 2 3 Whenarightturnlaneisdesignated,thelanecaneitherbestripedorunstriped.Tofunctionasarightturnlanetheremustbesufficientwidthforrightturningvehiclestotravel outsidethethroughlanes.L=Left;T=Through;R=Right;d=DefactoTurnLane;>=RightTurnOverlap;>>=FreeRightTurn ICUͲLOS=IntersectionCapacityUtilizationͲLevelofService TS=TrafficSignal Table2 CurrentGeneralPlanYear2035IntersectionCapacityUtilizationandLevelofService Intersection Traffic IntersectionApproachLanes1 PeakHour Northbound Southbound Eastbound Westbound ICUͲLOS2 16 20 IV.ProposedGeneralPlanYear2035TrafficConditions Inthissection,ProposedGeneralPlanYear2035trafficconditionsarediscussed.Figures12and 31illustratetheCurrentGeneralPlanYear2035trafficconditions. A.MethodofProjection Baseduponthe2007CityofVernonGeneralPlanUpdate,anambientannualgrowth rateof0.5percentisusedinthisanalysis.Thisproducesagrowthfactorof1.12for Year2035conditions. Thepotentialdevelopmenttripgenerationandtripdistributionarethenappliedto analyzetheProposedGeneralPlan. B.PotentialDevelopment 1. PotentialDevelopmentLocations TheCityofVernonhasprovidedthepotentiallocationsforresidential developments,industrialdevelopments,andanemergencyshelterwithinthe residentialandtruckingoverlaydistricts.Figure12providesthelocationofeach potentialdevelopmentsite. 2. TripGeneration Thetripsgeneratedbythepotentialdevelopmentisdeterminedbymultiplyingan appropriatetripgenerationratebythequantityoflanduse.Tripgenerationrates arepredicatedontheassumptionthatenergycosts,theavailabilityofroadway capacity,theavailabilityofvehiclestodrive,andourlifestylesremainsimilarto whatweknowtoday.Amajorchangeinthesevariablesmayaffecttrip generationrates. Tripgenerationratesweredeterminedfordailytrafficandmorningpeakhour inboundandoutboundtraffic,andeveningpeakhourinboundandoutbound trafficfortheproposedlanduses.Bymultiplyingthetripgenerationratesbythe landusequantities,thetrafficvolumesaredetermined.Thedifferenceinvehicle tripsbetweenthepreviouslyproposedlandusesandtheproposedlandusesare usedasthetripgenerationforeachpotentialdevelopmentsite.Table3shows thetripgenerationbaseduponratesobtainedfromtheInstituteof TransportationEngineers,TripGeneration,9thEdition,2012. 3. TripDistribution Todeterminethetripdistributionforthepotentialdevelopments,peakhour trafficcountsoftheexistingdirectionaldistributionoftrafficforexistingareasin thevicinityofthesite,andotheradditionalinformationonfuturedevelopment 21 andtrafficimpactsintheareawerereviewed.Thetripdistributionsforthe potentialdevelopmentsareprovidedonFigures13to25. 4. TripAssignment Basedontheidentifiedtripgenerationanddistributions,potentialdevelopment averagedailytrafficvolumeshavebeencalculatedandshownonFigure26. Morningandeveningpeakhourintersectionturningmovementvolumes expectedfromthepotentialdevelopmentsareshownonFigures27and28, respectively. C.ProposedGeneralPlanYear2035AverageDailyTrafficVolumes ProposedGeneralPlanYear2035averagedailytrafficvolumesaredepictedonFigure 29. D.ProposedGeneralPlanYear2035IntersectionCapacityUtilizationandLevelofService Thetechniqueusedtoassessthecapacityneedsofanintersectionisknownas IntersectionCapacityUtilization(seeAppendixD).TocalculateIntersectionCapacity Utilization,thevolumeoftrafficusingtheintersectioniscomparedwiththecapacityof theintersection. TheProposedGeneralPlanYear2035morningandeveningpeakhourturning movementvolumesareprovidedinFigures30and31,respectively. FortheProposedGeneralPlanYear2035trafficconditions,thestudyareaintersections areprojectedtooperateatLevelofServiceEtoFduringthepeakhours,without improvements(seeTable4).ProposedGeneralPlanYear2035IntersectionCapacity UtilizationworksheetsareprovidedinAppendixD. E.SignificantImpact BasedontheLosAngelesDepartmentofTransportationPoliciesandProcedures,an impactisconsideredsignificantiftheprojectͲrelatedincreaseinthevolumeͲtoͲcapacity ratioequalsorexceedsthethresholdsshownbelow: SignificantImpactThresholdforIntersections LevelofServiceVolume/CapacityIncrementalIncrease C0.70Ͳ0.790.04ormore D0.80Ͳ0.890.02ormore Table5depictstheProposedGeneralPlanYear2035trafficconditionsatthestudyarea intersections.Thestudyareaintersectionsarenotsignificantlyimpactedbythe proposedhousingandtruckingoverlaydistricts. Inbound Outbound Total Inbound Outbound Total TripGenerationRates Warehousing AC 7.22 2.81 10.03 3.04 5.65 8.69 57.23 Manufacturing AC 6.92 0.52 7.44 4.43 3.92 8.35 38.80 EmergencyShelter3 Site 1.00 1.00 2.00 1.00 1.00 2.00 10.00 Apartments DU 0.1 0.41 0.51 0.4 0.22 0.62 6.65 TripsGenerated Warehousing 2.7 AC 19 8 27 8 15 23 155 Manufacturing 2.7 AC Ͳ19 Ͳ1 Ͳ20 Ͳ12 Ͳ11 Ͳ23 Ͳ105 Subtotal 0 7 7 Ͳ44050 EmergencyShelter1Site 11211210 Manufacturing 2.1 AC Ͳ15 Ͳ1 Ͳ16 Ͳ9 Ͳ8 Ͳ17 Ͳ81 Subtotal Ͳ14 0 Ͳ14 Ͳ8 Ͳ7 Ͳ15 Ͳ71 Warehousing 5.0 AC 36 14 50 15 28 43 286 Manufacturing 5 AC Ͳ35 Ͳ3 Ͳ38 Ͳ22 Ͳ20 Ͳ42 Ͳ194 Subtotal 1 11 12 Ͳ78192 Warehousing 3.6 AC 26 10 36 11 20 31 206 Manufacturing 3.6 AC Ͳ25 Ͳ2 Ͳ27 Ͳ16 Ͳ14 Ͳ30 Ͳ140 Subtotal 1 8 9 Ͳ56166 Warehousing 3.1 AC 22 9 31 9 18 27 177 Manufacturing 3.1 AC Ͳ21 Ͳ2 Ͳ23 Ͳ14 Ͳ12 Ͳ26 Ͳ120 Subtotal 1 7 8 Ͳ56157 Warehousing 2.9 AC 21 8 29 9 16 25 166 Manufacturing 2.9 AC Ͳ20 Ͳ2 Ͳ22 Ͳ13 Ͳ11 Ͳ24 Ͳ113 Subtotal 1 6 7 Ͳ45153 Warehousing 10.5 AC 76 30 106 32 59 91 601 Manufacturing 10.5 AC Ͳ73 Ͳ5 Ͳ78 Ͳ47 Ͳ41 Ͳ88 Ͳ407 Subtotal 3 25 28 Ͳ15 18 3 194 Warehousing 2.0 AC 14 6 20 6 11 17 114 Manufacturing 2 AC Ͳ14 Ͳ1 Ͳ15 Ͳ9 Ͳ8 Ͳ17 Ͳ78 Subtotal 0 5 5 Ͳ33036 Warehousing 2.7 AC 19 8 27 8 15 23 155 Manufacturing 2.7 AC Ͳ19 Ͳ1 Ͳ20 Ͳ12 Ͳ11 Ͳ23 Ͳ105 Subtotal 0 7 7 Ͳ44050 Apartments 10DU 14542667 Manufacturing 0.5 AC Ͳ30Ͳ3 Ͳ2 Ͳ2 Ͳ4 Ͳ19 Subtotal Ͳ24220248 Warehousing 8.6 AC 62 24 86 26 49 75 492 Manufacturing 8.6 AC Ͳ60 Ͳ4 Ͳ64 Ͳ38 Ͳ34 Ͳ72 Ͳ334 Subtotal 2 20 22 Ͳ12 15 3 158 Apartments 45DU 51823181028299 Manufacturing 2.9 AC Ͳ20 Ͳ2 Ͳ22 Ͳ13 Ͳ11 Ͳ24 Ͳ113 Subtotal Ͳ15 16 1 5 Ͳ1 4 186 Warehousing 3.0 AC 22 8 30 9 17 26 172 Manufacturing 3.0 AC Ͳ21 Ͳ2 Ͳ23 Ͳ13 Ͳ12 Ͳ25 Ͳ116 Subtotal 1 6 7 Ͳ45156 Site PotentialProposedDevelopmentTripGeneration 1 Table3 Daily 1 Morning Evening Unit2QuantityLandUse 1Source:InstituteofTransportationEngineers,TripGeneration,9thEdition,2012,LandUseCategories140,150,and220. 2AC=Acres;Site=Site;DU=DwellingUnit totalof10vehicletripsperday. 3Theemergencyshelterisprojectedtogeneratelittletoknowtraffic.Anassumptionof1inboundand1outboundvehiclehasbeenmadeforthemorningandeven 2 10 9 8 7 6 5 4 3 13 12 11 22 Control3 LTRLTRLTRLTRMorningEvening AlamedaStreet(NS)at: VernonAvenueͲWest(EW)Ͳ#1a TS 1 1.5 0.5 1 1.5 0.5 0.5 1 0.5 0.5 1 0.5 1.617ͲF 1.671ͲF VernonAvenueͲEast(EW)Ͳ#1b TS 0100100.510.50.51.511.217ͲF 1.317ͲF 55thStreetͲWest(EW)Ͳ#2a TS 1 1.5 0.5 1 1.5 0.5 0.5 0.5 d 0 1 0 1.482ͲF 1.692ͲF 55thStreetͲEast(EW)Ͳ#2b TS 0100100100.50.5d0.811ͲD 1.153ͲF SantaFeAvenue(NS)at: 25th/26thStreet(EW)Ͳ#3 TS 1 2 1>> 1 2 1>> 1 1 d 1 0.5 0.5 0.988ͲE 1.125ͲF 38thStreet(EW)Ͳ#4 TS 1 1.5 0.5 1 1.5 0.5 0.5 0.5 d 0 0 0 1.055ͲF 1.119ͲF VernonAvenue(EW)Ͳ#5 TS 1 1.5 0.5 1 1.5 0.5 0 1 0 0.5 1 0.5 1.076ͲF 1.018ͲF VernonAvenue/PacificBoulevard(EW)Ͳ#6 TS 1 1.5 0.5 1 1.5 0.5 1 2.5 0.5 1 2 2 1.017ͲF 1.062ͲF SotoStreet(NS)at: 26thStreet(EW)Ͳ#7 TS 121>>12110.50.510.50.51.127ͲF 1.314ͲF BandiniBoulevard(EW)Ͳ#8 TS 1 1.5 0.5 1 1.5 0.5 1 2.5 0.5 1 2.5 0.5 1.060ͲF 1.111ͲF VernonAvenue(EW)Ͳ#9 TS 1 1.5 0.5 1 1.5 0.5 0.5 1 0.5 0.5 1 0.5 0.953ͲE 1.050ͲF LeonisBoulevard(EW)Ͳ#10 TS 1 1.5 0.5 1 1.5 0.5 1 1.5 0.5 1 1.5 0.5 0.969ͲE 0.899ͲD FruitlandAvenue(EW)Ͳ#11 TS 1 1.5 0.5 1 1.5 0.5 1 0.5 0.5 1 0.5 0.5 0.891ͲD 0.973ͲE BoyleAvenue(NS)at: SlausonAvenue(EW)Ͳ#12 TS 1 1.5 0.5 1 1.5 0.5 1 1.5 0.5 1 1.5 0.5 1.199ͲF 1.334ͲF DowneyRoad(NS)at: WashingtonBoulevard(EW)Ͳ#13 TS 121121121>12d0.963ͲE 1.019ͲF BandiniBoulevard(EW)Ͳ#14 TS 12112112121.50.51.002ͲF 1.048ͲF SlausonAvenue(EW)Ͳ#15 TS 11110.50.511.50.50.510.51.081ͲF 1.073ͲF AtlanticBoulevard(NS)at: BandiniBoulevard(EW)Ͳ#16 TS 14113.51.5>>1.520.5112>>1.725ͲF 1.598ͲF DistrictBoulevard(EW)Ͳ#17 TS 1 2.5 0.5 1 3 1>> 2 1 1 0.5 1.5 1>> 0.952ͲE 1.080ͲF 1 2 3 Whenarightturnlaneisdesignated,thelanecaneitherbestripedorunstriped.Tofunctionasarightturnlanetheremustbesufficientwidthforrightturningvehiclestotravel outsidethethroughlanes.L=Left;T=Through;R=Right;d=DefactoTurnLane;>=RightTurnOverlap;>>=FreeRightTurn ICUͲLOS=IntersectionCapacityUtilizationͲLevelofService TS=TrafficSignal Table4 ProposedGeneralPlanYear2035IntersectionCapacityUtilizationandLevelofService Intersection Traffic IntersectionApproachLanes1 PeakHour Northbound Southbound Eastbound Westbound ICUͲLOS2 23 Volumeto Levelof Volumeto Levelof Project Significant Volumeto Levelof Project Significant Hour Capacity Service Capacity Service Impact Impact1 Capacity Service Impact Impact AlamedaStreet(NS)at: VernonAvenueͲWest(EW)Ͳ#1a Morning 1.617 F 1.617 F 0.000 No Evening 1.671 F 1.671 F 0.000 No VernonAvenueͲEast(EW)Ͳ#1b Morning 1.217 F 1.217 F 0.000 No Evening 1.317 F 1.317 F 0.000 No 55thStreetͲWest(EW)Ͳ#2a Morning 1.482 F 1.482 F 0.000 No Evening 1.692 F 1.692 F 0.000 No 55thStreetͲEast(EW)Ͳ#2b Morning 0.811 D 0.811 D 0.000 No Evening 1.153 D 1.153 D 0.000 No SantaFeAvenue(NS)at: 25th/26thStreet(EW)Ͳ#3 Morning 0.986 E 0.988 E 0.002 No Evening 1.124 F 1.125 F 0.001 No 38thStreet(EW)Ͳ#4 Morning 1.059 F 1.055 F Ͳ0.004 No Evening 1.121 F 1.119 F Ͳ0.002 No VernonAvenue(EW)Ͳ#5 Morning 1.077 F 1.076 F Ͳ0.001 No Evening 1.022 F 1.018 F Ͳ0.004 No VernonAvenue/PacificBoulevard(EW)Ͳ#6 Morning 1.017 F 1.017 F 0.000 No Evening 1.061 F 1.062 F 0.001 No SotoStreet(NS)at: 26thStreet(EW)Ͳ#7 Morning 1.118 F 1.127 F 0.009 No Evening 1.311 F 1.134 F Ͳ0.177 No BandiniBoulevard(EW)Ͳ#8 Morning 1.053 F 1.060 F 0.007 No Evening 1.111 F 1.111 F 0.000 No VernonAvenue(EW)Ͳ#9 Morning 0.953 E 0.953 F 0.000 No Evening 1.050 F 1.050 F 0.000 No LeonisBoulevard(EW)Ͳ#10 Morning 0.969 E 0.969 E 0.000 No Evening 0.899 D 0.899 D 0.000 No FruitlandAvenue(EW)Ͳ#11 Morning 0.891 D 0.891 D 0.000 No Evening 0.973 E 0.973 E 0.000 No BoyleAvenue(NS)at: SlausonAvenue(EW)Ͳ#12 Morning 1.199 F 1.199 F 0.000 No Evening 1.335 F 1.334 F Ͳ0.001 No DowneyRoad(NS)at: WashingtonBoulevard(EW)Ͳ#13 Morning 0.960 E 0.963 E 0.003 No Evening 1.019 F 1.019 F 0.000 No BandiniBoulevard(EW)Ͳ#14 Morning 0.998 E 1.002 F 0.004 No Evening 1.043 F 1.048 F 0.005 No SlausonAvenue(EW)Ͳ#15 Morning 1.079 F 1.081 F 0.002 No Evening 1.075 F 1.073 F Ͳ0.002 No AtlanticBoulevard(NS)at: BandiniBoulevard(EW)Ͳ#16 Morning 1.717 F 1.725 F 0.008 No Evening 1.594 F 1.598 F 0.004 No DistrictBoulevard(EW)Ͳ#17 Morning 0.949 E 0.952 E 0.003 No Evening 1.081 F 1.080 F Ͳ0.001 No 1 orexceedsthethresholdsshownbelow: LevelofService C0.70Ͳ0.79 D0.80Ͳ0.89 E/F 0.90Ͳmore Table5 ProjectTrafficContribution ProposedGeneralPlan WithoutMitigation WithMitigation equaltoorgreaterthan0.010ormore Year2035 Peak Intersection CurrentGeneralPlan BasedontheLosAngelesDepartmentofTransportationPoliciesandProcedure ,impactisconsideredsignificantiftheprojectrelatedincreaseinthevolumetocapacityratioequals SignificantImpactThresholdforIntersections Volume/Capacity IncrementalIncrease equaltoorgreaterthan0.040ormore equaltoorgreaterthan0.020ormore 24 45 V.Conclusions Thepurposeofthisreportistoprovideanassessmentofthetrafficimpactsresultingfrom proposedresidentialandtruckingoverlaydistrictsintheCityofVernon,andtoidentifythetraffic mitigationmeasuresnecessarytomaintaintheestablishedLevelofServicestandardforthe elementsoftheimpactedroadwaysystem. Thestudyareaintersectionsweredeterminedbyselectingtheintersectionsthatwereprojected tooperateatunacceptableLevelsofServiceinthe2007CirculationPlanUpdatefortheCityof Vernon. AlamedaStreet(NS)at: VernonAvenue(EW)Ͳ#1 55thStreet(EW)Ͳ#2 SantaFeAvenue(NS)at: 25th/26thStreet(EW)Ͳ#3 38thStreet(EW)Ͳ#4 VernonAvenue(EW)Ͳ#5 VernonAvenue/PacificBoulevard(EW)Ͳ#6 SotoStreet(NS)at: 26thStreet(EW)Ͳ#7 BandiniBoulevard(EW)Ͳ#8 VernonAvenue(EW)Ͳ#9 LeonisBoulevard(EW)Ͳ#10 FruitlandAvenue(EW)Ͳ#11 BoyleAvenue(NS)at: SlausonAvenue(EW)Ͳ#12 DowneyRoad(NS)at: WashingtonBoulevard(EW)Ͳ#13 BandiniBoulevard(EW)Ͳ#14 SlausonAvenue(EW)Ͳ#15 AtlanticBoulevard(NS)at: BandiniBoulevard(EW)Ͳ#16 DistrictBoulevard(EW)Ͳ#17 ExistingLevelofService:ForExistingtrafficconditions,thestudyareaintersectionscurrently operatewithinacceptableLevelsofServiceduringthepeakhours,exceptforthefollowingstudy areaintersectionsthatoperateatLevelsofServiceEtoFduringthepeakhours(seeTable1): 46 AlamedaStreet(NS)at: VernonAvenue(EW)Ͳ#1 55thStreet(EW)Ͳ#2 SantaFeAvenue(NS)at: 25th/26thStreet(EW)Ͳ#3 38thStreet(EW)Ͳ#4 VernonAvenue(EW)Ͳ#5 VernonAvenue/PacificBoulevard(EW)Ͳ#6 SotoStreet(NS)at: 26thStreet(EW)Ͳ#7 BandiniBoulevard(EW)Ͳ#8 VernonAvenue(EW)Ͳ#9 BoyleAvenue(NS)at: SlausonAvenue(EW)Ͳ#12 DowneyRoad(NS)at: WashingtonBoulevard(EW)Ͳ#13 BandiniBoulevard(EW)Ͳ#14 SlausonAvenue(EW)Ͳ#15 AtlanticBoulevard(NS)at: BandiniBoulevard(EW)Ͳ#16 DistrictBoulevard(EW)Ͳ#17 CurrentGeneralPlanYear2035LevelofService:FortheCurrentGeneralPlanYear2035traffic conditions,thestudyareaintersectionsareprojectedtooperateatLevelofServiceEtoFduring thepeakhours,withoutimprovements(seeTable2). Allpotentialdevelopmentswithintheproposedhousingandtruckingoverlaydistrictshavebeen individuallyaccountedforbyanappropriatetripgenerationandtripdistribution. ProposedGeneralPlanYear2035LevelofService:FortheProposedGeneralPlanYear2035 trafficconditions,thestudyareaintersectionsareprojectedtooperateatLevelofServiceEtoF duringthepeakhours,withoutimprovements(seeTable4). Table5depictstheProposedGeneralPlanYear2035trafficconditionsatthestudyarea intersections.Thestudyareaintersectionsarenotsignificantlyimpactedbytheproposed housingandtruckingoverlaydistricts. TheIͲ710wideningprojectisprojectedtoaddanadditionaltwonorthboundandtwosouthbound travellanes.Thesetravellanesproposedtobededicatedtotrucks.Theadditionallane modificationsarenotprojectedtoalterthetrafficpatternswithintheCityofVernon.Thereis alsoapotentialforadditionalinterchangesandmodificationtheexistinginterchangesalongtheIͲ 710Freeway.Thesepotentialimprovementswillpotentiallysignificantlyimprovethefunctionof AtlanticBoulevard/BandiniBoulevard. 47 TheOrangeRailLinemightalignthroughtheCityofVernonandprovideaccesstotheCityof Vernon.Atthispointthereisnopreferredalignmentandnoproposedstations.Trafficpatterns withintheCityofVernonarenotanticipatedtosignificantlychangeifandwhenthisOrangeRail Lineiscompleted. ItshouldbenotedthattheCityofVernonisvirtuallybuiltoutandthatphysicallaneadditionasa meansoftrafficmitigationprovideslimitedopportunities.ItisrecommendedthattheCityof VernonimplementanIntelligentTransportationSystem.TheCityofLosAngeleshas implementedanumberofLosAngelesCountyAutomatedTrafficSurveillanceandControl systemsandthesesystemsprovideanapproximate10percentincreaseincapacity. Appendices AppendixA–GlossaryofTransportationTerms AppendixB–TrafficCountWorksheets AppendixC–TruckPercentageCalculations AppendixD–ExplanationandCalculationofIntersectionCapacityUtilization APPENDIXA GlossaryofTransportationTerms GLOSSARYOFTRANSPORTATIONTERMS COMMONABBREVIATIONS AC:Acres ADT:AverageDailyTraffic Caltrans:CaliforniaDepartmentofTransportation DU:DwellingUnit ICU:IntersectionCapacityUtilization LOS:LevelofService TSF:ThousandSquareFeet V/C:Volume/Capacity VMT:VehicleMilesTraveled TERMS AVERAGEDAILYTRAFFIC:Thetotalvolumeduringayeardividedbythenumberof daysinayear.Usuallyonlyweekdaysareincluded. BANDWIDTH:Thenumberofsecondsofgreentimeavailableforthroughtrafficina signalprogression. BOTTLENECK:Aconstrictionalongatravelwaythatlimitstheamountoftrafficthat canproceeddownstreamfromitslocation. CAPACITY:Themaximumnumberofvehiclesthatcanbereasonablyexpectedtopass overagivensectionofalaneoraroadwayinagiventimeperiod. CHANNELIZATION:Theseparationorregulationofconflictingtrafficmovementsinto definitepathsoftravelbytheuseofpavementmarkings,raisedislands,orother suitablemeanstofacilitatethesafeandorderlymovementsofbothvehiclesand pedestrians. CLEARANCEINTERVAL:Nearlysameasyellowtime.Ifthereisanallredintervalafter theendofayellow,thenthatisalsoaddedintotheclearanceinterval. CORDON:Animaginarylinearoundanareaacrosswhichvehicles,persons,orother itemsarecounted(inandout). CYCLELENGTH:Thetimeperiodinsecondsrequiredforonecompletesignalcycle. CULͲDEͲSACSTREET:Alocalstreetopenatoneendonly,andwithspecialprovisions forturningaround. DAILYCAPACITY:Thedailyvolumeoftrafficthatwillresultinavolumeduringthe peakhourequaltothecapacityoftheroadway. DELAY:Thetimeconsumedwhiletrafficisimpededinitsmovementbysomeelement overwhichithasnocontrol,usuallyexpressedinsecondspervehicle. DEMANDRESPONSIVESIGNAL:SameastrafficͲactuatedsignal. DENSITY:Thenumberofvehiclesoccupyinginaunitlengthofthethroughtraffic lanesofaroadwayatanygiveninstant.Usuallyexpressedinvehiclespermile. DETECTOR:Adevicethatrespondstoaphysicalstimulusandtransmitsaresulting impulsetothesignalcontroller. DESIGNSPEED:Aspeedselectedforpurposesofdesign.Featuresofahighway,such ascurvature,superelevation,andsightdistance(uponwhichthesafeoperationof vehiclesisdependent)arecorrelatedtodesignspeed. DIRECTIONALSPLIT:Thepercentoftrafficinthepeakdirectionatanypointintime. DIVERSION:Thereroutingofpeakhourtraffictoavoidcongestion. FORCEDFLOW:Oppositeoffreeflow. FREEFLOW:Volumesarewellbelowcapacity.Vehiclescanmaneuverfreelyand travelisunimpededbyothertraffic. GAP:Timeordistancebetweensuccessivevehiclesinatrafficstream,rearbumperto frontbumper. HEADWAY:Timeordistancespacingbetweensuccessivevehiclesinatrafficstream, frontbumpertofrontbumper. INTERCONNECTEDSIGNALSYSTEM:Anumberofintersectionsthatareconnectedto achievesignalprogression. LEVELOFSERVICE:Aqualitativemeasureofanumberoffactors,whichincludespeed andtraveltime,trafficinterruptions,freedomtomaneuver,safety,drivingcomfort andconvenience,andoperatingcosts. LOOPDETECTOR:Avehicledetectorconsistingofaloopofwireembeddedinthe roadway,energizedbyalternatingcurrentandproducinganoutputcircuitclosure whenpassedoverbyavehicle. MINIMUMACCEPTABLEGAP:Smallesttimeheadwaybetweensuccessivevehiclesin atrafficstreamintowhichanothervehicleiswillingandabletocrossormerge. MULTIͲMODAL:Morethanonemode;suchasautomobile,bustransit,railrapid transit,andbicycletransportationmodes. OFFSET:Thetimeintervalinsecondsbetweenthebeginningofgreenatone intersectionandthebeginningofgreenatanadjacentintersection. PLATOON:Acloselygroupedcomponentoftrafficthatiscomposedofseveral vehiclesmoving,orstandingreadytomove,withclearspacesaheadandbehind. ORIGINͲDESTINATIONSURVEY:Asurveytodeterminethepointoforiginandthe pointofdestinationforagivenvehicletrip. PASSENGERCAREQUIVALENTS:OnecarisonePassengerCarEquivalent.Atruckis equalto2or3PassengerCarEquivalentsinthatatruckrequireslongertostart,goes slower,andacceleratesslower.LoadedtruckshaveahigherPassengerCarEquivalent thanemptytrucks. PEAKHOUR:The60consecutiveminuteswiththehighestnumberofvehicles. PRETIMEDSIGNAL:Atypeoftrafficsignalthatdirectstraffictostopandgoona predeterminedtimeschedulewithoutregardtotrafficconditions.Also,fixedtime signal. PROGRESSION:Atermusedtodescribetheprogressivemovementoftrafficthrough severalsignalizedintersections. SCREENͲLINE:Animaginarylineorphysicalfeatureacrosswhichalltripsarecounted, normallytoverifythevalidityofmathematicaltrafficmodels. SIGNALCYCLE:Thetimeperiodinsecondsrequiredforonecompletesequenceof signalindications. SIGNALPHASE:Thepartofthesignalcycleallocatedtooneormoretraffic movements. STARTINGDELAY:Thedelayexperiencedininitiatingthemovementofqueuedtraffic fromastoptoanaveragerunningspeedthroughasignalizedintersection. TRAFFICͲACTUATEDSIGNAL:Atypeoftrafficsignalthatdirectstraffictostopandgo inaccordancewiththedemandsoftraffic,asregisteredbytheactuationofdetectors. TRIP:Themovementofapersonorvehiclefromonelocation(origin)toanother (destination).Forexample,fromhometostoretohomeistwotrips,notone. TRIPͲEND:Oneendofatripateithertheoriginordestination;i.e.eachtriphastwo tripͲends.AtripͲendoccurswhenaperson,object,ormessageistransferredtoor fromavehicle. TRIPGENERATIONRATE:Thequalityoftripsproducedand/orattractedbyaspecific landusestatedintermsofunitssuchasperdwelling,peracre,andper1,000square feetoffloorspace. TRUCK:Avehiclehavingdualtiresononeormoreaxles,orhavingmorethantwo axles. UNBALANCEDFLOW:Heaviertrafficflowinonedirectionthantheother.Onadaily basis,mostfacilitieshavebalancedflow.Duringthepeakhours,flowisseldom balancedinanurbanarea. VEHICLEMILESOFTRAVEL:Ameasureoftheamountofusageofasectionof highway,obtainedbymultiplyingtheaveragedailytrafficbylengthoffacilityinmiles. APPENDIXB TrafficCountWorksheets APPENDIXC TruckPercentageCalculations Morning Evening Morning Evening SotoStreet(NS)at26thStreet(EW)Ͳ#7 4,718 5,827 1,361 1,303 SotoStreet(NS)atBandiniBoulevard(EW)Ͳ#8 5,584 6,465 1,642 1,486 DowneyRoad(NS)atBandiniBoulevard(EW)Ͳ#14 4,469 6,128 1,484 1,409 AtlanticBoulevard(NS)atBandiniBoulevard(EW)Ͳ#16 6,533 8,110 2,490 2,299 TotalCarsͲAM TotalCarsͲPM TotalCars TotalTrucksͲAM TotalTrucksͲPM TotalTrucks PercentCarsͲAM PercentTrucksͲAM PercentCarsͲPM PercentTrucksͲPM PercentCars PercentTrucks Intersection TruckPercentageCalculations 26,530 21,304 Car Truck 75.3% 13,474 6,497 6,977 47,834 22.0% 78.0% 19.7% 80.3% 24.7% APPENDIXD ExplanationandCalculationof IntersectionCapacityUtilization EXPLANATIONANDCALCULATIONOF INTERSECTIONCAPACITYUTILIZATION Overview Theabilityofaroadwaytocarrytrafficisreferredtoascapacity.Thecapacityis usuallygreaterbetweenintersectionsandlessatintersectionsbecausetrafficflows continuouslybetweenthemandonlyduringthegreenphaseatthem.Capacityat intersectionsisbestdefinedintermsofvehiclesperlaneperhourofgreen.If capacityis1600vehiclesperlaneperhourofgreen,andifthegreenphaseis50 percentofthecycleandtherearethreelanes,thenthecapacityis1600times50 percenttimes3lanes,or2400vehiclesperhourforthatapproach. Thetechniqueusedtocomparethevolumeandcapacityatanintersectionisknown asIntersectionCapacityUtilization.IntersectionCapacityUtilization,usually expressedasapercent,istheproportionofanhourrequiredtoprovidesufficient capacitytoaccommodateallintersectiontrafficifallapproachesoperateatcapacity. Ifanintersectionisoperatingat80percentofcapacity(i.e.,anIntersectionCapacity Utilizationof80percent),then20percentofthesignalcycleisnotused.Thesignal couldshowredonallindications20percentofthetimeandthesignalwouldjust accommodateapproachingtraffic. IntersectionCapacityUtilizationanalysisconsistsof(a)determiningtheproportionof signaltimeneededtoserveeachconflictingmovementoftraffic,(b)summingthe timesforthemovements,and(c)comparingthetotaltimerequiredtothetotaltime available.Forexample,iffornorthͲsouthtrafficthenorthboundtrafficis1600 vehiclesperhour,thesouthboundtrafficis1200vehiclesperhour,andthecapacityof eitherdirectionis3200vehiclesperhour,thenthenorthboundtrafficiscriticaland requires1600/3200or50percentofthesignaltime.IfforeastͲwesttraffic,30 percentofthesignaltimeisrequired,thenitcanbeseenthattheIntersection CapacityUtilizationis50plus30,or80percent.Whenleftturnarrows(leftturn phasing)exist,theyareincorporatedintotheanalysis.Thecriticalmovementsare usuallytheheavyleftturnmovementsandtheopposingthroughmovements. TheIntersectionCapacityUtilizationtechniqueisanidealtooltoquantifyexistingas wellasfutureintersectionoperation.Theimpactofaddingalanecanbequickly determinedbyexaminingtheeffectthelanehasontheIntersectionCapacity Utilization. IntersectionCapacityUtilizationWorksheetsThatFollowThisDiscussion TheIntersectionCapacityUtilizationworksheettablecontainsthefollowing information: 1.Peakhourturningmovementvolumes. 2.Numberoflanesthatserveeachmovement. 3.Forrightturnlanes,whetherthelaneisafreerightturnlane,whetherithasa rightturnarrow,andthepercentofrightturnsonredthatareassumed. 4.Capacityassumedperlane. 5.Capacityavailabletoserveeachmovement(numberoflanestimescapacityper lane). 6.Volumetocapacityratioforeachmovement. 7.Whetherthemovement'svolumetocapacityratioiscriticalandaddstothe IntersectionCapacityUtilizationvalue. 8.Theyellowtimeorclearanceintervalassumed. 9.Adjustmentsforrightturnmovements. 10.TheIntersectionCapacityUtilizationandLevelofService. TheIntersectionCapacityUtilizationWorksheetalsohastwographicsonthesame page.Thesetwographicsshowthefollowing: 1.Peakhourturningmovementvolumes. 2.Numberoflanesthatserveeachmovement. 3.Theapproachandexitlegvolumes. 4.ThetwoͲwaylegvolumes. 5.Anestimateofdailytrafficvolumesthatisfairlyclosetoactualcountsandis basedstrictlyonthepeakhourlegvolumesmultipliedbyafactor. 6.Percentofdailytrafficinpeakhours. 7.Percentofpeakhourlegvolumethatisinboundversusoutbound. AmoredetaileddiscussionofIntersectionCapacityUtilizationandLevelofService follows. LevelofService LevelofServiceisusedtodescribethequalityoftrafficflow.LevelsofServiceAtoC operatequitewell.LevelofServiceCistypicallythestandardtowhichruralroadways aredesigned. LevelofServiceDischaracterizedbyfairlyrestrictedtrafficflow.LevelofServiceDis thestandardtowhichurbanroadwaysaretypicallydesigned.LevelofServiceEisthe maximumvolumeafacilitycanaccommodateandwillresultinpossiblestoppagesof momentaryduration.LevelofServiceFoccurswhenafacilityisoverloadedandis characterizedbystopͲandͲgotrafficwithstoppagesoflongduration. AdescriptionofthevariousLevelsofServiceappearsattheendoftheIntersection CapacityUtilizationdescription,alongwiththerelationshipbetweenIntersection CapacityUtilizationandLevelofService. SignalizedandUnsignalizedIntersections AlthoughcalculatinganIntersectionCapacityUtilizationvalueforanunsignalized intersectionisinvalid,thepresumptionisthatasignalcanbeinstalledandthe calculationshowswhetherthegeometricsarecapableofaccommodatingthe expectedvolumeswithasignal.AtrafficsignalbecomeswarrantedbeforeLevelof ServiceDisreachedforasignalizedintersection. SignalTiming TheIntersectionCapacityUtilizationcalculationassumesthatasignalisproperly timed.ItispossibletohaveanIntersectionCapacityUtilizationwellbelow100 percent,yethaveseveretrafficcongestion.Thiswouldoccurifoneormore movementsisnotgettingsufficientgreentimetosatisfyitsdemand,andexcessgreen timeexistsonothermovements.Thisisanoperationalproblemthatshouldbe remedied. LaneCapacity Capacityisoftendefinedintermsofroadwaywidth;however,standardlaneshave approximatelythesamecapacitywhethertheyare11or14feetwide.Ourdata indicatesatypicallane,whetherathroughlaneoraleftturnlane,hasacapacityof approximately1750vehiclesperhourofgreentime,withnearlyalllocationsshowing acapacitygreaterthan1600vehiclesperhourofgreenperlane.Rightturnlanes haveaslightlylowercapacity;however1600vehiclesperhourisavalidcapacity assumptionforrightturnlanes. ThisfindingispublishedintheAugust,1978issueofITEJournalinthearticleentitled, "AnotherLookatSignalizedIntersectionCapacity"byWilliamKunzman.Acapacityof 1600vehiclesperhourperlanewithnoyellowtimepenalty,or1700vehiclesperhour witha3or5percentyellowtimepenaltyisreasonable. YellowTime Theyellowtimecaneitherbeassumedtobecompletelyusedandnopenaltyapplied, oritcanbeassumedtobeonlypartiallyusable.Totalyellowtimeaccountsfor approximately10percentofasignalcycle,andapenaltyof3to5percentis reasonable. Duringpeakhourtrafficoperationtheyellowtimesarenearlycompletelyused.If thereisnoleftturnphasing,theleftturnvehiclescompletelyusetheyellowtime. Evenifthereisleftturnphasing,thethroughtrafficcontinuestoenterthe intersectionontheyellowuntiljustasplitsecondbeforethered. SharedLanes Sharedlanesoccurinmanylocations.Asharedlaneisoftenfoundattheendofanoff rampwheretherampformsanintersectionwiththecrossstreet.Oftenatadiamond interchangeofframp,therearethreelanes.Inthecaseofadiamondinterchange,the middlelaneissometimesshared,andthedrivercanturnleft,gothrough,orturnright fromthatlane. Ifoneassumesathreelaneofframpasdescribedabove,andifoneassumesthateach lanehas1600capacity,andifoneassumesthatthereare1000leftturnsperhour,500 rightturnsperhour,and100throughvehiclesperhour,thenhowshouldoneassume thatthethreelanesoperate.Therearethreewaysthatitisdone. Onewayistojustassumethatall1600vehicles(1000plus500plus100)areserved simultaneouslybythreelanes.Whenthisisdone,thecapacityis3times1600or 4800,andtheamountofgreentimeneededtoservetherampis1600vehicles dividedby4800capacityor33.3percent.Thisassumptioneffectivelyassumesperfect lanedistributionbetweenthethreelanesthatisnotrealistic.Italsomeansaleftturn canbemadefromtherightlane. Anotherwayistoequallysplitthecapacityofasharedlaneandinthiscasetoassume thereare1.33leftturnlanes,1.33rightturnlanes,and0.33throughlanes.Withthis assumption,thecriticalmovementistheleftturnsandthe1000leftturnsareserved byacapacityof1.33times1600,or2133.Thevolumetocapacityratioofthecritical moveis1000dividedby2133or46.9percent. Thefirstmethodresultsinacriticalmoveof33.3percentandthesecondmethod resultsinacriticalmoveof46.9percent.Neitherisveryaccurate,andthedifference inthecalculatedLevelofServicewillbeapproximately1.5LevelsofService(oneLevel ofServiceis10percent). ThewayKunzmanAssociatesdoesitistoassignfractionallanesinareasonableway. Inthisexample,itwouldbeassumedthatthereis1.1rightturnlanes,0.2through lanes,and1.7leftturnlanes.Thevolumetocapacityratiosforeachmovementwould be31.3percentforthethroughtraffic,28.4percentfortherightturnmovement,and 36.8percentfortheleftturnmovement.Thecriticalmovementwouldbethe36.8 percentfortheleftturns. RightTurnonRed KunzmanAssociates'softwaretreatsrightturnlanesinoneoffivedifferentways. Eachrightturnlaneisclassifiedintooneoffivecases.Thefivecasesare(1)freeright turnlane,(2)rightturnlanewithseparaterightturnarrow,(3)standardrightturn lanewithnorightturnsonredallowed,(4)standardrightturnlanewithacertain percentageofrightturnsonredallowed,and(5)separaterightturnarrowanda certainpercentageofrightturnsonredallowed. FreeRightTurnLane Ifitisafreerightturnlane,thenitisgivenacapacityofonefulllanewithcontinuous or100percentgreentime.AFreerightturnlaneoccurswhenthereisaseparate approachlaneforrightturningvehicles,thereisaseparatedeparturelaneforthe rightturningvehiclesaftertheyturnandareexitingtheintersection,andthethrough crossstreettrafficdoesnotinterferewiththevehiclesaftertheyturnright. SeparateRightTurnArrow Ifthereisaseparaterightturnarrow,thenitisassumedthatvehiclesaregivena greenindicationandcanproceedonwhatisknownastheleftturnoverlap. Theleftturnoverlapforanorthboundrightturnisthewestboundleftturn.Whenthe leftturnoverlaphasagreenindication,therightturnlaneisalsogivenagreenarrow indication.Thus,ifthereisanorthboundrightturnarrow,thenitcanbeturnedgreen fortheperiodoftimethatthewestboundleftturnsareproceeding. Iftherearemorerightturnsthancanbeaccommodatedduringthenorthbound throughgreenandthetimethatthenorthboundrightturnarrowison,thenan adjustmentismadetotheIntersectionCapacityUtilizationtoaccountforthegreen timethatneedstobeaddedtothenorthboundthroughgreentoaccommodatethe northboundrightturns. StandardRightTurnLane,NoRightTurnsonRed Astandardrightturnlane,withnorightturnonredassumed,proceedsonlywhen thereisagreenindicationdisplayedfortheadjacentthroughmovement.Ifadditional greentimeisneededabovethatamountoftime,thenintheIntersectionCapacity Utilizationcalculationarightturnadjustmentgreentimeisaddedabovethegreen timethatisneededtoservetheadjacentthroughmovement. StandardRightTurnLane,WithRightTurnsonRed Astandardrightturnlanewithsay20percentoftherightturnsallowedtoturnright onaredindicationiscalculatedthesameasthestandardrightturncasewherethere isnorightturnonredallowed,exceptthattherightturnadjustmentisreducedto accountforthe20percentoftherightturningvehiclesthatcanlogicallyturnrighton aredlight.Therightturnsonredareneverallowedtoexceedthetimetheoverlap leftturnstakeplustheunusedpartofthegreencyclethatthecrossstreettraffic movingfromlefttorighthas. Asanexampleofhow20percentofthecarsareallowedtoturnrightonared indication,assumethatthenorthboundrightturnvolumeneeds40percentofthe signalcycletobesatisfied.Toallow20percentofthenorthboundrightturnstoturn rightonred,thenduring8percentofthesignalcycle(40percentofsignalcycletimes 20percentthatcanturnrightonred)rightturnsonredwillbeallowedifitisfeasible. Forthisexample,assumethat15percentofthesignalcycleisgreenforthe northboundthroughtraffic,andthatmeansthat15percentofthesignalcycleis availabletosatisfynorthboundrightturns.Afterthenorthboundthroughtraffichas receiveditsgreen,25percentofthesignalcycleisstillneededtosatisfythe northboundrightturns(40percentofthesignalcycleminusthe15percentofthe signalcyclethatthenorthboundthroughused). Assumethatthewestboundleftturnsrequireagreentimeof6percentofthesignal cycle.This6percentofthesignalcycleisusedbynorthboundrightturnsonred. Afteraccountingforthenorthboundrightturnsthatoccuronthewestboundoverlap leftturn,19percentofthesignalcycleisstillneededforthenorthboundrightturns (25percentofthecyclewasneededafterthenorthboundthroughgreentimewas accountedfor[seeaboveparagraph],and6percentwasservedduringthewestbound leftturnoverlap).Also,atthispoint6percentofthesignalcyclehasbeenusedfor northboundrightturnsonred,andstill2percentmoreoftherightturnswillbe allowedtooccurontheredifthereisunusedeastboundthroughgreentime. Forpurposeofthisexample,assumethatthewestboundthroughgreeniscritical,and that15percentofthesignalcycleisunusedbyeastboundthroughtraffic.Thus,2 percentmoreofthesignalcyclecanbeusedbythenorthboundrightturnsonred sincethereis15secondsofunusedgreentimebeinggiventotheeastboundthrough traffic. Atthispoint,8percentofthesignalcyclewasavailabletoservenorthboundright turningvehiclesonred,and15percentofthesignalcyclewasavailabletoserveright turningvehiclesonthenorthboundthroughgreen.So23percentofthesignalcycle hasbeenavailablefornorthboundrightturns. Because40percentofthesignalcycleisneededtoservenorthboundrightturns, thereisstillaneedfor17percentmoreofthesignalcycletobeavailablefor northboundrightturns.Whatthismeansisthenorthboundthroughtrafficgreen timeisincreasedby17percentofthecyclelengthtoservetheunservedrightturn volume,anda17percentadjustmentisaddedtotheIntersectionCapacityUtilization toaccountforthenorthboundrightturnsthatwerenotservedonthenorthbound throughgreentimeorwhenrightturnsonredwereassumed. SeparateRightTurnArrow,WithRightTurnsonRed Arightturnlanewithaseparaterightturnarrow,plusacertainpercentageofright turnsallowedonrediscalculatedthesamewayasastandardrightturnlanewitha certainpercentageofrightturnsallowedonred,excepttheturnswhichoccuronthe rightturnarrowarenotcountedaspartofthepercentageofrightturnsthatoccuron red. CriticalLaneMethod IntersectionCapacityUtilizationparallelsanothercalculationprocedureknownasthe CriticalLaneMethodwithoneexception.CriticalLaneMethoddimensionscapacityin termsofstandardizedvehiclesperhourperlane.ACriticalLaneMethodresultof800 vehiclesperhourmeansthattheintersectionoperatesasthough800vehicleswere usingasinglelanecontinuously.Ifoneassumesalanecapacityof1600vehiclesper hour,thenaCriticalLaneMethodcalculationresultingin800vehiclesperhouristhe sameasanIntersectionCapacityUtilizationcalculationof50percentsince800/1600 is50percent.ItisouropinionthattheCriticalLaneMethodisinferiortothe IntersectionCapacityUtilizationmethodsimplybecauseastatementsuchas"The CriticalLaneMethodvalueis800vehiclesperhour"meanslittletomostpersons, whereasastatementsuchas"TheIntersectionCapacityUtilizationis50percent" communicatesclearly.CriticalLaneMethodresultsdirectlycorrespondto IntersectionCapacityUtilizationresults.Thecorrespondenceisasfollows,assuminga lanecapacityof1600vehiclesperhourandnoclearanceinterval. CriticalLaneMethodResultIntersectionCapacity UtilizationResult 800vehiclesperhour 50percent 960vehiclesperhour 60percent 1120vehiclesperhour 70percent 1280vehiclesperhour 80percent 1440vehiclesperhour 90percent 1600vehiclesperhour100percent 1760vehiclesperhour110percent INTERSECTIONCAPACITYUTILIZATION LEVELOFSERVICEDESCRIPTION1 Levelof ServiceDescription Volumeto CapacityRatio A B C D E F LevelofServiceAoccurswhenprogressionisextremely favorableandvehiclesarriveduringthegreenphase.Most vehiclesdonotstopatall.Shortcyclelengthsmayalso contributetolowdelay. LevelofServiceBgenerallyoccurswithgoodprogression and/orshortcyclelengths.MorevehiclesstopthanforLevel ofServiceA,causinghigherlevelsofaveragedelay. LevelofServiceCgenerallyresultswhenthereisfair progressionand/orlongercyclelengths.Individualcycle failuresmaybegintoappearinthislevel.Thenumberof vehiclesstoppingissignificantatthislevel,althoughmany stillpassthroughtheintersectionwithoutstopping. LevelofServiceDgenerallyresultsinnoticeablecongestion. Longerdelaysmayresultfromsomecombinationof unfavorableprogression,longcyclelengths,orhighvolume tocapacityratios.Manyvehiclesstop,andtheproportionof vehiclesnotstoppingdeclines.Individualcyclefailuresare noticeable. LevelofServiceEisconsideredtobethelimitofacceptable delay.Thesehighdelayvaluesgenerallyindicatepoor progression,longcyclelengths,andhighvolumetocapacity ratios.Individualcyclefailuresarefrequent. LevelofServiceFisconsideredtobeunacceptabletomost drivers.Thisconditionoftenoccurswhenoversaturation, i.e.,whenarrivalflowratesexceedthecapacityofthe intersection.Itmayalsooccurathighvolumetocapacity ratiosbelow1.00withmanyindividualcyclefailures.Poor progressionandlongcyclelengthsmayalsobemajor contributingcausestosuchdelaylevels. 0.600andbelow 0.601to0.700 0.701to0.800 0.801to0.900 0.901to1.000 1.001andup 1Source:HighwayCapacityManualSpecialReport209,TransportationResearchBoard,NationalResearch CouncilWashingtonD.C.,2000. Existing CurrentGeneralPlanYear2035 ProposedGeneralPlanYear2035 ;V^U *V\U[Y`9VHK:\P[L 6YHUNL*HSPMVYUPH ^^^[YHMÄJLUNPULLYJVT Attachment F City of Vernon Focused General Plan and Zoning Ordinance Update Final Environmental Impact Report SCH No. 2007061031 March 2015 Lead Agency: City of Vernon 4305 S. Santa Fe A venue Vernon, CA 90058 This document is designed for double-sided printing to conserve natural resources. Supplemental Environmental Impact Report i Table of Contents 1 Introduction .......................................................................................... 1 2 Responses to Comments ......................................................................... 3 3 Errata ................................................................................................ 17 4 Public Circulation ................................................................................. 19 5 Mitigation Monitoring Reporting Program ................................................. 25 List of Tables Table A DEIR Comments ................................................................................ 3 Table of Contents ii Focused General Plan and Zoning Ordinance Update This Page Intentionally Left Blank Supplemental Environmental Impact Report 1 1 Introduction This Final Environmental Impact Report (FEIR) has been prepared to comply with Sections 15089 and 15132 of the State CEQA Guidelines. As noted in Section 15089(b) of the Guidelines, the focus of a FEIR should be on responses to comments on the Draft Supplemental Environmental Impact Report (Draft SEIR). Accordingly, this document incorporates the City of Vernon Focused General Plan and Zoning Ordinance Update Draft SEIR, Volumes I through II (State Clearinghouse No. 2007061031) by reference, in its entirety. The Draft SEIR is available for review at the City of Vernon, 4305 South Santa Fe Avenue, Vernon, California 90058 and on the City’s web site (www.cityofvernon.org). The contents of this FEIR include: Section 1: Introduction Section 2: Responses to Comments The City published a Notice of Availability and circulated the Draft SEIR for public review and comment for a 45-day review period from December 4, 2014 through January 20, 2015. A total of three different pieces of correspondences were submitted to the City during the review period. This section includes a list of all correspondence submitted to the City of Vernon, each identified by a letter for later reference, together with the authors and the dates the letters were issued. Following this list, all of the letters are presented, with numbered brackets to highlight specific comments that are responded to in the next section. Review of Environmental Documents Section 15204 of the California Environmental Quality Act (CEQA) Guidelines provides guidance to the public and public agencies in reviewing CEQA documents. This section is designed not to limit the scope of comments that can be submitted but to focus comments on issues that are substantive to the environmental analysis. Commenting entities should focus on the adequacy of the document in identifying and analyzing impacts to the environment, and should identify any areas they believe to be inadequate. The guidance indicates that comments should be submitted in a manner that: Identifies a specific environmental effect Supports the effect and its significance with substantial evidence Comments should include alternatives or mitigation measures to avoid or reduce identified, specific environmental effects. This section reiterates that the lead agency is bound by “reasonableness” and “good faith” in its analysis and that the lead agency is not required to respond to comments on the FEIR that do not identify significant environmental issues. Each response provided in this Final EIR is coded to correspond to the individual comment/author and each of the bracketed comments in that letter. A summary table is included with each response to identify if the response introduces “new 1 Introduction 2 Focused General Plan and Zoning Ordinance Update significant information” under any of the four categories identified in Section 15088 et seq. of the CEQA Guidelines. Evaluation of Comments Section 15088 et seq. of the State CEQA Guidelines provides guidance on the evaluation and response to comments received during circulation of the Draft SEIR. To summarize: The lead agency must evaluate all comments received during the public review period and prepare a written response to comments on significant environmental issues. The lead agency must provide the response to the commenting entity at least 10 days prior to certification of the EIR. The response must: o Identify any significant environmental issues raised in the comment; o Explain, if necessary, why any recommendations provided in the comment were not accepted; and o Be supported by reasoned analysis. Responses may be provided as direct revisions to the DEIR or as a separate section of the FEIR with marginal notes in the DEIR text indicated that it was subsequently revised. A lead agency is required to recirculate the DEIR if “significant new information” is introduced during the public comment period. “Significant new information” includes: 1. New significant impacts 2. Substantial increases in the severity of impacts 3. Feasible alternatives or mitigation that would reduce significant impacts 4. Identification of inadequacies in the analysis Recirculation is not required when new information is not significant; this includes: Revisions that clarify or amplify an adequate analysis Insignificant modifications (such as spelling and grammar corrections) Section 3: Errata This section identifies revisions to the Draft SEIR to incorporate clarifications developed in response to comments on the Draft SEIR. Additions to the text are underlined and deletions have been stricken through. No substantial revisions were made to the Draft SEIR, and recirculation of the document is not required pursuant to CEQA. Section 4: Notices and Distribution This consists of notices concerning the release of the Draft SEIR for public review and comment, and the list of agencies, groups and individuals who were sent notices and/or a copy of the Draft SEIR. Responses to Comments 2 Supplemental Environmental Impact Report 3 2 Responses to Comments The Draft Supplemental Environmental Impact Report (Draft SEIR) was circulated for a 45-day public review and comment period beginning December 4, 2014 and ending January 20, 2015. Correspondence was received from agencies and the public during this time period. The correspondence listed in Table 1 (Draft SEIR Comments) was submitted to the City of Vernon concerning the Draft SEIR. Written responses to comments are subsequently provided. The following responses to comments include a summary statement to identify if the response will introduce “new significant information” under any of the four categories identified in Section 15088 et seq. of the CEQA Guidelines or if it does not introduce “new significant information.” The four general categories are: 1. New significant impacts 2. Substantial increases in the severity of impacts 3. Feasible alternatives or mitigation that would reduce significant impacts 4. Identification of inadequacies in the analysis Table A DEIR Comments ID Commenting Agencies and Individuals Date A Native American Heritage Commission 12/08/14 B California Department of Transportation – District 7 01/05/15 C The Ness Companies 01/26/15 2 Responses to Comments 4 Focused General Plan and Zoning Ordinance Update This Page Intentionally Left Blank Responses to Comments 2 Supplemental Environmental Impact Report 5 Comment A – Native American Heritage Commission 2 Responses to Comments 6 Focused General Plan and Zoning Ordinance Update Responses to Comments 2 Supplemental Environmental Impact Report 7 2 Responses to Comments 8 Focused General Plan and Zoning Ordinance Update Response A - Native American Heritage Commission A-1 This comment states that the lead agency is required to assess whether the project will have an adverse impact on historical resources within the area of project effect. To adequately assess and mitigate project-related impacts, the comment includes recommended actions, including a record search, archaeological inventory survey, and a Sacred Lands File Check. The proposed project does not involve any development activity. At the time development applications are received, the City will evaluate the potential impacts to cultural resources on a project-by-project basis pursuant to CEQA/NEPA and may include a Sacred Lands File search and/or tribal consultation, as applicable. The City will comply with all applicable state and federal regulations regarding cultural resources. As stated in the 2012 Initial Study prepared for the proposed project, in the unlikely event that resources are discovered, compliance with existing regulatory procedures would be required. No further response is required. This response does not identify any new information. Responses to Comments 2 Supplemental Environmental Impact Report 9 Comment B – California Department of Transportation – District 7 2 Responses to Comments 10 Focused General Plan and Zoning Ordinance Update Responses to Comments 2 Supplemental Environmental Impact Report 11 Response B – California Department of Transportation – District 7 B-1 Caltrans states that a target LOS at the transition between LOS C and LOS D on State highway facilities should be maintained. If an existing State highway is operating at less than the appropriate target LOS, the existing measure of effectiveness should be maintained. Caltrans notes that Interstate 710 (I-710) currently operates near or at capacity during the peak hours and that the off-ramps at southbound I-710 and Bandini Boulevard and at northbound I-710 and Atlantic Boulevard should be analyzed. The traffic study prepared for the proposed project analyzed the City’s arterial street network and included analysis of the Atlantic Boulevard/Bandini Boulevard intersection, which interacts directly with the I- 710 on- and off-ramps. As discussed on page 4.4-2 of the SEIR, this intersection directly impacts the freeway interchange, particularly due to the substantial truck traffic in the area and trucks originating from the Hobart Rail Yard. Table 4.4-2 in the SEIR indicates that the Atlantic Boulevard/Bandini Boulevard intersection currently operates at LOS F during both the morning and evening peak periods. Engineering studies sponsored in part by the Gateway Cities Council of Governments call for improvements to the interchange that could include dedicated truck ramps. However, as stated on page 4.4-2 of the SEIR, detailed engineering plans and studies for this interchange will continue to concert with broader plans for improvements to I-710, with expected improvements to the interchange to be accomplished prior to 2030. The timing will depend upon State approvals and funding. The environmental documents for the I-710 improvement project, outlining the alternatives for this interchange, have yet to be released. Once implemented, the interchange improvements are expected to relieve a major traffic bottleneck and improve safety by separating autos from heavy truck traffic. This comment does not identify any significant new information and does not comment on the adequacy of the environmental analysis in the SEIR. B-2 Caltrans encourages the City of Vernon to work with neighboring cities to resolve traffic impacts on the freeways and State highways, particularly with regard to: x I-710 freeway on/off ramps x Cumulative traffic impacts x The need for fair-share payment of improvements at Atlantic Boulevard/Bandini Boulevard precedent to completion of the I-710 improvement project x Payment of traffic impact fees 2 Responses to Comments 12 Focused General Plan and Zoning Ordinance Update The Vernon General Plan Circulation Element already contains the following policies focused on regional cooperation to improve mobility, including both physical improvements and increased use of alternative transit modes. Policy CI-1.7: Encourage the continued improvement of services provided by the Los Angeles County Metropolitan Transit Authority to Vernon and adjacent cities to provide good access from home to job to job to home for persons employed in Vernon. Policy CI-1.9: Continue to work with Caltrans and neighboring jurisdictions to improve the Atlantic/Bandini/I-710 intersection and to make improvements to the I-710 Freeway, including direct truck ramps to the rail yards and exploring the potential for adding an interchange at Slauson Avenue to improve access to the City. Policy CI-1.12: Consider installing and maintaining an ATSAC system to improve traffic flow. Policy CI-1.13: Cooperate with the Metropolitan Transportation Authority and other local agencies in their efforts to complete a bicycle path along the levee of the Los Angeles River connecting to adjacent jurisdictions. The Gateway Cities Council of Governments, in which Vernon and adjacent jurisdictions participate, has initiated preparation of a Strategic Transportation Plan for the region. The consultant leading the effort will be completing a detailed study of freeways and arterials within the Gateway Cities region, with the goal of identifying a multitude of ways to improve regional mobility. The study will address multimodal mobility, including the improvements identified by Caltrans to I-710 ramps and the Atlantic Boulevard/Bandini Boulevard interchange. Also, the study will identify funding and financing strategies. The City notes that longer-term enhancements to the ramps and interchange will be accomplished as part of Caltrans’ I-710 improvement project. With regard to funding of long-term improvements, Vernon does not charge traffic impact fees at this time. Any improvements to the street/circulation system are funded consistent with Capital Improvement Program directives, with funding sources such as the general fund, gas tax proceeds, and grants. Other agencies are responsible for funding improvements to regional facilities such as freeway segments, interchanges, and ramps, and bus and transit facilities. State gas tax and other revenue sources—to which the City of Vernon and property and business owners contribute—pay for such improvements. This comment does not identify any significant new information and does not comment on the adequacy of the environmental analysis in the SEIR. Responses to Comments 2 Supplemental Environmental Impact Report 13 Comment C – The Ness Companies 2 Responses to Comments 14 Focused General Plan and Zoning Ordinance Update Responses to Comments 2 Supplemental Environmental Impact Report 15 Response C – The Ness Companies C-1 The commenter notes that for the past five years, the truck repair facility located at 3121 Fruitland Avenue has operated as a legal nonconforming use, as stated in a letter from Samuel Kevin Wilson, Director of Community Services & Water, dated September 1, 2011. This comment does not address the adequacy of the Draft SEIR. No response is required. 2 Responses to Comments 16 Focused General Plan and Zoning Ordinance Update This Page Intentionally Left Blank 17 Focused General Plan and Zoning Ordinance Update 3 Errata This section is intended to identify revisions to the Draft SEIR to incorporate clarifications developed in response to comments on the Draft SEIR or minor errors corrected through subsequent review. No clarifications or correction of errors have been identified. Therefore, no modifications to the SEIR have been prepared. 3 Errata 18 Focused General Plan and Zoning Ordinance Update This Page Intentionally Left Blank Supplemental Environmental Impact Report 19 4 Public Circulation Notice of Availability 4 Public Circulation 20 Focused General Plan and Zoning Ordinance Update Distribution The Notice of Availability (NOA) was distributed to all agencies on the standard notification list maintained by the Department of Community Services & Water (see following pages) and was posted at City Hall. The NOA and Notice of Completion (NOC) were sent to the State Clearinghouse for distribution to state agencies. Public Circulation 4 Supplemental Environmental Impact Report 21 4 Public Circulation 22 Focused General Plan and Zoning Ordinance Update Public Circulation 4 Supplemental Environmental Impact Report 23 Notice of Completion 4 Public Circulation 24 Focused General Plan and Zoning Ordinance Update Supplemental Environmental Impact Report 255 Mitigation Monitoring Reporting Program FOCUSED GENERAL PLAN AND ZONING ORDINANCE UPDATE Supplemental Environmental Impact Report: Mitigation Monitoring Reporting ProgramMitigation Measures Monitoring Timing/ Frequency Action Indicating Compliance Monitoring Agency Verification of Compliance Initials Date Remarks Hazards and Hazardous Materials Mitigation Measures H-1 The City will continue to implement the provisions of City ordinances to provide for the business occupancy inspection program and the regular inspection of businesses involved in the production, storage, handling, disposals, treatment, emission, discharge, or recycling of hazardous materials. Such activity will be funded as part of the City’s annual budgeting process, special tax, and/or will be funded as a fee program. Ongoing Conduct regular inspections Director of Environmental Health H-2 At the time any new or revised Hazardous Material Business application for a new business or activity is received for a location within one-quarter mile of any residence, school, hospital, residential assisted care facility, or similar use (sensitive uses may be located within the City or outside its boundaries), or greater distance as may be determined by the Director of Environmental Health Department for particular business types, the City will review the application and determine whether a Health Risk Assessment (HRA) is required pursuant to State law and/or City Ordinance 961 to address any potential impacts to these uses. If an HRA is deemed appropriate and further, if the HRA identifies potential risks associated with the business activity relative to proximity to the residence, school, hospital, residential assisted care facility or similar use, the City shall ensure that action is taken to address such risk. The action may consist of: - Denying the application within the limits of the Code of the City of Vernon, or - Requiring the business operator to incorporate preventative or ameliorative measures into the business processes or activities to lower the risk to acceptable levels as set forth by federal or state regulations and policies. At the time a new or revised HazardousMaterial Business application is received within one-quarter mile of any sensitive use Determine the need for a Health Risk Assessment Director of Environmental Health 5 Mitigation Monitoring Reporting Program 26Focused General Plan and Zoning Ordinance Update FOCUSED GENERAL PLAN AND ZONING ORDINANCE UPDATE Supplemental Environmental Impact Report: Mitigation Monitoring Reporting ProgramMitigation Measures Monitoring Timing/ Frequency Action Indicating Compliance Monitoring Agency Verification of Compliance Initials Date Remarks Noise Mitigation Measures N-1Noise Regulations. Continue to enforce City noise regulations contained in the Zoning Ordinance to protect residents and school children from excessive noise levels associated with stationary noise sources. Periodically evaluate regulations for adequacy and revise, as needed, to address community needs and changes in legislation and technology. Ongoing Continue enforcing City noise regulations Director of Community Services & Water N-2Siting of New Businesses and Activities near Sensitive Land Uses. Review all development proposals and building permits within the City to determine whether the proposed use has the potential to exceed City one-hour noise standards. The City’s standards are lower at locations near existing residences and schools. As appropriate, require acoustical analysis for all such development and activities near such uses, and determine if mitigation measures are required. Require property and business owners to implement mitigation to achieve City noise standards. At the time new development proposals and building permits are submitted As appropriate, require acoustical analysis for new uses near sensitive uses Director of Community Services & Water Transportation and Traffic Mitigation Measures T-1Automated Traffic Surveillance and Control System (ATSAC). Conduct a study to determine if ATSAC would be a beneficial and cost-effective system for the City to operate and maintain. Ongoing Conduct study on ATSAC system Public Works Director T-2Coordinate with Adjacent Jurisdictions. Continue to coordinate intersection maintenance and improvements with adjacent jurisdictions so that intersect5ions along Soto Street, Pacific Boulevard, Slauson Avenue, Alameda Street, Atlantic Boulevard, Bandini Boulevard, and Downey Road operate at an acceptable Level of Service.Ongoing Coordinate with adjacent jurisdictions Public Works Director T-3Coordinate with Rail Companies. Coordinate with railroad companies in removing obsolete rail spurs. Work to minimize traffic impacts to City streets from trucks using Hobart Yard facilities and other multi-modal transportation yards. Ongoing Coordinate with rail companies Public Works Director Mitigation Monitoring Reporting Program 5 Supplemental Environmental Impact Report 27FOCUSED GENERAL PLAN AND ZONING ORDINANCE UPDATE Supplemental Environmental Impact Report: Mitigation Monitoring Reporting ProgramMitigation Measures Monitoring Timing/ Frequency Action Indicating Compliance Monitoring Agency Verification of Compliance Initials Date Remarks T-4Coordination with Metropolitan Transportation Authority. Work with the Metropolitan Transportation Authority (Metro) to achieve the following: - Implement the Metro’s Congestion Management Plan (CMP) within the City. - Continue to provide local and regional connections through Metro local and rapid bus lines. - Improve access to local Metro stations. Ongoing Coordinate with Metropolitan Transportation Authority Public Works Director T-5Minimize Parking Impacts. Work with businesses to develop creative strategies and solutions to address parking shortages. Require new development projects to meet the minimum parking standards in the Zoning Ordinance for both trucks and automobiles, including truck trailer storage, employee parking, and visitor parking.Ongoing Work with existing businesses and require new development to meet minimum parkingstandards Public Works Director T-6Soto Street Widening. At the time properties along Soto Street are redeveloped or as otherwise dictated by City plans for the widening of Soto Street, require the dedication of rights-of-way to achieve the road standard for Soto Street established in the Circulation and Infrastructure Element. Complete the road widening project at the time adequate rights-of-way have been acquired and/or dedicated. At the time Soto Street is to be redeveloped or widened Require the dedication of rights-of-way Public Works Director T-7Interstate 710 Freeway Improvements. Work with Caltrans on all plans, activities, and projects regarding Interstate 710 that may directly impact Vernon’s roadway facilities and traffic patterns. Coordinate with the Gateway Cities Council of Governments and Southern California Association of Governments on studies and programs regarding the improvements to the I-710 freeway. Ongoing Coordinate with Caltrans and the Gateway Cities Council of Governments Public Works Director 5 Mitigation Monitoring Reporting Program 28Focused General Plan and Zoning Ordinance Update FOCUSED GENERAL PLAN AND ZONING ORDINANCE UPDATE Supplemental Environmental Impact Report: Mitigation Monitoring Reporting ProgramMitigation Measures Monitoring Timing/ Frequency Action Indicating Compliance Monitoring Agency Verification of Compliance Initials Date Remarks T-8Other Improvements. At Santa Fe Avenue and 38thStreet, stripe an eastbound left-turn lane within existing right-of-way to provide additional intersection capacity. Ongoing Completeimprovement at Santa Fe Avenue and 38thStreet Public Works Director Attachment G City of Vernon Focused General Plan and Zoning Ordinance Update Findings of Fact and Statement of Overriding Considerations SCH 2007061031 March 2015 City of Vernon This document is designed for double-sided printing to conserve natural resources. Supplemental Environmental Impact Report i Tab l e o f Co n t en t s 1 Findings of Fact ...................................................................................................................................................... 3 2 Findings on Significant and Unavoidable and Potentially Significant Impacts ........................................................ 5 3 Impacts Considered in the Initial Study but Found not to be Potentially Significant ................................................ 9 4 Findings on Project Alternatives Considered in the Environmental Impact Report ............................................... 11 5 Implementation Schedule ..................................................................................................................................... 15 6 Statement of Overriding Considerations ............................................................................................................... 17 Table of Contents ii Focused General Plan and Zoning Ordinance Update This Page Intentionally Left Blank Supplemental Environmental Impact Report 3 1 Fi n d i n g s o f Fac t In t r o d u c t i o n an d Pu r p o s e The proposed project addressed in these Findings of Fact is the City of Vernon Focused General Plan and Zoning Ordinance Update. The California Environmental Quality Act (CEQA) Statutes (Public Resources Code Sections 21000 through 21178), Section 21081 requires the Lead Agency (City of Vernon) to issue written findings for significant impacts identified in the Environmental Impact Report (EIR), accompanied by a brief rationale for each finding. Section 15091 of the CEQA Guidelines states that: “(a) No public agency shall approve or carry out a project for which an environmental impact report has been certified which identifies one or more significant environmental effects of the project unless the public agency makes one or more written findings for each of those significant effects, accompanied by a brief explanation of the rationale for each finding: The possible findings are: (1) Changes or alterations have been required in, or incorporated into, the project which avoid or substantially lessen the significant environmental effect as identified in the Final EIR. (2) Such changes or alterations are within the responsibility and jurisdiction of another public agency and have been, or can and should be, adopted by that other agency. (3) Specific economic, legal, social, technological, or other considerations, including considerations for the provision of employment opportunities for highly trained workers, make infeasible the mitigation measures or alternatives identified in the environmental impact report. (b) With respect to significant effects which were subject to a finding under paragraph (3) of subdivision (a), the public agency finds that specific overriding economic, legal, social, technological or other benefits of the project outweigh the significant effects on the environment.” In accordance with Section 21081 of the CEQA Statutes, whenever significant impacts cannot be substantially mitigated and remain unavoidable, the benefits of the proposed project must be balanced against the unavoidable environmental consequences in determining whether to approve the proposed project. The Lead Agency must make Findings of Fact and adopt a Statement of Overriding Considerations where the decision of the Lead Agency allows the occurrence of significant effects that are identified in the EIR, but are not substantially mitigated. This document sets forth the City of Vernon’s Findings and Statement of Overriding Considerations, pursuant to Section 21081 of the CEQA Statutes, as supported by substantial evidence in the record. Pr o j ec t Des c r i p t i o n The proposed project is the adoption and implementation of a focused updated to the City of Vernon General Plan, referred to herein as the General Plan, and the adoption of focused amendments to the City of Vernon Zoning Ordinance. The project consists of several components: x Update the Land Use Element to expand the locations where commercial uses and trucking and freight terminals can be established in the City. 1 Findings of Fact 4 Focused General Plan and Zoning Ordinance Update x Update the Land Use, Resources, Safety, and Noise Elements to comply all current State laws and to update pertinent information. x Update the Implementation Plan with new applicable policies related to the above revised policy changes. x Revise the Zoning Ordinance and Zoning Map to establish and apply a new Truck and Freight Terminal Overlay (TF) to over approximately 1,065 acres of land zoned for industrial use. x Revise the Zoning Ordinance and Zoning Map to replace and expand the existing Commercial Overlay with the new C-1 and C-2 Commercial Overlays, with the overlay zones to be applied to approximately 281 acres and 177 acres, respectively. x Establish a new Minor Conditional Use Permit process. x Provide standards for digital billboards. x Perform additional clean-up, non-substantive revisions to the Zoning Ordinance that do not affect any prior policy directives. In i t i al St u d y an d No t i c e o f Pr ep ar at i o n In accordance with Section 15063 of the CEQA Guidelines, a Lead Agency must conduct an Initial Study following preliminary review of a proposed project. Based on an initial project description, the City prepared an Initial Study in September of 2012, and prepared and published a Notice of Preparation (NOP). The NOP was circulated for public review and comment for a 30-day review period beginning on September 13, 2012. In accordance with CEQA Guidelines Section 15163, the City, as the Lead Agency, has prepared a Supplement to the previously certified General Plan and Zoning Ordinance Update Program Environmental Impact Report (SCH No. 2007061031). Mi t i g at i o n Mo n i t o r i n g Rep o r t i n g Pr o g r am As required by CEQA Statute 21081.6, a program for reporting on and monitoring mitigation measures will be adopted by the Lead Agency. L o c at i o n o f Do c u m en t s The Draft SEIR, Final SEIR, and administrative record for the City of Vernon Focused General Plan and Zoning Ordinance Update are available for review upon request at: City of Vernon, Community Services Department 4305 South Santa Fe Avenue Vernon, California 90058 (323) 583-8811 Supplemental Environmental Impact Report 5 2 Fi n d i n g s o n Si g n i f i c an t an d Un av o i d ab l e an d Po t en t i al l y Si g n i f i c an t Im p ac t s Di s c u s s i o n o f Fi n d i n g s Where, as a result of the environmental analysis of the proposed project and the compliance with existing laws, codes, and statutes, and the identification of feasible mitigation measures, potentially significant impacts have been determined by the City to be reduced to a level of less than significant. The City has found in accordance with CEQA Section 21081(a)(1) and CEQA Guidelines Section 15091(a)(1) that “(c)hanges or alterations have been required in, or incorporated into, the project which mitigate or avoid the significant effects on the environment.” Such a finding is referred to herein as Fi n d i n g 11. Where the City has determined pursuant to CEQA Section 21081(a)(2) and CEQA Guidelines Section 15091(a)(2) that “(t)hose changes or alterations are within the responsibility and jurisdiction of another public agency and have been, or can and should be, adopted by that other agency,” the City’s finding is referred to as Fi n d i n g 22. For the subject SEIR, this finding is not required to be made because all mitigation is under the jurisdiction of the Lead Agency. Where, as a result of the environmental analysis of the project, the City has determined that: a) even with the identification of project design features, compliance with existing laws, codes and statutes, and/or the identification of feasible mitigation measures, potentially significant impacts cannot be reduced to a level of less than significant; or b) no feasible mitigation measures or alternatives are available to mitigate the potentially significant impact, the City has found in accordance with CEQA Section 21081(a)(3) and CEQA Guidelines Section 15091(a)(3) that “(s)pecific economic, legal, social, technological, or other considerations, including considerations for the provision of employment opportunities for highly trained workers, make infeasible the mitigation measures or alternatives identified in the environmental impact report.” Such a finding is referred to as Fi n d i n g 33. References for discussion of environmental impacts within the SEIR are noted with each finding. Impact numbers refer to the section number and the threshold letter referenced in the SEIR where the full discussion of impacts is included. Tr an s p o r t at i o n an d Tr af f i c Im p ac t s 4.4.A an d 4.4.B Long-term implementation of land use policy, in combination with regional contributions to traffic on the local road network, as analyzed in the certified General Plan EIR, resulted in significant and unavoidable impacts. Impacts related to the addition of the Truck and Freight Overlay and the increase in the Commercial Overlay District will not be substantial when compared to the analysis provided in the certified General Plan EIR. Consistent with the certified General Plan EIR, impacts will remain significant and unavoidable. Evidence supporting the fact that the environmental effects identified in Impacts 4.4.A and 4.4.B are unavoidable is provided in Section 4.4 of the SEIR. The certified General Plan EIR identifies physical improvements to a number of roadways that will improve local and regional traffic flow. Circulation and Infrastructure Element Policy CI-1.12 and Mitigation Measure T-1, over the long term, provide for installation and maintenance of an Intelligent Transportation System (ITS) that will improve traffic flow. Implementation of these improvements is anticipated to increase circulation system performance. Other mitigation measures, listed below, were also incorporated to further reduce potential circulation system impacts related to coordinating with adjacent jurisdictions, agencies, and rail companies to minimize traffic interference. However, due to the lack of right-of-way to make additional physical improvements, lack of local control over regional system elements, and uncertainty in funding, impacts were determined to be significant and unavoidable. Implementation of the Truck and Freight Overlay and the increase in the Commercial 2 Findings on Significant and Unavoidable and Potentially Significant Impacts 6 Focused General Plan and Zoning Ordinance Update Overlay District will not be substantial when compared to the analysis provided in the certified General Plan EIR. Consistent with the certified General Plan EIR, impacts will remain significant and unavoidable. T-1 A u t o m at ed Tr af f i c Su r v ei l l an c e an d Co n t r o l Sy s t em (A TSA C).. Conduct a study to determine if ATSAC would be a beneficial and cost-effective system for the City to operate and maintain. T-2 Co o r d i n at e w i t h A d j ac en t J u r i s d i c t i o n s .. Continue to coordinate intersection maintenance and improvements with adjacent jurisdictions so that intersections along Soto Street, Pacific Boulevard, Slauson Avenue, Alameda Street, Atlantic Boulevard, Bandini Boulevard, and Downey Road operate at an acceptable Level of Service. T-3 Co o r d i n at e w i t h Rai l Co m p an i es . Coordinate with railroad companies in removing obsolete rail spurs. Work to minimize traffic impacts to City streets from trucks using Hobart Yard facilities and other multi-modal transportation yards. T-4 Co o r d i n at i o n w i t h Met r o p o l i t an Tr an s p o r t at i o n A u t h o r i t y .. Work with the Metropolitan Transportation Authority (Metro) to achieve the following: -Implement the Metro’s Congestion Management Plan (CMP) within the City. -Continue to provide local and regional connections through Metro local and rapid bus lines. -Improve access to local Metro stations. T-5 Mi n i m i ze Par k i n g Im p ac t s .. Work with businesses to develop creative strategies and solutions to address parking shortages. Require new development projects to meet the minimum parking standards in the Zoning Ordinance for both trucks and automobiles, including truck trailer storage, employee parking, and visitor parking. T-6 So t o St r eet Wi d en i n g .. At the time properties along Soto Street are redeveloped or as otherwise dictated by City plans for the widening of Soto Street, require the dedication of rights-of-way to achieve the road standard for Soto Street established in the Circulation and Infrastructure Element. Complete the road widening project at the time adequate rights-of-way have been acquired and/or dedicated. T-7 In t er s t at e 710 Fr eew ay Im p r o v em en t s .. Work with Caltrans on all plans, activities, and projects regarding Intersection 710 that may directly impact Vernon’s roadway facilities and traffic patterns. Coordinate with the Gateway Cities Council of Governments and Southern California Association of Governments on studies and programs regarding the improvements to the I-710 freeway. T-8 Ot h er Im p r o v em en t s .. At Santa Fe Avenue and 38th Street, stripe an eastbound left-turn lane within existing right-of-way to provide additional intersection capacity. Fi n d i n g Regarding Impacts 4.4.A and 4.4.B, the City hereby makes Fi n d i n g 3 that no feasible mitigation measures or alternatives exist to mitigate the above-discussed potentially significant impacts to less-than-significant levels. Findings on Significant and Unavoidable and Potentially Significant Impacts 2 Supplemental Environmental Impact Report 7 Fi n d i n g s o n Si g n i f i c an t Im p ac t s t h at Can B e Mi t i g at ed Hazar d s an d Hazar d o u s Mat er i al s Im p ac t s 4.2.A , 4.2.B , an d 4.2.C Section 4.2 (Hazards and Hazardous Materials) of the SEIR identifies significant impacts involving the use, transport, and disposal of hazardous materials and wastes. The project could result in potentially a significant impact involving the use, transport, and disposal of hazardous materials, as 40 to 60 percent of all businesses in Vernon store, use, or manufacture hazardous materials to the extent that a City hazardous materials permit is required. However, pursuant to the discussion in Section 4.2 of the SEIR, any potentially significant impacts involving hazards can be reduced to a level of insignificance with mitigation and implementation of General Plan policies and actions. Accordingly, based on substantial evidence in the SEIR and the Public Record of Proceedings, the City finds and declares that, pursuant to CEQA Guidelines 15091(a), changes or alterations have been required in, or incorporated into the project which will avoid, mitigate, or substantially lessen any of the project’s impacts involving hazardous materials to a less-than-significant level. Any impact involving hazards has been eliminated or substantially lessened to a level that is less than significant by virtue of the following mitigation measures as identified by the certified General Plan EIR, and incorporated into the project. H-1 The City will continue to implement the provisions of City ordinances to provide for the business occupancy inspection program and the regular inspection of businesses involved in the production, storage, handling, disposal, treatment, emission, discharge, or recycling of hazardous materials. Such activity will be funded as part of the City’s annual budgeting process, special tax, and/or will be funded as a fee program. H-2 At the time any new or revised Hazardous Material Business application for a new business or activity is received for a location within one-quarter mile of any residence, school, hospital, residential assisted care facility, or similar use (sensitive uses may be located within the City or outside its boundaries), or greater distance as may be determined by the Director of Environmental Health Department for particular business types, the City will review the application and determine whether a Health Risk Assessment (HRA) is required pursuant to State law and/or City Ordinance 961 to address any potential impacts to these uses. If an HRA is deemed appropriate and further, if the HRA identifies potential risks associated with the business activity relative to proximity to the residence, school, hospital, residential assisted care facility or similar use, the City shall ensure that action is taken to address such risk. The action may consist of: -Denying the application within the limits of the Code of the City of Vernon, or -Requiring the business operator to incorporate preventative or ameliorative measures into the business processes or activities to lower the risk to acceptable levels, as set forth by federal or state regulations and policies. Mitigation Measure H-1 ensures that the City will continue to provide for the business occupancy inspection program and the regular inspection of businesses. Mitigation Measure H-2 ensures that a Health Risk Assessment will be prepared when the City deems it appropriate to address risks to any nearby sensitive receptors. Therefore, the project will have a less-than-significant impact with mitigation. 2 Findings on Significant and Unavoidable and Potentially Significant Impacts 8 Focused General Plan and Zoning Ordinance Update Fi n d i n g Regarding Impacts 4.2.A, 4.2.B, and 4.2.C, the City hereby makes Finding 1 that changes or alterations have been required in, or incorporated into, the project that mitigate or avoid the significant effects on the environment. No i s e Section 4.3 of the SEIR analyzes the potential for significant impacts involving noise from long-term implementation of the General Plan land use plan. However, pursuant to the discussion in Section 4.3 of the EIR, any potentially significant impacts related to future development can be reduced to a level of insignificance with mitigation. The City concurs in this analysis. Accordingly, based on substantial evidence in the EIR and the Public Record of Proceedings, the City finds and declares that, pursuant to CEQA Guidelines 15091(a), changes or alterations have been required in, or incorporated into the Project which will avoid, mitigate, or substantially lessen any future impacts involving short- and long-term noise to a less than significant level. Implementation of the focused General Plan and Zoning Ordinance update may result in future development with the potential to produce noise during construction and operations. Any impacts related to noise due to future development will be analyzed on a case-by-case basis. Any impact resulting from short- and long-term noise can been substantially lessened to a level that is less than significant by virtue of the following mitigation measures, as identified by the certified General Plan EIR and incorporated into the project. N-1 No i s e Reg u l at i o n s .. Continue to enforce City noise regulations contained in the Zoning Ordinance to protect residents and school children from excessive noise levels associated with stationary noise sources. Periodically evaluate regulations for adequacy and revise, as needed, to address community needs and changes in legislation and technology. N-2 Si t i n g o f New B u s i n es s es an d A c t i v i t i es n ear Sen s i t i v e L an d Us es .. Review all development proposals and building permits within the City to determine whether the proposed use has the potential to exceed City one-hour noise standards. The City’s standards are lower at locations near existing residences and schools. As appropriate, require acoustical analyses for all such development and activities near such uses, and determine if mitigation measures are required. Require property and business owners to implement mitigation to achieve City noise standards. Mitigation Measures N-1 and N-2 ensure that the City will continue to enforce noise regulations and review all development proposals and building permits to determine whether a proposed use has the potential to exceed City noise standards. Therefore, the project will have a less-than-significant impact with mitigation. Fi n d i n g Regarding impacts related to noise, the City hereby makes Finding 1 that changes or alterations have been required in, or incorporated into, the project that mitigate or avoid significant effects on the environment. Supplemental Environmental Impact Report 9 3 Im p ac t s Co n s i d er ed i n t h e In i t i al St u d y b u t Fo u n d n o t t o B e Po t en t i al l y Si g n i f i c an t The City conducted an Initial Study dated September 12, 2012 for the purpose of determining whether the project would result in potentially significant environmental impacts beyond those analyzed in the certified General Plan EIR. The analysis in the Initial Study concluded that, consistent with the certified General Plan EIR, potentially significant impacts would result relative to air quality, hazards and hazardous materials, transportation/traffic, water supply and solid waste, and noise. These impacts were examined in the Supplemental EIR, with the conclusions made in the Final SEIR as presented in Section 2 of this document. The Initial Study further concluded that no potentially significant impacts or less-than-significant impacts would result relative to: x Aesthetics x Agricultural Resources x Air Quality: Air Quality Plan, Objectionable Odors x Biological Resources x Cultural Resources x Geology and Soils x Hazardous Materials: Airport Land Use Plan hazards, airstrip safety hazards, impair implementation or interfere with an adopted emergency response plan, and exposure to wildland fires x Hydrology and Water Quality: Violate water quality standards, alter existing drainage pattern resulting in flooding or erosion, create or contribute to runoff water, degrade water quality, place housing or structures within a 100-year flood hazard area, expose people to loss related to failure of dam or levee, inundation by seiche, tsunami, or mudflow x Land Use and Planning x Mineral Resources x Noise: Expose people to substantial airport noise proximate to airport land use plan or airstrip x Population and Housing x Public Services x Recreation x Transportation and Traffic: Result in a change in air traffic patterns or substantially increase hazards due to design features, increase hazards due to design feature, result in inadequate emergency access, parking capacity, and conflict with policies supporting alternative transportation. x Utilities The analysis and findings relative to the above environmental issues are contained in the Initial Study, which is included as Appendix A of the SEIR, and are incorporated herein by reference. 3 Impacts Considered in the Initial Study but Found not to be Potentially Significant 10 Focused General Plan and Zoning Ordinance Update This Page Intentionally Left Blank Supplemental Environmental Impact Report 11 4 Fi n d i n g s o n Pr o j ec t A l t er n at i v es Co n s i d er ed i n t h e En v i r o n m en t al Im p ac t Rep o r t The Alternatives section of the Supplemental EIR was prepared in accordance with CEQA Guidelines Section 15126(d), which requires the analysis of a reasonable range of alternatives capable of eliminating or reducing significant adverse environmental effects of the proposed project. The Alternatives section analyzes the effects of the following alternatives: 1) No Project/Existing General Plan 2) Additional railway/roadway grade separations 3) Zoning Ordinance provisions that allow warehousing facilities of less than 50,000 square feet citywide 4) No truck and freight terminal overlay A l t er n at i v e 1. No Pr o j ec t /Ex i s t i n g Gen er al Pl an The purpose of analyzing a No Project Alternative is to allow decision-makers to compare the impacts of approving the proposed project to the impacts of not approving the project. This alternative assumes that the focused General Plan and Zoning Ordinance updates would not be adopted and implemented. Instead, the development in the City would continue to occur in conformance with the current land use policy map and current zoning regulations, as described in the certified EIR. The General Plan update analyzed in the certified EIR included the establishment of a Commercial Overlay District and the elimination of the so-called 2009 Rule that required all businesses that have nonconforming parking and/or loading facilities to achieve conformity by 2009. The No Project alternative would have resulted in the continued implementation of the 2009 Rule and the General Plan land uses without the Commercial Overlay. In particular, the current Commercial Overlay would remain in effect; the focused General Plan and Zoning Ordinance updates would replace the current Commercial Overlay with two expanded C-1 and C-2 Overlays along Santa Fe Avenue, Pacific Boulevard, Soto Street north of Fruitland Avenue, East Slauson Avenue, and along the eastern boundary of the City. Also, the No Project alternative would not involve establishment of a Truck and Freight Terminal north of 37th Street west of Downey Road and north of the Los Angeles River east of Downey Road. The No Project alternative analyzed in the certified EIR has the potential to accelerate privately initiated reuse and redevelopment activity due to the application of the 2009 Rule and thereby, possibly to reduce overall building area in Vernon. The certified EIR determined that depending on the types of development proposed over the long term, reduced development citywide would reduce vehicle trips and associated air emissions, and decrease demand for potable water. Vernon consists almost entirely of industrial uses, and the extent of businesses using or storing hazardous materials could be expected to remain, depending upon the individual new uses established over the long term. The SEIR concluded the overall level of impact of Alternative 1 would be slightly lower than that associated with the proposed project. The continued application of the 2009 Rule has the potential to improve traffic flow on City streets, as on-street loading activity would be prohibited and on-street parking minimized due to the enforcement of off-street parking requirements. In this regard, the No Project Alternative was considered environmentally superior to the proposed project. With regard to noise impacts, almost all local impacts are associated with regional traffic noise and rail traffic, neither of which would be expected to be affected by the No Project scenario. No change in impact would result. The General Plan Land Use plan designates the entire city as Industrial, with commercial uses allowed only within the designated Commercial Overlay and new residential uses limited to a strictly defined housing overlay area. The proposed project includes the expansion and implementation of two commercial overlay zones and the establishment 4 Findings on Project Alternatives Considered in the Environmental Impact Report 12 Focused General Plan and Zoning Ordinance Update of a Truck and Freight Terminal Overlay Zone. The focused General Plan and Zoning Ordinance updates do not propose any changes to underlying land use designations or building intensities. Consistent with the adopted General Plan, privately initiated reuse and redevelopment activity would result in overall reduced building area in Vernon with the enforcement of parking and setback requirements. Impacts related to air quality, hazards, noise, traffic, and utilities for the No Project alternative would be equivalent to impacts associated with the proposed project. Fi n d i n g Specific economic and public health and safety considerations make this alternative infeasible. Fac t s i n Su p p o r t o f t h e Fi n di n g New policies and zoning regulations will facilitate establishment of commercial uses in close proximity to industrial businesses, which will benefit the local economy by providing new tax-generating uses. Also, locating commercial uses in Vernon in limited areas will allow employees of industrial businesses to travel shorter distances for restaurants, goods, and services, which will reduce vehicle miles traveled and associated emissions. Establishing the Trucking and Freight Overlay will allow such uses to be established nearer the businesses and logistics centers dependent upon trucking operations. Based on these facts and findings, the City rejects adoption of this alternative. A l t er n at i v e 2. A d d i t i o n al Rai l w ay /Ro ad w ay Gr ad e Sep ar at i o n s Many rail lines cross streets in Vernon at grade, with frequent train activity between the ports of Los Angeles and Long Beach largely serving the Hobart Yard and other regional cargo redistribution facilities. Intense rail activity historically has created rail/roadway conflicts in Vernon. However, as stated in the certified General Plan EIR, the City has experienced a substantial decrease in rail traffic and associated congestion as a result of the 2002 completion of the expressway Alameda Corridor. The key environmental impact identified in the certified General Plan EIR was traffic, with delays continuing to be associated in part by rail operations. This alternative, as analyzed in the certified EIR, considers including specific policies in the General Plan to pursue rail/road grade separations at Bandini Boulevard/Downey Road, Pacific Avenue, Vernon Avenue, and District Boulevard/Downey Road. The Circulation and Infrastructure Element, which was analyzed previously in the certified General Plan EIR, includes the following policy, which is non-specific regarding grade separations to be pursued: POLICY CI-1.6: Continue to pursue grade separation for railroad crossings on designated streets. The City has not conducted an analysis of the effects of providing grade separations at the above locations. However, such improvements would have the potential to improve traffic flow and possibly result in reduced air pollutant emissions due to reduced vehicle idling time while waiting for trains to cross roadways. With this assumption, traffic and air quality impacts associated with Alternative 2 would be expected to be reduced relative to the proposed project. With regard to hazards, increased grade separations would reduce the risk of train/roadway vehicle accidents at those locations where separations would be provided. Risk of upset would be slightly reduced. With regard to water use, grade separations would have no effect. Fi n d i n g Specific economic considerations make this alternative infeasible. Fac t s i n Su p p o r t o f t h e Fi n di n g The City has not identified funding for any grade separations in its current Capital Improvement Program (CIP). Also, responsible rail companies have not identified or funded any separations to be accomplished. Based on these facts and findings, the City rejects adoption of this alternative. Findings on Project Alternatives Considered in the Environmental Impact Report 4 Supplemental Environmental Impact Report 13 A l t er n at i v e 3. Zo n i n g Pr o v i s i o n s t o Per m i t War eh o u s i n g Ci t y w i d e At the time of preparation of the certified General Plan EIR, the Zoning Ordinance did not allow new non-refrigerated warehouse facilities larger than 50,000 square feet to locate anywhere in Vernon. The certified General Plan EIR examined the alternative of allowing non-refrigerated warehouse facilities of less than 50,000 square feet to be established (Alternative 3). However, since certification of the Program EIR, the Zoning Ordinance has been amended to allow warehouses uses of any size to locate within the Industrial zone, which encompasses the entire city. Therefore, Alternative 3 analyzed in the certified EIR is no longer applicable and was not discussed or analyzed further in the Supplemental EIR. A l t er n at i v e 4. No Tr u c k an d Fr ei g h t Ter m i n al Ov er l ay This alternative assumes that the proposed Truck and Freight Terminal Overlay Zone would not be established. The proposed focused General Plan and Zoning Ordinance updates provide for a Truck and Freight Terminal Overlay Zone to be applied north of 37th Street and the Los Angeles River and to encompass approximately 1,065 acres. The Vernon Zoning Ordinance defines a freight terminal as a location where goods or freight are transferred or redistributed from one vehicle to another. A truck terminal is defined as a facility used primarily for storage, maintenance, or servicing of highway-type vehicles, not limited to trucks and buses. Elimination of the Truck and Freight Terminal Overlay Zone from the proposed project has the potential to reduce traffic, air quality, and noise impacts. Freight terminals include high turnover of transported goods, resulting in increased and continuous truck trips in the area. Diesel trucks are a major contributor to PM2.5 concentrations, and truck and freight terminal uses could increase the number of diesel trucks on local roads, thereby increasing the area’s PM2.5 concentrations. Overall, local and regional air quality impacts would be reduced under this alternative. Because truck and freight terminal use, if allowed, could result in additional truck traffic due to the intensive trucking operations associated with such uses, impacts on the transportation system could be slightly reduced if exclusive without truck and freight terminal uses were not allowed as proposed. The largest contributor to the ambient noise environment in Vernon is vehicle traffic, especially that of heavy-duty trucks. Noise also is associated with many of the industrial operations occurring citywide. Truck and freight terminal uses would contribute to noise from the delivery systems inherent in their operations, with large trucks driving into the City for deliveries, pick-ups, and servicing. On site, most noise is generated by loading dock operations, trucks entering and leaving the area, and mechanical equipment located both inside and outside the building. As truck and freight terminal uses may have higher levels of noise on site associated with the continuous loading and unloading of goods, noise impacts would be slightly reduced if truck and freight terminal uses were not allowed. However, given the almost exclusively industrial nature of Vernon, noise levels generally are not considered a concern. Many industrial facilities in Vernon use and store hazardous materials. Businesses are required to obtain hazardous materials permits for keeping those materials at the business. In the Industrial zone, hazardous waste facilities require a Conditional Use Permit. The uses—whether warehousing, manufacturing, or truck and freight terminal— would be subject to the same local, state, and federal regulations regarding hazardous materials. Because a similar amount and type of hazardous materials would likely be present in the planning area under this alternative, this alternative would result in a similar impact related to hazards, which is less than significant. Trucking and freight terminal uses are relatively low impact on water and solid waste systems, in comparison to many industrial uses. Industrial uses have the potential to be very water intensive, especially if water is used for cooling in an industrial process. Truck and freight terminals, by comparison, generally use less water. Additionally, because manufacturing does not occur on site with truck and freight terminal uses, the level of waste generated would be comparably less. The primary waste product from truck and freight terminal activities is likely to be packaging materials and waste from the repair and maintenance of vehicles. Overall, the impact on utilities (excluding roads) would be slightly increased if truck and terminal uses were not allowed. 4 Findings on Project Alternatives Considered in the Environmental Impact Report 14 Focused General Plan and Zoning Ordinance Update Fi n d i n g The City finds that Alternative 4 represents an acceptable alternative, as it would represent continued application of current land use regulations and would result in slightly reduced impacts related to air quality, hazards, traffic, water, and landfills. Supplemental Environmental Impact Report 15 5 Im p l em en t at i o n Sc h ed u l e Given the long-term nature of General Plan implementation and enforcement of Zoning Ordinance regulations, the mitigation measures set forth in Section 2 of this document and documented in the Final SEIR will be implemented over time as needed. 5 Implementation Schedule 16 Focused General Plan and Zoning Ordinance Update This Page Intentionally Left Blank Supplemental Environmental Impact Report 17 6 St at em en t o f Ov er r i d i n g Co n s i d er at i o n s The California Environmental Quality Act (CEQA) requires that a Lead Agency balance the benefits of a project against its unavoidable environmental risk in determining whether to approve the project. If the benefits outweigh the unavoidable adverse effects, those effects may be considered “acceptable” pursuant to CEQA Guidelines Section 15093(a). CEQA requires that a Lead Agency support, in writing, the specific reasons for considering a project acceptable when significant impacts are infeasible to mitigate. Those reasons must be based on substantial evidence in the Environmental Impact Report (EIR) or elsewhere in the administrative record pursuant to CEQA Guidelines Section 15093(b). The Lead Agency’s written reasons are referred to as a Statement of Overriding Considerations. The City will approve the City of Vernon Focused General Plan and Zoning Ordinance updates and implementing actions, and has prepared a Supplemental EIR that satisfies the requirements of CEQA. The following adverse impacts of the proposed project are considered significant and unavoidable based on the analysis in the Draft SEIR, Final SEIR, and the Findings of Fact. Im p ac t 4.4.A an d 4.4.B : Ci r c u l at i o n Sy s t em Per f o r m an c e. Long-term implementation of land use policy, in combination with regional contributions to traffic on the local road network, will cause an increase in traffic that will result in inadequate Level of Service. Impacts will be significant and unavoidable. The City has determined that the SEIR has identified and discussed significant effects which may occur as a result of the proposed project. With the implementation of the policies of the General Plan and mitigation measures identified in the certified General Plan EIR, these effects can be reduced to levels of less than significant except for the significant impacts identified above, consistent with the findings of the certified General Plan EIR. The City declares that, having reduced the adverse significant environmental effects of the proposed project to the extent feasible, having considered the entire administrative record on the proposed project, and having weighed the benefits of the proposed project against its unavoidable adverse impacts, the City has determined that each of the following social, economic, and environmental benefits of the proposed project separately and individually outweigh the potential unavoidable adverse impacts, and render those potential adverse environmental impacts acceptable based upon the following overriding considerations: 1.L o n g -Ter m Fi s c al St ab i l i t y an d Di v er s i t y o f J o b s .. Implementation of Land Use Element policies and application of Zoning Ordinance provisions will allow the City to maintain a strong tax base and thereby provide for long-term fiscal stability. Land use policies and zoning regulations will allow Vernon to continue to be largely an industrial city, where diverse businesses provide jobs for skilled workers in varied industries. As a city focused on industry, Vernon fills a unique role in the region as a location where industrial businesses are welcomed. 2.In c r eas ed Reg u l at i o n o f B u s i n es s es L o c at i n g n ear Res i d en c es an d Sc h o o l s . The General Plan includes policies, implemented through the Zoning Ordinance, that require new businesses locating within one-tenth of a mile of residences and schools—both in Vernon and adjacent cities—to maintain noise at levels that will not adversely affect conditions at these sensitive receptors. 3.A c c o m m o d at i n g L i m i t ed Co m m er c i al Us es .. General Plan land use policy, implemented through the Zoning Ordinance, will allow commercial uses to establish along key corridors in Vernon and provide needed goods and services for local employees. The benefits include additional tax revenues to fund City services and reduced vehicle miles traveled/associated vehicle emissions due to more localized availability of commercial goods and services. 6 Statement of Overriding Considerations 18 Focused General Plan and Zoning Ordinance Update 4.L eg al l y A d eq u at e Gen er al Pl an .. The updated General Plan contains all components required by State law and establishes a clear framework for decision-making. 5.Zo n i n g Or d i n an c e Co n s i s t en t w i t h t h e Gen er al Pl an .. By completing update of the General Plan and Zoning Ordinance simultaneously, full consistency between the two can be achieved, and the Zoning Ordinance can serve as an effective tool for implementing goals and policies contained in the General Plan. Attachment H Supplemental Environmental Impact Report 255 Mitigation Monitoring Reporting Program FOCUSED GENERAL PLAN AND ZONING ORDINANCE UPDATE Supplemental Environmental Impact Report: Mitigation Monitoring Reporting ProgramMitigation Measures Monitoring Timing/ Frequency Action Indicating Compliance Monitoring Agency Verification of Compliance Initials Date Remarks Hazards and Hazardous Materials Mitigation Measures H-1 The City will continue to implement the provisions of City ordinances to provide for the business occupancy inspection program and the regular inspection of businesses involved in the production, storage, handling, disposals, treatment, emission, discharge, or recycling of hazardous materials. Such activity will be funded as part of the City’s annual budgeting process, special tax, and/or will be funded as a fee program. Ongoing Conduct regular inspections Director of Environmental Health H-2 At the time any new or revised Hazardous Material Business application for a new business or activity is received for a location within one-quarter mile of any residence, school, hospital, residential assisted care facility, or similar use (sensitive uses may be located within the City or outside its boundaries), or greater distance as may be determined by the Director of Environmental Health Department for particular business types, the City will review the application and determine whether a Health Risk Assessment (HRA) is required pursuant to State law and/or City Ordinance 961 to address any potential impacts to these uses. If an HRA is deemed appropriate and further, if the HRA identifies potential risks associated with the business activity relative to proximity to the residence, school, hospital, residential assisted care facility or similar use, the City shall ensure that action is taken to address such risk. The action may consist of: - Denying the application within the limits of the Code of the City of Vernon, or - Requiring the business operator to incorporate preventative or ameliorative measures into the business processes or activities to lower the risk to acceptable levels as set forth by federal or state regulations and policies. At the time a new or revised HazardousMaterial Business application is received within one-quarter mile of any sensitive use Determine the need for a Health Risk Assessment Director of Environmental Health 5 Mitigation Monitoring Reporting Program 26Focused General Plan and Zoning Ordinance Update FOCUSED GENERAL PLAN AND ZONING ORDINANCE UPDATE Supplemental Environmental Impact Report: Mitigation Monitoring Reporting ProgramMitigation Measures Monitoring Timing/ Frequency Action Indicating Compliance Monitoring Agency Verification of Compliance Initials Date Remarks Noise Mitigation Measures N-1Noise Regulations. Continue to enforce City noise regulations contained in the Zoning Ordinance to protect residents and school children from excessive noise levels associated with stationary noise sources. Periodically evaluate regulations for adequacy and revise, as needed, to address community needs and changes in legislation and technology. Ongoing Continue enforcing City noise regulations Director of Community Services & Water N-2Siting of New Businesses and Activities near Sensitive Land Uses. Review all development proposals and building permits within the City to determine whether the proposed use has the potential to exceed City one-hour noise standards. The City’s standards are lower at locations near existing residences and schools. As appropriate, require acoustical analysis for all such development and activities near such uses, and determine if mitigation measures are required. Require property and business owners to implement mitigation to achieve City noise standards. At the time new development proposals and building permits are submitted As appropriate, require acoustical analysis for new uses near sensitive uses Director of Community Services & Water Transportation and Traffic Mitigation Measures T-1Automated Traffic Surveillance and Control System (ATSAC). Conduct a study to determine if ATSAC would be a beneficial and cost-effective system for the City to operate and maintain. Ongoing Conduct study on ATSAC system Public Works Director T-2Coordinate with Adjacent Jurisdictions. Continue to coordinate intersection maintenance and improvements with adjacent jurisdictions so that intersect5ions along Soto Street, Pacific Boulevard, Slauson Avenue, Alameda Street, Atlantic Boulevard, Bandini Boulevard, and Downey Road operate at an acceptable Level of Service.Ongoing Coordinate with adjacent jurisdictions Public Works Director T-3Coordinate with Rail Companies. Coordinate with railroad companies in removing obsolete rail spurs. Work to minimize traffic impacts to City streets from trucks using Hobart Yard facilities and other multi-modal transportation yards. Ongoing Coordinate with rail companies Public Works Director Mitigation Monitoring Reporting Program 5 Supplemental Environmental Impact Report 27FOCUSED GENERAL PLAN AND ZONING ORDINANCE UPDATE Supplemental Environmental Impact Report: Mitigation Monitoring Reporting ProgramMitigation Measures Monitoring Timing/ Frequency Action Indicating Compliance Monitoring Agency Verification of Compliance Initials Date Remarks T-4Coordination with Metropolitan Transportation Authority. Work with the Metropolitan Transportation Authority (Metro) to achieve the following: - Implement the Metro’s Congestion Management Plan (CMP) within the City. - Continue to provide local and regional connections through Metro local and rapid bus lines. - Improve access to local Metro stations. Ongoing Coordinate with Metropolitan Transportation Authority Public Works Director T-5Minimize Parking Impacts. Work with businesses to develop creative strategies and solutions to address parking shortages. Require new development projects to meet the minimum parking standards in the Zoning Ordinance for both trucks and automobiles, including truck trailer storage, employee parking, and visitor parking.Ongoing Work with existing businesses and require new development to meet minimum parkingstandards Public Works Director T-6Soto Street Widening. At the time properties along Soto Street are redeveloped or as otherwise dictated by City plans for the widening of Soto Street, require the dedication of rights-of-way to achieve the road standard for Soto Street established in the Circulation and Infrastructure Element. Complete the road widening project at the time adequate rights-of-way have been acquired and/or dedicated. At the time Soto Street is to be redeveloped or widened Require the dedication of rights-of-way Public Works Director T-7Interstate 710 Freeway Improvements. Work with Caltrans on all plans, activities, and projects regarding Interstate 710 that may directly impact Vernon’s roadway facilities and traffic patterns. Coordinate with the Gateway Cities Council of Governments and Southern California Association of Governments on studies and programs regarding the improvements to the I-710 freeway. Ongoing Coordinate with Caltrans and the Gateway Cities Council of Governments Public Works Director 5 Mitigation Monitoring Reporting Program 28Focused General Plan and Zoning Ordinance Update FOCUSED GENERAL PLAN AND ZONING ORDINANCE UPDATE Supplemental Environmental Impact Report: Mitigation Monitoring Reporting ProgramMitigation Measures Monitoring Timing/ Frequency Action Indicating Compliance Monitoring Agency Verification of Compliance Initials Date Remarks T-8Other Improvements. At Santa Fe Avenue and 38thStreet, stripe an eastbound left-turn lane within existing right-of-way to provide additional intersection capacity. Ongoing Completeimprovement at Santa Fe Avenue and 38thStreet Public Works Director © 2020 Microsoft Corporation © 2020 Maxar ©CNES (2020) Distribution Airbus DS City of VernonSANTA FE AVENUEEAST VERNON AVENUE2332/2334 E.Vernon Ave.Proposed lots to be rezoned to Housing Zone2328 E.Vernon Ave. NOTICE OF CITY COUNCIL PUBLIC HEARING The City Council of the City of Vernon will conduct a public hearing, which you may attend, at Vernon City Hall, City Council Chamber, 4305 Santa Fe Avenue, Vernon, CA 90058, on Tuesday, September 1, 2020, at 9:00 a.m. (or as soon thereafter as the matter can be heard), to: Consider adoption of an ordinance amending Chapter 26 modifying the Comprehensive Zoning Map of the City of Vernon to include the properties located at 2328 and 2332/2334 E. Vernon Ave, Vernon, California 90058 in the Housing Overlay Zone. The proposed ordinance will be available for public review on the City’s website once the agenda for the meeting is posted or from the City Clerk at CityClerk@ci.vernon.ca.us or 323-583-8811, ext. 546. Please send your comments or questions to: Daniel Wall, Director of Public Works City of Vernon 4305 Santa Fe Avenue, Vernon, CA 90058 (323) 583-8811 Ext. 305 Email: dwall@ci.vernon.ca.us PROPOSED CEQA FINDING: Find that the proposed action is exempt under the California Environmental Quality Act (“CEQA”) review, because it is continuing administrative activity that will not result in any direct or indirect physical changes in the environment, and therefore does not constitute a “project” as defined by CEQA Guidelines section 15378, and to the extent the property owner seeks to engage in actual physical construction or development, such would be subject to separate and independent CEQA review and analysis. If you challenge the adoption of the proposed ordinance approving and authorizing the amendment of the Comprehensive Zoning Map of the City of Vernon to include the properties located at 2328 and 2332/2334 E. Vernon Ave. Vernon California 90058 in the Housing Overlay Zone or any provision thereof in court, you may be limited to raising only those issues you or someone else raised at the hearing described in this notice or in written correspondence delivered to the City of Vernon at, or prior to, the meeting. In compliance with the Americans with Disabilities Act (ADA), if you need special assistance to participate in the meeting, please contact the Office of the City Clerk at (323) 583-8811 ext. 546. The hearing may be continued, adjourned, or cancelled and rescheduled to a stated time and pl ace without further notice of a public hearing. Dated: August 17, 2020 Lisa Pope, City Clerk Publish: August 20, 2020 City of Vernon 4305 Santa Fe Avenue Vernon, CA 90058 (323) 583 - 8811 City Council Agenda Item Report Agenda Item No. COV-294-2020 Submitted by: Sandra Dolson Submitting Department: City Clerk Meeting Date: September 1, 2020 SUBJECT Approval of Minutes Recommendation: Approve the August 4, 2020 Regular City Council Minutes. Background: Staff has prepared and hereby submits the minutes for approval. Fiscal Impact: There is no fiscal impact associated with this report. Attachments: 1. 20200804 City Council Minutes MINUTES VERNON CITY COUNCIL REGULAR MEETING TUESDAY, AUGUST 4, 2020 COUNCIL CHAMBER, 4305 SANTA FE AVENUE CALL TO ORDER Mayor Lopez called the meeting to order at 9:01 a.m. FLAG SALUTE Mayor Lopez led the Flag Salute. ROLL CALL PRESENT:Leticia Lopez, Mayor (via remote access) Melissa Ybarra, Mayor Pro Tem William Davis, Council Member Carol Menke, Council Member Diana Gonzales, Council Member STAFF PRESENT: Carlos Fandino, City Administrator (via remote access) Arnold Alvarez-Glasman, Interim City Attorney Lisa Pope, City Clerk Scott Williams, Finance Director Jim Enriquez, Interim Fire Chief Abraham Alemu, Public Utilities General Manager Fredrick Agyin, Health and Environmental Control Director Michael Earl, Human Resources Director Anthony Miranda, Police Chief Dan Wall, Public Works Director APPROVAL OF THE AGENDA MOTION Mayor Pro Tem Ybarra moved and Council Member Gonzales seconded a motion to approve the agenda. The question was called and the motion carried unanimously. PUBLIC COMMENT Francisco Gonzalez, Vernon City School Principal, provided updates on the school’s online instructional plan. Regular City Council Meeting Minutes Page 2 of 7 August 4, 2020 PRESENTATIONS 1.Recognition of Outgoing City Commission and Committee Members Recommendation: Recognize outgoing Business and Industry Commissioner Robert Wendoll and outgoing Vernon CommUNITY Fund Grant Committee Member Juliet Goff for their dedicated service to the City of Vernon. City Clerk Pope read the commendations to outgoing Business and Industry Commissioner Robert Wendoll and outgoing Vernon CommUNITY Fund Grant Committee Member Juliet Goff. 2.Recognition of Retiring Employee - Steven B. Hartsfield, Facilities Maintenance Worker, Senior Recommendation: Acknowledge and present a proclamation to retired employee Steven B. Hartsfield, Facilities Maintenance Worker, Senior, in recognition of his dedicated service to the City of Vernon. Human Resources Director Earl acknowledged retired employee Steven B. Hartsfield, Facilities Maintenance Worker, Senior, and indicated he was unavailable to attend the meeting. 3.Recognition of Retired Employee - Jose H. Pereyra, Electric Operator Recommendation: Acknowledge and present a proclamation to retired employee Jose H. Pereyra, Electric Operator, in recognition of his dedicated service to the City of Vernon. Human Resources Director Earl acknowledged retired employee Jose H. Pereyra, Electric Operator and presented the proclamation. 4.Recognition of Retired Employee - Vickie Harris-Trigg, Police Records Technician Recommendation: Acknowledge and present a proclamation to retired employee Vickie Harris-Trigg, Police Records Technician, in recognition of her dedicated service to the City of Vernon. Human Resources Director Earl acknowledged retired employee Vickie Harris-Trigg, Police Records Technician, and presented the proclamation. 5.Fiscal Year 2019-2020 City Wide Financial Update and Preliminary Results Recommendation: Receive and file the report. Finance Director Williams presented a PowerPoint regarding the Fiscal Year 2019-2020 City Wide Financial Update and Preliminary Results. Regular City Council Meeting Minutes Page 3 of 7 August 4, 2020 CONSENT CALENDAR Council Member Gonzales pulled Item No. 7. MOTION Mayor Pro Tem Ybarra moved and Council Member Davis seconded a motion to approve the Consent Calendar, with the exception of Item No. 7. The question was called and the motion carried unanimously. The Consent Calendar consisted of the following items: 6.Approval of Minutes Recommendation: Approve the July 21, 2020 Regular City Council meeting minutes. 8. Public Works Monthly Building Report Recommendation: Receive and file the June 2020 Building Report. 9. Amendment to the Agreement with Southeast Area Animal Control Authority (SEAACA) Recommendation: Approve the Amendment to the Agreement with SEAACA for animal control services to update the schedule of fees effective July 1, 2020. 10. Acceptance of Electrical Easement at 2244 37th Street (APN 6302-013-045) Recommendation: A. Find that acceptance of the Electrical Easement is not a “project” as that term is defined under the California Environmental Quality Act (CEQA) Guidelines Section 15378, and even if it were a project, it would be categorically exempt in accordance with CEQA Guidelines Sections 15301 (maintenance, repair or minor alteration of an existing facility and involves negligible or no expansion of an existing use) and 15061(b)(3) (general rule that CEQA only applies to projects that may have a significant effect on the environment); and B. Accept the Electrical Easement and authorize the Mayor to execute the Certificate of Acceptance. 11. Federal Equitable Sharing Agreement and Annual Certification Report Recommendation: Approve and authorize the Police Chief and City Administrator to execute the Federal Equitable Sharing Agreement and Annual Certification Report. 12. Transfer Agreement with the Los Angeles County Flood Control District for Measure W Funds Recommendation: Approve and authorize the City Administrator to execute the Transfer Agreement between the City of Vernon and the Los Angeles County Flood Control District to receive Annual Safe, Clean Water Program Funds (Measure W). 13. Amendment to the Order Form with NeoGov Recommendation: Approve and authorize the City Administrator to execute the NeoGov Amendment for Biddle Software upgrade, in an amount not-to-exceed $4,476.53, for a one- year term, effective July 9, 2020. 14. Appointments to Los Angeles Gateway Region Integrated Regional Water Management Joint Powers Authority Recommendation: Adopt Resolution No. 2020-27 updating the City staff member's appointments to the Los Angeles Gateway Region Integrated Water Management Joint Power Authority and repealing Resolution No. 2017-45. 15.First Amendment to Agreement Number C-131831 with City of Los Angeles for Fiscal Year 2017 Urban Areas Security Initiative Grant Program Regular City Council Meeting Minutes Page 4 of 7 August 4, 2020 Recommendation: Approve and authorize the Mayor to execute the First Amendment to Agreement Number C-131831 of City of Los Angeles Contract between the City of Los Angeles and the City of Vernon in connection with the Fiscal Year 2017 Urban Areas Security Initiative (UASI 17) grant program in substantially the same form as submitted, to increase the UASI 17 grant fund allocation amount by an additional $304.54, resulting in a total grant allocation of $25,304.54. The following item was pulled from the Consent Calendar for individual consideration: 7. Operating Account Warrant Register Recommendation: Approve Operating Account Warrant Register No. 50, for the period of July 5 through July 18, 2020, which totals $9,880,407.93 and consists of ratification of electronic payments totaling $9,671,103.58 and ratification of the issuance of early checks totaling $209,304.35. In response to Council Member Gonzales, Finance Director Williams explained the payment to AltaMed. City Administrator Fandino stated AltaMed had stopped testing and the warrant was payment for services approved by Council. In response to Council Member Menke, Interim City Attorney Alverez-Glasman recommended discussion of the $900,000 warrant to Morgan Lewis during closed session. MOTION Council Member Menke moved and Council Member Gonzales seconded a motion to approve Operating Account Warrant Register No. 50 with the exception of the payment to Morgan Lewis in the amount of $900,000. The question was called and the motion carried unanimously. NEW BUSINESS 16.Amendments to the Classification and Compensation Plan Recommendation: 1) Adopt Resolution No. 2020-28 amending Exhibits A and C of the Classification and Compensation Plan adopted by Resolution No. 2020-19 to add new and amended classifications and associated salary ranges; and 2) Approve the revised job descriptions for the positions for Deputy City Treasurer; Deputy Director of Public Works; Utilities Dispatcher, Senior; Utilities Compliance Analyst; and Water Maintenance Worker, Senior. Human Resources Director Earl presented the staff report. MOTION Mayor Pro Tem Ybarra moved and Council Member Menke seconded a motion to adopt Resolution No. 2020-28 amending Exhibits A and C of the Classification and Compensation Plan adopted by Resolution No. 2020-19 to add new and amended classifications and associated salary ranges, with Section 3 amended to remove the Finance Specialist series; and approve the revised job descriptions for the positions for Deputy City Treasurer; Deputy Director of Public Works; Utilities Dispatcher, Senior; Utilities Regular City Council Meeting Minutes Page 5 of 7 August 4, 2020 Compliance Analyst; and Water Maintenance Worker, Senior. The question was called and the motion carried unanimously. 17.Agreement with Public Health Advocates and Kounkuey Design Initiative, Inc. for Preparation of a Statewide Park Program Grant Application Recommendation:Approve and authorize the City Administrator to execute the Agreement between the City of Vernon, Public Health Advocates and Kounkuey Design Initiative, Inc. to provide technical assistance services to the City for the preparation and submission of a grant application for Statewide Park Program (SPP) funding for the purchase and development of the property located at 5122 South Atlantic Boulevard, Vernon, into a park at no cost to the City for the term of the SPP funding application process. Public Works Director Wall presented the staff report. In response to Mayor Pro Tem Ybarra, Public Works Director Wall estimated the cost to be $3 to $4 million without the grant. MOTION Mayor Pro Tem Ybarra moved and Council Member Davis seconded a motion to approve and authorize the City Administrator to execute the Agreement between the City of Vernon, Public Health Advocates and Kounkuey Design Initiative, Inc. to provide technical assistance services to the City for the preparation and submission of a grant application for Statewide Park Program (SPP) funding for the purchase and development of the property located at 5122 South Atlantic Boulevard, Vernon, into a park at no cost to the City for the term of the SPP funding application process. The question was called and the motion carried unanimously. ORAL REPORTS City Administrator Reports on Activities and other Announcements. City Administrator Fandino provided an update on recent Police, Fire, and Public Utility incidents. He also provided an update on the USC COVID-19 vaccine testing, $50 raffle for residents who shared their contact information with the City, and Back to School outreach planning. He announced the Business and Industry Commission meeting on August 13, 2020, and the cancellation of the August 18, 2020 Regular City Council meeting. City Council Reports on Activities (including AB1234), Announcements, or Directives to Staff. None. Regular City Council Meeting Minutes Page 6 of 7 August 4, 2020 RECESS Mayor Lopez recessed the meeting to Closed Session at 9:55 a.m. CLOSED SESSION 18.CONFERENCE WITH LEGAL COUNSEL – ANTICIPATED LITIGATION Significant Exposure to Litigation Government Code Section 54956.9(d)(2) Number of potential cases: 1 Facts and Circumstances: Pursuant to Government Code Section 54956.9(e)(3), the City has received written communication threatening litigation on behalf of former employee Jerrick Torres related to his termination, in the form of a Complaint of Discrimination filed with the Department of Fair Employment and Housing (DFEH). The DFEH Complaint (DFEH No. 201910-08099730) is made available for public inspection pursuant to Section 54957.5. 19.CONFERENCE WITH REAL PROPERTY NEGOTIATORS Government Code Section 54956.8 Property: 2700 South Indiana Street, Vernon CA 90058 Agency Negotiator: Carlos Fandino, City Administrator Negotiating Party: Exide Holdings, Inc. Under Negotiation: Price and Terms of Payment 20.CONFERENCE WITH LEGAL COUNSEL – EXISTING LITIGATION (two cases) Government Code Section 54956.9(d)(1) A. Bicent (California) Malburg LLC et al. v. City of Vernon et al., Los Angeles Superior Court Case No.19STCV08859 and JAMS Reference No. 1100107175 B. City of Vernon v. Bicent (California) Malburg LLC Los Angeles Superior Court Case No.19STCP02411 and JAMS Reference No. 1220062657 RECONVENE At 11:23 a.m., Mayor Lopez adjourned Closed Session and reconvened the regular meeting. CLOSED SESSION REPORT Interim City Attorney Alvarez-Glasman reported that the Council, with all five members being present, met in Closed Session and discussed all items on the agenda. Regular City Council Meeting Minutes Page 7 of 7 August 4, 2020 7. Operating Account Warrant Register (Continued) Recommendation: Approve Operating Account Warrant Register No. 50, for the period of July 5 through July 18, 2020, which totals $9,880,407.93 and consists of ratification of electronic payments totaling $9,671,103.58 and ratification of the issuance of early checks totaling $209,304.35. MOTION Council Member Menke moved and Council Member Davis seconded a motion to approve payment to Morgan Lewis in the amount of $900,000. The question was called and the motion carried unanimously. ADJOURNMENT Mayor Lopez adjourned the meeting at 11:27 a.m. ______________________________ LETICIA LOPEZ, Mayor ATTEST: _____________________________________ LISA POPE, City Clerk (seal) City Council Agenda Item Report Agenda Item No. COV-303-2020 Submitted by: Sandra Dolson Submitting Department: City Clerk Meeting Date: September 1, 2020 SUBJECT Claims Against the City Recommendation: Receive and file the claims submitted by: 1) Leydi Sanchez in the amount of $3,361.84; and 2) Edwin Silveira in the minimum amount of $3,925.93. Background: On August 5, 2020, the City received the following Claims: Name of Claimant Amount Demanded 1) Leydi Sanchez $3,3,61.84 (State Farm insurance paid $2861.84, claimant paid the deductible of $500) 2) Edwin Silveira $3,925.93 + $500 estimated cost for rental car Pursuant to Municipal Code Section 2.11-1, the above information is listed on the City Council agenda as soon after filing of the claim with the City as practical. Fiscal Impact: There is no fiscal impact associated with this report. Attachments: 1. Sanchez, Leydi 08-05-2020 2. Silveira, Edwin 08-20-20 CLAIM FOR DAMAGES TO PERSON OR PROPERTY INSTRUCTIONS '1. C laims for death, inju ry lo person or to personal property must be filed not later than six (6) months afrer the occurence. (Gov. Code Sec- 91 1 2)2. Claims for damages to real property must be filed not later than one (1) year after the occurrence. (Gov. Code Sec.91 'l.2) 3. Read entire claim before filing.4. See page 2 for diagram upon which to locate place of accident 5. This claim form musl be signed on page 2 at bottom.6. Attach separate sheets, if necessary, to give full details. SIGN EACH SHEET7. Claim must be filed with City Clerk. (Gov.Code Sec. 915a) TO: CITY OF VERNON CITY COUNCIL Name of Claimant Leydi Sanchez ome ress a an Business Address of Claimant City and State Business fOU f,IIV CLERK's OFFITE RECEIUED QUGS,EII pu4r5l:04 25 ome e p ma n ta person one um o one UM er Give address to which you desire notices or communications to be sent regarding this claim How did DAMAGE or INJURY occur? Givefull particulars. The car was parked on Bandini Blvd. and a truck from Vest lNC. was passing by and hit the lid of the sewer. The lid was not placed right on the floor so that caused the lid to lift up and roll on the way to hit the car. When did DAMAGE or INJURY occur? Give full particulars, date, time of day, etc The damage occurred on 0610312020 after I am. Where did DAIMAGE oTINJURY occur? Describe fully, and locateon diagram onreverse side ofthis sheet, where approximate, give street names and address and measurements from landmarks: The damaged occured on Bandini Blvd. the car was parked on the street. There is a drive way to go into the businesses and the car was the first one to the right as soon as you drive out. What particularACT or OMISSION doyou claim causedthe injury ordamage? Givenamesof Cityemployees, if any, causingthe injury or damage, if known: When the lid of the sewer rolled to the car it hit the bottom right side of the car. What DAMAGE or INJURIES do you claim resulted? Give full extent of injuries or damages claimed: Due to the speed and the way the lid hit the car it resulted on damaging almost all of the right side of the car. The claim is attached which states all the damages that were done. WhatAMOUNTdo youctaimof each item of injury or damage asofdate of presentation of thisclaim, givingbasisof computation: The estimate from my insurance is attached with each amount. Give ESTIMATED AMOUNT as far as known you claim on account of each item of prospective injury or damage, giving basis of computation As far as the damage to the vehicle the amount is $3361.84. Out of pocket I payed the n^n.,^+itrt^ ,r,|..;^i^ OEnn ^^..1 +t'^ i^^' '.^^^^ h^i.l aael 0A RESERVE FOR FILING STAMP CLAIM No. Were you insured at the time of the incident? lf so, provide name of insurance company, policy numbers and amount of insurance payments received: The car is insured with State Farm, policy number 627-1245-c07-75a. State Farm payed for s3361 84 Expenditures made on account of accident or lnjury: (Date - ltem)(Amount) Name and address of Witnesses, Doctors and Hospitals: There was a police report done with the Vernon Police Dep. by officer T. Flores 660, case number cr2020-0873. The manager from Vest lNC., Tarsicio Alvarez, was also there to witness READCAREFULLY For all accident claims place on following diagram names of streets, including North, East. South, and West: indicate place of accident by "X" and by showing house numbers or distances to street corners. lf City Vehicle was lnvolved, designate by letter'A" location of City vehicle when you first s-aw.it, an9 OV lle" lo-cation of.yourself or your vehicle when you first saw CiIy vehicl'e; location of City vehicle at time of accident by 'A-1" and location of yourself or your vehicle at the time oi accident by "8 1" and the point of lmpact by "X." NOTE:tf diagrams do not fit the situation, attach hereto a proper diagram signed by claimant. FOR AUTOMOBILE ACCIDENTS GUHH under of u that the NTS ol includi a attachments is true and correct. Date.Ty me: !+rdtSancltu-zlalz'a>o ALL CLAI MA PEN. CODE SEC. 72). CLAIMS MUST BE FILEDWITH CITY C NTATION SEC.915a). STATE LAW PROVIDES THAT lF YOU ARE NOT NOTIFIED cLA|M rs DEEMED DENIED (SEE GOV. CODE SEC.911.6 & 912.4) (CAL. filing onClaimant giving ACTION BY THE CITY OF THIS CLAIM WITHIN 45 DAYS OF FILING THEN THE OF ANY Rev. 8/4/1 6 7nW I RB PAINT & BODY RETAX WE WILL TAKE IT FROM HERE ! 10850 Norwalk Blvd., Santa Fe Springs. CA 90670 Phone: (562) 903-1100 FAX: (562) 903-1104 Supplement of Record 2 with Summary Federal ID: Resale Number: State EPAI BAR: 91-1944951 sRAP-102642587 cA1000401441 ARD278920 Workfile IDI Partsshare: 621d13d7 SRwyzL RO Number: 6476 Insured: Type of Loss: Point of Impact: SANCHEZ, LEYDI Comprehensive 05 Right Rear Written By: Daniel Jimenez, 71712020 ltl6t29 PM Adjuster: Express Team U, (855) 341-8184 Business Poliry #i Date of Loss: 5/3/2020 6:00 PM Claim #: Days to Repair 75-07P0-91S01 0 Owner: SANCHEZ. LEYDI lnspection Lo(ation: RB PAINT & BODY 10850 Norwalk Blvd. Santa Fe Springt CA 90670 Repair Facility (562) 903-1100 Business Promise Date: Vehicle Pick UplReturn Date: Insurance Company: SIATE FARN1 INSURANCE COMPANIES Repair Start Date:06108/20240611612020 0611012020 VEHICLE 2018 HOND CR-V Lx 4D UTV 4-2,4L Gasoline Gasoline Dired Iniection EURGANDY BURGANDY Mileage In: Mileage Out Condition: Vehide Out: 6/122020 lob #:6139 TRANSMIS$Ot{ Automatic Transmission PIOWER Power Ste€rinq Power Brakes Power Locks Power Mirrors DECOR Dual Mirrors Tinted Glass Console/Storage Overhead Console COI{VE IE CE Air Conditioning Intermittent Wipers Tilt Wheel Cruise control Rear Defogger Keyless Entry Message Center Steering Wheel Toudr Controls Rear Window Wiper Telescopic Wheel Climate Control Backup Camera RADIO Al4 Radio FM Radio Stereo Search/Seek Auxiliary Audio Connection SAFETY Drivers Side Air Bag Passenger Air Bag Anti-Lock Brakes (4) 4 Wheel Disc Brakes Tradion Control Stability Control Front Side Impact Air Bags Head/Curtain Air Bags Hands Free Device SEATS Cloth Seats Bucket Seats RecJining/Lounge Seats W}IEELS Aluminum/Alloy wheels PAINT Clear Coat Paint OTHER, Rear Spoiler 717/20201116t29 PM 311359 Page I Vehicle Drop Off Date, 0610812020 RepairCompletion Date: 06/10/2020 VIN: 9427 Interior Color: Ucense: 127 Exterior Color: State: CA Production Date: Supplement of Record 2 with Summary RO Number= 6476 2018 HOND CR-V LX 4D UTV 4-2.41 Gasoline Gasoline Direct Injection BURGANDY Line Oper Labor PaintDescriptionPart ilumber Qty Extended Price $ 1 2 3 4 5 6 7 I 9 10 11 t2 13 t4 15 16 L7 18 19 20 2t 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 1 1 # # # # s02 s02 s02 S01 Subl ,AUTHORIZATION TO PAY SECURED, OWNER PROVIDED WITH A COPY OF ESTIMATE / FINAL BILL Four wheel alignment O/H rear bumper Bumper cover RT Side cover Add for Clear Coat Lower cover w/visible exhaust RT Side retainer 1 1 8s.00 x R.EAR. BUMPER. 1 1 1 1 Repl Repl 71501T1A400 MTL2TlAAOOzz 71510T1AA00 71593T1AA01 42200T18A51 52210T14A02 74552T1AA00 74413T1AA01 744IZTMETOL 156.30 m 164.20 m 8s.00 60.38 19,33 21.00 70.00 x 20.00 s.00 6.00 16.00 176.35 203.46 105.59 14.88 2.4 Incl. Incl. 0.1 Incl.2.0 0.4 Repl Repl REAR LAMPS REAR BODY & FLOOR * Rpr REAR SUSPENSIOil S01 Repl S01 Repl QUARTER PAilEL # Subl * Rpr ROOF R&I EXHAUST SYSTEM * Rpr # # Subl # Repl # Repl R&I RTTail lamp assy RT Rail reinf rear (UHS) RT Hub assy RT Knuckle Four wheel alignment RTTail lamp pocket Add for Clear Coat RT Quarter panel w/l7" wheels Add for Clear Coat RT Wheelhouse liner w/17" wheels RT Wheel opng mldg RT Protector w/o Indiana built RT Quarter glass Honda w/o privacy RT Inner wheelhouse Overlap Minor Panel GIASS KIT Muffler & pipe w/o AWD **r< **ADD-ONS****x Hazardous waste removal Cover Car Restore Corrosion Protection Primer S 0.3 1.0 Ind. 2,1 1,0 8.0 0.3 0.3 0.2 lJ 0.4 1.0 0.5 M 1.0 0.2 2.4 1.0 Rpr Repl Repl Repl Subl Rpr 1 1 1 #1 0.3 -0.2 RT Drip molding m 1 1 1 1 71712020 1:16:29 PM 3 1 1359 Page 2 1 1 1 Supplement of Record 2 with Summary RO Number= 6476 2018 HOND CR-V LX 4D UTV 4-2.41 Gasoline Gasoline Direct Injection BURGANDY 40 4L 42 43 44 45 46 47 1 I 1 8 1 1 # # # # # # Repl s01 s01 s01 Flex additive tint color pre scan clip fender RR Reflector Trunk Hook 8.00 24.56 17.95 2.35 375.00 0,5 0.5 M # OTHER CHARGES Towinq SUBTOTALS 1,536.35 22.L 7.6 ESTIMATE TOTALS Category Basis Rate Cost $ Pafts Parts Discount Body Labor Paint Labor Mechanical Labor Paint Supplies Miscellaneous Other Charges $ s86.s4 19.5 hrs @ 7.6 hrs @ 2.6 hrs @ 7.6 hrs @ -5.0 o/o $ a4.00 /hr $ aa.00 lhr $ 63.00 /hr $ 34.00 /hr 1,176.35 -29.33 858.00 334.40 163.80 258.,10 85.00 375,00 Subtotal 3,22t.62 Sales Tax $ 1,335.42 @ 10.5ooo %140.22 Grand Total 3,351.84 Deductible 500.00 CUSTOMER PAY 500.00 It{SURANCE PAY Register online to check the status of your claim and stay connected with State Farm@. To register, go to htto://www'statefarm.com/ and select Check the Status of a Claim. If you are already registered, thank you! 2,851.84 71712020 l:16:29 PM 3 1 1359 Page 3 Supplement of Record 2 with Summary RO Number:6476 2018 HOND CR-V LX 4D UTV 4-2.41 Gasoline Gasoline Direct Injection BURGANDY SUPPTEMENT SUMMARY Line Oper Labor PaintDescriptionPart Number Qty Extended Price t#s02 s02 s02 2# 3# "AUTHORIZATION TO PAY SECURED, OWNER PROVIDED WITH A COPY OF ESTIMATE / FINAL BILL 1 1 SUBTOTALS 0.oo 0.0 0.0 TOTALS SUMMARY Category Basis Rate Cost $ Parts 0.00 Subtotal 0.00 CUMULATTVE EFFECTS OF SUPPLEMENT(S) Estimate Supplement S01 Supplement S02 Job Total: CUSTOMER PAY: INSURAT{CE PAY: 3,361.84 s00.00 2,861.84 2,846.00 515.84 0.00 Daniel Jimenez Daniel Jimenez Daniel Jimenez $ $ $ 71712020 1:16:29 PM 3 1 1359 Page 4 Supplement of Record 2 with Summary RO Number: 5476 2018 HOND CR-V LX 4D UTV 4-2.4L Gasoline Gasoline Direct Injection BURGANDY FOR YOUR PROTECTION CALIFORNIA LAW REQUIRES THE FOLLOWING TO APPEAR ON THIS FORM: ANY PERSON WHO KNOWINGLY PRESENTS FALSE OR FRAUDULENT CLAIM FOR THE PAYMENT OF A LOSS IS GUILTY OF A CRIME AND IVIAY BE SUBJECT TO FINES AND CONFINEMENT IN STATE PRISON. THE FOLLOWING IS A LIST OF ABBREVIATIONS OR SYMBOLS THAT MAY BE USED TO DESCRIBE WORK TO BE DONE OR PARTS TO BE REPAIRED OR REPLACED: MOTOR ABBREVIATIONS/SYMBOLS: D=DISCONnNUED PART, A=APPROXIMATE PRICE. LABOR TYPES: B=BODY LABOR, D=DIAGNOfiC, E=ELECTRICAL, F=FRAME, G=GLASS, 14=MECHANICAL, P=PAINT LABOR, S=STRUCTURAL, T=TAXED MISCELLANEOUS, X=NON TAXED MISCELLANEOUS. CCC ONE: ADJ=ADJACENT, ALGN=ALIGN, A/M=AFTERN4ARKET, BLND=BLEND, CAPA=CERNFIED AUTOMOTIVE PARTS ASSOCIANON, D&R=DISCONNECT AND RECONNECT, EST=ESTIIYATE, EXT. PRICE=UNIT PRICE MULTIPLIED BY THE QUANTITY, INCL=INCLUDED, MISC=MISCELLANEOUS, NAGS=NATIONAL AUTO GLASS SPECIFICATIONS, NON-ADJ=NON ADIACENT, O/H=OVERHAUL, OP=OPERATION, NO=LINE NUMBER, QTY=QUANTITY, RECOND=RECONDITION, REFN=REFINISH, REPL=REPLACE, R&I=REMOVE AND INSTALL, R&R=REMOVE AND REPLACE, RPR=REPAIR, RT=RIGHT, SECT=SECTION, SUBL=SUBLET, LT=LEFT, WO=WITHOUT, W-=WITH/- SYMBOLS: #=MANUAL LINE ENTRY, *=OTHER [IE..MOTORS DATABASE INFORMATION WAS CHANGED], **=DATABASE LINE WITH AFTERMARKET, N=NOTES ATTACHED TO LINE. OPT OEM=ORIGINAL EQUIPMENT MANUFACTURER PARTS ETMER OPNONALLY SOURCED OR OTHERWISE PROVIDED WITH SOME UNIQUE PRIC]NG OR DISCOUNT. .CURE TIME' N4EANS THE LENGTH OF TIME THAT, PER THE ADHESIVE MANUFACTURER, THE WINDSHIELD ADHESIVE NEEDS TO CURE UNTIL THE WINDSHIELD CAN PROPERLY FUNCTION AS A SAFETY DEVICE PURSUANT TO THE FEDERAL MOTOR VEH]CLE SAFETY STANDARDS AND THE VEHICLE MANUFACTURER'S SPECIFICATIONS. 717/2020 1116t29 PM 311359 Page 5 Supplement of Record 2 with Summary RO Number: 6476 2018 HOND CR-V LX 4D UTV +2.41Gasoline Gasoline Direct Injection BURGANDY Estimate based on MOTOR CRASH ESTIMATING GUIDE and potentially other third party sources of data. Unless otherwise noted, (a) all items are derived from the Guide ARG4464, CCC Data Dale 0710112020, and potentially other third party sources of data; and (b) the parts presented are OEM-pafts. OEM parts are manufactured by or for the vehicle's Original Equipment Manufacturer (OEM) according to OEM'S specificatrons for U.S. distribution. OEM parts are available at OE/Vehicle dealerships or the specifled supplier. OPT OEM (Optional OEM) or ALT OEM (Alternative OEM) parts are OEM parts that may be provided by or through alternate sources other than the OEM vehicle dealerships with discounted pricing. Asterisk (*) or Double Asterisk (**) indicates that the parts and/or labor data provided by third party sources of data may have been modified or may have come from an alternate data source. Tilde sign (-) items indicate IYOTOR Not-lncluded Labor operations. The symbol (<>) indicates the reflnish operation WILL NOT be pedormed as a separate procedure from the other panels in the estimate. Non-Original Equipment Manufacturer aftermarket parts are described as Non OEM, A/M or NAGS. Used parts are described as LKQ, RCY, or USED, Reconditioned parts are described as Recond. Recored pafts are described as Recore. NAGS Part Numbers and Benchmark Prices are provided by National Auto Glass Specifications. Labor operauon times listed on the line with the NAGS information are MOTOR suggested labor operation times, NAGS labor operation times are not included. Pound sign (#) items indicate manual entries. Some 2021 vehicles contain minor changes from the previous year. For those vehicles, prior to receiving updated data from the vehicle manufacturer, labor and parts data from the previous year may be used. The CCC ONE estimator has a list of applicable vehicles, Parts numbers and prices should be confirmed with the local dealership. The following is a list of additional abbreviations or symbols that may be used to describe work to be done or parts to be repaired or replaced: SYMBOLS FOLLOWING PART PRICE: m=|v1OTOR Mechanical component. s=MOTOR Structural component. T=l''liscellaneous Taxed charge category. X=Miscellaneous Non-Taxed charge category. SYMBOLS FOLLOWING LABOR: D=Diagnostic labor category. E=Electrical labor category. F=Frame labor category. G=Glass labor category. M=Mechanical labor category. S=Structural labor category. (numbers) l through 4=User Defined Labor Categories. OTHER SYMBOLS AND ABBREVIATIONS: Adj,=16iu."n,. Algn.=Align. ALU=Aluminum. A/M=Aftermarket paft. Blnd=Blend. BOR=Boron steel. CAPA=Certifled Automotive Parts Association. D&R=Disconnect and Reconnect. HSS=Hi9h Strength Steel. HYD=Hydroformed Steel. Incl.=Included. LKQ=Like Kind and Quality. LT=1eft. MAG=Magnesium. Non-Adj.=Non Adjacent. NSF=NSF International Certifled Part. O/H=Overhaul. qry=quantiV. Refn=Refinish. Repl=Replace. R&I=Remove and Install. R&R=Remove and Replace. Rpr=Repair. RT=Right. SAs=Sandwiched Steel' Sect=Section, Subl=Sublet. UHS=UItra High Strength Steel. N=Note(s) associated with the estimate line. cCC ONE Estimating - A product of CcC Information Services Inc. The following is a list of abbreviations that may be used in CCC ONE Estimating that are not part of the MOTOR CRASH Efi I,IATING GUIDE: BAR=Bureau of Automotive Repair. EPA= Environmental Protection Agency. NHTSA= National Highway Transportation and Safety Administration. PDR=Painuess Dent Repair. VIN=Vehicle Identification Number. 717/2020 ltl6.29 PNt 311359 Page 6 Sanchez, Leydi Subject: From: Sent: To: Sent from my iPhone Leydi Sanchez Wednesday, August 5,2020 2:58 PM Sanchez, Leydi IMG_0474jpeg { h 1 I !!ry.?r'' Sanchez, Leydi From: Sent: To: Subiect: Sent from my iPhone Leydi Sanchez Wednesday, August 5,2020 2:59 PM Sanchez, Leydi IMG_0475jpeg 1 Sanchez, Leydi From: Sent: To: Subject: Sent from my iPhone Leydi Sanchez < Wednesday, August 5, 2020 2:58 PM Sanchez, Leydi IMG_0472jpeg 1 Sanchez, Leydi From: Sent: To: Subiect: Sent from my iPhone Leydi Sanchez < Wednesday, August 5, 2020 2:58 PM Sanchez, Leydi IMG_0469jpeg e 1 Pouce Drpr 4305 Sarre Fe Avr. Truptrore (323) 587-5171 ffi Pnrsrrurro By VERNON POLICE DEPARTMENT CITY OF VERNON 'f. Fr,r0-eS bQO Rronqorire CAsr No.O??nz-o 13 Plase Krep Tnrs Cmo Fon Rrrenrruce VEST !NC. MANUFACTUFIERS OF WELDED STEEL TUBING Tarsicio Alvarez Shipping and Receiving Leader 6023 Alcoa Avenue Los Angeles, CA 90058 I a CLAIM FOR DAMAGES TO PERSON OR PROPERW INSTRUCTIONS 1 . Claims for death, iniury to person or to personal property must be filed nol later than six (6) months afrer the occurrence. (Gov. Code Sec 911 2)2. Claims for damages to real property must be filed not laterthan one ('l ) year afrer the occurrence. (Gov. Code Sec.911.2)3. Read entire daim before filing.4- See page 2 for diagram upon which to locate place of accident5 This claim form must be signed on page 2 at bottom.6. Attach separate sheets, if necessary, to give full details. SIGN EACH SHEET7. Claim must be filed with City Clerk. (Gov Code Sec. 915a) TO: CITY OF VERNON CITY COUNCIL Name of Claimanl Edwin Silveira RESERVE FOR FILING STAMP CLAIM No. COU CITTCLERIfSIFFICE RECEIUED AUG20'20 nnB:26:55 person 40 Home Address of mant me p ne um Business Address of Claimant ity and State Business Telephone Number Give address to which you desire notices or communications to be sent regarding this claim How did DAMAGE or INJURY occur? Give full particulars. I was driving my 2O14 Gray Ford Fusion Hybrid SE west bound on Bandini Boulevard (once the number 2 lane becomes the number 3 lane), and Just east of Downey Road. Suddenly, unexpectedly and without warning, lhe sewer lid that exists where the number 2 and 3 lanes splil, flew off and struck my vehicle causing damage. Attached hereto are photographs taken immediately after the incident of my vehicle, the sewer cap and the location ol the incident. Vvhen did DAMAGE or INJURY occur? Give full particulars, date, time of day, etc. Friday, July 24, 2020 at or about 12:50 p.m. Where did DAMAGE oTINJURY occur? Oescribefully, and locateon diagram on reverse sideofthissheet, where approximate, give street names and address and measurements from landmarks: Near the split of the number 2 and 3 lanes on west bound Bandini Boulevard, just east of Downey Road. What particularACT or OMISSION doyou claim causedthe injury ordamage? Givenamesof Cityemployees, if any, causingthe injury or damage, if known: The dangerous condition of public property, and/or the negligent maintenance, installalion and/or repair of the sewer cap, sewer, and/or other City property by as of yet unknown City Employees, agents, contractors and/or representatives resulted in the sewer cap flying off and hitting my vehicle Vvhat DAMAGE or INJURIES do you claim resulted? Give full extent of injuries or damages claimed; At a minimum, property damage occurred to my right rear tire and rear panel, with total known damages to date of $3,925.93 (please see attached photos, receipts and repair estimates). As ot the submission ol this claim, no injury claims are being asserted, with Claimant reserving the right to assert a tuture claim for bodily injuries. VvhatAMOUNTdo you claim of each item of injury ordamage as of dale of presentation of thisclaim, giving basisof computation: As of this time, no iniury claims are being asserted. Claimant reserves the right to assert a claim for bodily injuries in the future. Minimum property damage-$3,925.93 (please see attached repair estimates and receipts) Give ESTIMATEDAMOUNT as farasknownyou claim onaccount of each item of prospective injury ordamage,giving basisof computation: At a minimum, it is estimated another $500 will be necessary lor a rental car during repairs. Additionally, I have been advised that turther repairs may be necessary should additional damages be discovered during the repair process. e n \ lbre you insured at the time of the incidenl? lf so, provide mnE of insurance company, policy numbers and arnount of insurance payrEr{s received: Yes. lnsurer: Esurance. Policy Number: PACA-5096871 Expenditures made on account of accident or lnjury: (Date - ltem) As o, the date ol this claim submission expenditures total $389.68 [AAA Tow Truck-$90.00; Rim and 'l'ire Beplacement $299.681. Copies ol receipts are attached hereto. Name and address of Witnesses, Doclors and Hospitals: Claimant's minor children Zoey & Gavin Silveira, and Reese Davila, all of whom reside with Claimant at the above referenced address. READ CAREFULLY For all accident claims place on following diagram names of streets, including North, East. South, and West indicate place of accident by "X" and by shorring house numbers or distances to street comers. (Amount) $389.68 lf City Vehicle was lnvolved, designate by letter'A" location of City vehicle when you first saw it, and by "B" location of yourself or your \€hicle when you first saw City \Ehicie, locaton of City \€hicle at tme of accdent by'A-1"and location of yourself or your \rehicle at the time of accident by "8 1" and the point of lmpacl by "X " NOTE]lf diagrams do not fit the situation, attach hereto a proper diagram signed by daimant. CURE I declare, under al of Typed/Printed Name Edwin Silveira u FOR OTHERACCIDENIS DEWALK CUIBl that the oi , includin attachments, is true and correct.a Date 8t4120 NOTE: ALL CLAIMANTS [,AY BE REOUESTED cLnr UN PRESENTAIION OF A FALSE LAIM IS A FELONY (CAL PEN CODE SEC.72) CLAIMS MUST BE FILEOWI cLERK (GOV COOE SEC 91 PANXWAV sis nature of n filing on his/her behalf, givingor a am ACTION BY THE CITY OF TH S CLAIM WITH N 45 YS OF FILING THEN THE CLAIM IS DEEMED OENIEO (SEE GOV CODE SEC 911 6 A 912,4) FOR AUTOMOBILE ACCIDENTS __l 7 /) t__l L STATE LAW PROVIDES TI.TAT IF YOU ARE NOT NOTIFIEO OFANY ffi Payment Confirmation Dear EDWN SILVEIRA. Thank you for contacting the Auto Club. This email is to conf irm your onetime payment on 7 t2412020. . i,lembership Number XXXXXXXXXXXX660T . Amount 90.00 o Account Ending in: 8322 Please allow up to 72 hours for your payment to be processed by your f inancial institution and for billing changes to be reflected online. The Automobile Club of Southem Calif omia tlEnks you foryour loyatty Copyright O 2014 Automobile Club of Southem Calitomia. All Rights Reseryed. Please do not reply to this email as we are unable to respond to messages sent to this add ress. Did you also know that you can now access youraccount, pay yourball online, and sign up forAAA Auto Pay at AAA com/myaccount? tro E Tota I OIBI I CARD SAIt 25 Jul 2020 I l:56:4lA S2q9.68 | M!rhul: t'Mv us DEBTT XXXX)(XXXXXXX3S l3 t ISA RFYNAGA Reference lD: 020700502197 A!lh lD: 57 I 184 MID rr******7887 At0 A0000000980840 AlhNlwkNnr: NTFRtINK lllnd:DEtsll PIN VERIFIET) Acalon Tire & Wheel BOO WASHINGTON EIVO rv!0NTEBEt.l 0, CA 90640 171 72r 1000 I ronsat,tior 002276 NQ.)KEWsOYCOs6 Paynrent N00KEW80YC056 t)1,*,r nrtu Y P',1( t hlltr rrr lor'1 r', 'rt rrrl t ill il1il ]llil illllllllll lll $29e.68 S2ee.68 +{UJ{ rutr EN\hlu'rltrlt HI Eil ct t-l-2. F'":[ il trEMT* H*r tN ? trF E .i 3oaI mtr lnFF F n> l! agt $tr - t, Et *t ;'{ C' =--0 0 I = E tj = \n(\ es J-+-to tt- Y *t -+ a d -* z = = 2o 2o € D!t z,I s\\'=EE6N;r E == 2i EA Eql ititErlr .B .A .ggEE l: f]f, ihat IriEY :., I t oa rl a - E I E't Ig E ; I I o 0 ) () o'4 I K- EI Hd p b' 2 z = = g 6. o o { & { )- lle 3 J\- f q - s ,+ & d { ,{ I n a l: f ll!t o E { i ntttF a -.t kT tr fn I ,t: tl-V Ct l{lht. iltri fDl [_tI 8t Er F] FI ( 4 V- -4,, Fs -tt-) # .f I N R Io .7 Fcderal lD:95 254295r sE'D'{Efr5colltltox cENfE*t Cornmitted to providing an "Extraordinary Repair Experience'to our GuesE and our Busilt€ss Partners 321 w whittier Btvd., Montebello. CA 90ff0 Phone: (323) 722-3220 F/U: (323) 722-56/.9 Preliminary Estimate Customer: Reynaga, Lisa lrErrcd: Type of Loss: kilt of lrpact: Reynaga, Lisa wrifrea By: Falph G.done turcy *: D*e of toss: Ctraim *: Days to RePir: I (x Right Qts Post (Right Side) Otxner: Reyn4a, tisa In€9.dion Lo.ation: SEID|{ER'5 COtlIsIOl{ CEWTER - MOIYTEEEIIO 321 w Whittier Evd. Montebello, cA 9Oa$ Repair Facility (323) 722'3220 Buiness Insuranca CofiganY: OJSIOMER PAY VEHICLE 2014 FoRD Fuson tlvb(d sE FwD 4D sED 4-2 01 li/brid s€quenbal MPI c,ay WN; Li(Else sbts:c Iiterior Cd6: Exterir Cdc: Prod[Etioo Date: Mleage In: 1 l.lEagE Otn: 1 Condtim: Gray Vehide Ort: lob # Gray TRA]lsHrssloll Autornatic TrarErissiql FOWER Por.,er Ste€ring Pot.er grakes Power Windovrs Po/{er Locks Polrer HiaroG Heated Minors Po*er Oriver Seat OE@T Dual Mirrors .finted G6s Coftsole/Storage O/ert€ad Consde O()llVEIIIEIICE Air OndtixfrE lntern*nent wiPets Illt Wh€el C^ise Conbd Rear Defogger Keyless Erdry Ala.m Message Cent€t Mng ltthed ToJdt ConEols Tehscopac whed Oimate CoriEd RAI'IO Atl Rafo Fl"l P.adk) Cto$ Seats Brdet seats Redinirg/tologe Seats WHEEUi Alur num/Allo/ llheds PA$$ C,ed Coat Pairt OTHCR Tradbn Cqltrd Staulity Conrol Signal Integrated Mirrors Porver T.unk/GaE Release 7l3tl2010 12:32:49 PN 306544 Page 1 Stereo Seaich/S€ek CD Hayer Auiliary Audio coffEdio.r Satdlrte Radio SAFETV Drrve6 Side Air 8aq PasEengEr Air Bag AIt-Lock rakes (4) 4 Wh€d Disc Br*€s Front SUe Irpact ar BagE itead/ClJrttn Af Bags Politractioo Hards Free Cla/rce SEATS Lu5lrrllti't ; lattyrrdga, Lrld 2014 FORD Fusion tlybrid 5E FWD 4D SED 4-2.01 ttybnd Seqr-Enbal MPI Gray Line Oper Description Part Number atY Extended Prke I Labor Paint I I B 1 I 2 3 4 5 PILLARS, ROCKER & FLOOR Repl Repl Repl Repl RT Front seal RT Rear seal RT Roder rdding ctip RT Ro*er moldirE Ncte: Torn MountirE Tabs Add fo. Clear Coat D6/68101C36A D67ZY 101C.IOA w7165035300 057254101764 39.m 36.86 20.00 230.44 z8-00 x 20.00 0.7 0.3 0.2 0.2 0.3 0.3 1/ rl 1.0 1.0 lncl. Incl 1.! 2,0 1.8 o.7 1.2 2.2 -0.2 0.4 6 7 8 9 t0 l1 REAR DOOR BACK GLASS QUARTER PANEL ' gJbl R&I RT R&I tsim pand R&I RT tladle, outside Vpa6srve €nEy R&I RT Belt mdding R&I RT Rea. vr'sfiP RAI RT Front l^/stip R&I RT Wsfip m body RAI ff D@r $/rstip Brd ff Ort€r pand tlote: DLE to dce prqimaty to repair -ea on RT qJarter Panel RDr Rope/l'4d - Ba& glass Ford Hermo6allo plant R&l - RT Qts glass FORD bnghvbla* r2oryo Lrreflane Gl6 Xit RT qra.ter Oattd Oreriap Malor Non-Adi. Pand Add tor Clear coa Sheet Metd/Floor Pull - RT Qlr Pnl Weld Tabs Fo( h- l Setup for Floor Pull 0.5 0.3 t2 t3 14 15 16 t7 ir 'j 18 l9 I I20 21 23 24 E 26 2A 29 30 31 32 34 36 2.0 Rp. Rp( Rp. REAR LAIIIPS I R&I RT Ta lamp assy w/o ENERGI or TTTANIUM REAR BT'IPER R&l R&I bumper cover t <> Rpr &Jmper cover w/o park setEors OveriaP MaFr Noo-M. Pand Add fo. Clear Coat VEHICI.I DIAG]IO$ICS + RePl Pre-repair scan * RePl Post-r@air scan xtscEllAt{Eot s oPERATIOi{S 0.2 3.0 -0.2 0.6 m m I 1 QJH 0tM t|3U2O2O 12.32.49 Pt{306544 Pdge 2 Preliminary Estimate Customer: ReynagEr, Lisa 2014 FORD hJsin ttt/brid SE FWO 40 SED 4-2.01 ttybnd SeqEntial MPI Grdy 38 39 ,m 4t 42 1l # # * 1 0.0 0.5 0.4 0.5 0.3 o.2 Cdor Matdr Md For Prirrt Md( For Paint Mad( lamb6 For Ossprdy t{ote: RR O@. M* Wirxlot,i Opeorngs Note: RT Qb Gl6 Mask tsunk compartnert Fll Sard And FeatfEr Adl6iofl Pro.noter Cdrosim Protedbn cdo. sad Ard Folidr Hazardous Wade Oisposd I I I l0.m 12.00 5.m 5.00 3.00 x 7.* 8.00 r0.m 5.00 x 43 4 45 4 47 48 4 I I I I I $ * $ # * 0.2 1.0 0.2 0.2 Rpr SUBTOYAI.S 469.40 27.1 9.5 ESTIMATE TOTALS Category Basis R.t€Cost $ 26.! hrs 9.5 trs 1.0 hrs 9.5 tYs 441.80 1,696.50 617.50 1r5.00 s22.50 8.00 @ @ @ @ $ 65.00 /hr I 65.00 /hr $ us.00 /hr $ 55.m /hl tubtotal 3,44r.30 Sales Tax $ 926.30 @ 10.2s00 %94.95 Grand Total 3,536.2s riyHcelinl Esttorate ID / Quote ID: 718s45040326008832 I 7 r2t7065 7l3U2A2O 12.32:49 ?M 306544 Pdqe l Repl Rpr t PaTG Eody tabo. Paint L&r l,ledEnical Labor Part Miscellaneoos Custom€r: Reynaga, Lisa 2014 FORD Fusion Hytrid SE FWD 4D SED +2.01 Hybrid Seqren0al MpI Grdy Thank you for visiting Seidner's Collision Centers. We appreciate the opportunity that you have given us to prepare an estimate for your vehicle! We understand that you have many choies when it comes to @llision repair. seidner's @llision centers is committed to giving you an EXTRAoRDINARY REPAIR EXPERIENCE! Here are just a few thirEs about Seidne/s Collision Centers that we are very proud of. We have been serving the great people of the San Gabriel Valley and Inland Empire since 1964 Our Customer Satisfactbn scorcs are among the highest in the country We have muftiple locations dedicated to the highest quality of collision repair. We work directly with all major Insurance Companies on your behalf We can set up a rental resewation for you with the Rental Car Company of your cfioir- We invest heavity in tEtining to ensure you receive the highest quality repair in the indusuy We have State of the Art equip.nent required to propedy repair your vehicb Every step of the repair process is decked and docurnented to ensure a proper Gpair Again, thank lrou for taking fle tilne to visit Seidner's Collision Centers. If you have any questions or would like to set up an appoinbnent, please feel free to conbct our orrce at (323) 722-3220. We are happy to hetp! FOR YOUR PROTECTION CAUFORNIA LAW REQUIRES THE FOLLOWING TO APPEAR ON THIS FORM: ANY PERSON WHO KNOMNGLY PRESENTS FALSE OR FRAUDULENT CLAIM FOR THE PAYMENT OF A LOSS IS GUILTY OF A CRIME AND MAY BE SUB]ECT TO FINES AND CONFINEMENT IN STATE PRISON. THE FOLLOWNG IS A UST OF ABBREVTATIONS OR SYMBOLS THAT MAY BE USED TO DESCRIBE WORK TO BE DONE OR PARTS TO BE REPAIRED OR REPLACED: MOTOR ABBREVIATIONS/SYMBOLS: D=DISCONTINUED PART, A=APPROIMATE PRICE. LABOR TYPES: B=BODY IABOR, D= DIAGNOSTIC, E =ELECTRICAL, F= FRAME, G=GIASS, M = MECHANICAL, P=PAINT LABOR, S=STRUCTURAL. I=TAXED MISCELLANEOUS, X=NON TAXED MISCELLANEOUS. CCC ONE: ADI=AD]ACENT, ALGN=AUGN, Ay'M=AFTERMARKET, BLND=ELEND, CAPA=CERTIFIED AUTOMOTIVE PARTS ASSOCIANON, D&R=DISCONNECT AND RECONNECT, EST=ESTIMATE, EXT. PRICE=UNIT PRICE MULTIPUED BY THE QUANTITY, INCL=INCLUDED, MISC=MISCELLANEOUS, NAGS=NAIONAL AUTO GLASS SPECIRCATIONS, NON-ADI=NON ADJACENT, O/H=OVERHAUI- oP=OPERATION, NO=UNE NUMBER, QTY=QUANTITY, RECOND=RECONDITION, REFN=REFINISH, REPL=REPLACE, R&I=REMOVE AND INSTALL, R&R=REMOVE AND REPIACE, RPR=REPAIR, RT=RIGHT, SECT=SECTION. SUBL=SUBLET, LT=IEFT. flO=wrTHOUT, W_=wrftli SYMBO6: # =I4ANUAL UNE ENTRY, *=OTHER [IE..MOTORS DATARASE INFORMATION wAS CHANGED], *+=DATAEIASE UNE WIIH AFTERMARKET, N=NOTES ATTACHED TO UNE. OPT OEM=ORIGINAL EQUIPMENT MANUFACTURER PARTS EITHER OMONALLY SOURCED OR OTHERMSE PROVIDED WITH SOME UNIQUE PRICING OR DISCOUNT. "CIJRE TIME" MEANS THE LENGTH OF TIME THAT, PER THE ADHESIVE MANUFACTURER, THE WINDSHIELD ADHESIVE NEEDS TO CURE UNTIL THE WINDSHIELD CAN PROPERLY FUNCTION AS A SAFETY DEVICE PURSUANT TO THE FEDERAL MOTOR VEHICLE SAFETY SIANDARDS AND THE VEHICLE MANUFACTURER'S SPECIFICANONS. 7l3ll2o2o L2.32:.49 PM 30654.1 Pdg€ 4 Customer: R.eynaga, Lisa 2014 FORD Fusion Hybrid SE FWD 4D SED +2-01 l-tybrid Sequential MPI Gray Estimate based on MOTOR CRASH ESTIMATING GUIDE and potentially other $ird party sources of data. Unless othenvise noted, (a) all items are derived from the Guide DR2JP13, CCC Data Date 071771?020, and potentially other third party sources of data; and (b) the parts presented are OEM-parts. OEM parts are manufactured by or for the vehicle's Original Equiprnent Manufucturer (OEM) according to OEM'S sp€cifications for U.S. distribution. OEM parts are available at OE/Vehicle dealerships or the speciFred supplier. OPT OEM (Optional OEM) or ALT OEM (Altemative OEM) parts are OEM parts that may be provided by or tftrough altemate sources other than the OEM vehicle deahrships with discounted pricing. Asterisk (*) or Double Asterisk (**) indicates that the parts and/or labor data provided by third party sources of data may have been modified or may have come from an aftemate data source. Tilde sign (-) items indicate MOTOR Not-Included Labor operauons. The symbol (<>) indicates the rennish operatbn WILL NOT be performed as a separate procedure from the other panels in the estirnate. Non-Original Equipment Manufacturer aftermarket parts are described as Non OEM, A/M or NAGS. Used parts are described as LKQ, RCY, or USED. Reconditioned parts are described as Recond. Recored parts are descriH as Recore. NAGS Part NumbeB and Benchmark Pn'ces are provided by National Auto Glass SpeciFications. Labor operation times listed on the line v'rth the NAGS information are MOTOR suggestd labor operation times. NAGS labor operation times are not included. Pound sign (#) items indicate manual entries. Sorne 2021 vehicles contain minor charEes from the previous year- For those vehkles, prior to receiving updated data from the vehicle manufacturer, labor and parts data from the previous year tnay be used. The CCC ONE estimator has a list of applicable vehicles. Parts numbers and prices should be confirmed with the local dealership. The following as a list of additional abbreviations or symbols that may be used to describe work to be done or parts to be repaired or replaced: SYMBOLS FOLLOWING PART PRICE: m=MOToR Mechanacal component, S=MOTOR Structural component. T=Miscellaneous Taxed charge category. X=Miscellaneous Non-Taxed charge category. SYM80Ls FOTLO\4[NG I.ABOR: D=Diagnostic labor category. E=Electrical labor category. F=Frame labor category. G=Glass labor category. M-Mechanical labor Gtegory. S=Structural labor category. (numbers) I through 4=User Defined Labor Categories- OTHER SYMBOLS AND AEBREVIATIONS: Adj.=461u.una. Algn.=Aliqn. Alu=Aluminum. A,/M=Aftermarket part. Blnd=Blend. BOR=Boron steel. CAPA=C.ertified Automotive Parts Association. D&R=Disconnect and Reconnect. HSS=High Strength Steel. HYD=Hydroformed Steel. Incl.=Included. LKQ=Like Kind and Quality. LT=Left. MAG=Magnesium. Non-adj.=ruon Adjacent. NSF=NSF International Certified Part. O/H=Overhaul. Qty=Quantrty. Refn=Refinish. Repl-Replace. R&I=Remove and Install. R&R=Remove and Replace. Rpr=Repair. RT=Right. SAs=Sandwiched Steel. Sect=Section. Subl=Sublet. UHS=Ultra High Strength Steel. N=Note(s) associated with the estimate line. CCC ONE Estimating - A product of CCC Information Servr'ces Inc. The following is a list of abbreviations that may be used in CCC ONE Estimating that are not part of the MO'fOR CRASH EfiMANNG GUIDE: BAR=Bureau of Automotive Repair. EPA=Environmental Protection Agerrcy. NHTSA= National Highway Tmnsportation and Safety Administration. PDR=Paintless Dent Repair. VIN=Vehide ldentificauon Number. 7i3U2Q0 r2132t49 PM 306544 Page 5 L + :', iI / I t I(, @ - S. f 7 oo 4 z T II -1 \ I F > \) / oa* -- 4 \- F I \.- -/,I \ I r-- a i:/ oe @ L I .- - - (- 7 ! II T II aI I I {, '-. I \ i.'I I II t{ rj"\ \ i. l ,i IrI|t ) - \ t,7 t\ ./ "d5tr I 4 i T t_..1 i-J \5 - -l \ ieG E# a I sI x4 rI _:r d\ t T i' I/ l I ilt!tt a I I - - I {E= :?.+E EEI TI II I I II I - LI :\ _t 1 H lFt _.f-_r f tr trltta L --F.--'-:-'-.2 I t - I _ -=- --rr- I---- "r;r.E *\N II I I I a k Ir -.1 J hf^ /I ,l I Lt- frII 7,l-ilrEth :l ;l -^- -t r-- ..- a:.--tL I t t f r dn -4 E t n -4 a L--r Ba \ , ) o wneY Rd I I a F TlilF ci)r 1l l! I ,, I !t--t t I I -- //h/ ,/ a --,!l'''.'-._#..^ ,/ /I /, I ) / - L-.$ L / ,/1 L-_ L-- L. _-.) [It-I't ,r t_ fiI n tt \ \ fu--. I ( :rIL Jf'l'..u-- . I I lrD .lI ttI \ I (.) I 'l:!%J t b I L.t\ t \ \.'! I'l L \/L- \,\ - 7 \ a I t - L.! / .-/ --.1 -.{ = il I \tal a t.j \i N I 7 i-l J l o L-.-\ E^ a { l I \ L\ r'lt l\ I \ / IlIS-/ /,7 ;.-\4 \ \ \ City Council Agenda Item Report Agenda Item No. COV-313-2020 Submitted by: John Lau Submitting Department: Finance/Treasury Meeting Date: September 1, 2020 SUBJECT City Payroll Warrant Register Recommendation: Approve City Payroll Warrant Register No. 770, for the period of July 1 through July 31, 2020, which totals $4,258,150.66 and consists of ratification of direct deposits, checks and taxes totaling $2,996,148.77 and ratification of checks and electronic fund transfers (EFT) for payroll related disbursements totaling $1,262,001.89 paid through operating bank account. Background: Section 2.13 of the Vernon Municipal Code indicates the City Treasurer, or an authorized designee, shall prepare warrants covering claims or demands against the City which are to be presented to City Council for its audit and approval. Pursuant to the aforementioned code section, the City Treasurer has prepared City Payroll Account Warrant Register No. 770 covering claims and demands presented during the period of July 1 through July 31, 2020, drawn, or to be drawn, from East West Bank for City Council approval. Fiscal Impact: The fiscal impact of approving City Payroll Warrant Register No. 770, totals $4,258,150.66. The Finance Department has determined that sufficient funds to pay such claims/demands, are available in the respective accounts referenced on City Payroll Warrant Register No. 770. Attachments: 1. City Payroll Account Warrant Register No. 770 Raquel Franco | 8/18/2020 4:26 PMPAYROLL WARRANT REGISTERCity of VernonNo.770Month ofAugust 2020I hereby Certify: that claims or demands covered by the This is to certify that the claims or demandsabove listed warrants have been audited as to accuracycovered by the above listed warrants have beenand availability of funds for payments thereof; and that audited by the City Council of the City of Vernonsaid claims or demands are accurate and that funds are and that all of said warrants are approved for pay-available for payments thereof. mentsScott A. WilliamsDATEDirector of Finance / City TreasurerDATEDate:Page 1 of 1Payroll Warrant Register Memo (002) : Warrant8/20/2020 Payrolls reported for the month of July: 06/07/20 - 06/20/20, Paydate 07/02/20 06/21/20 - 07/04/20, Paydate 07/16/20 07/04/20 - 07/04/20, Paydate 07/16/20 07/05/20 - 07/18/20, Paydate 07/30/20 Payment Method Date Payment Description Amount CHECKS 07/02/20 Net payroll, checks 16,643.15$ ACH 07/02/20 Net payroll, direct deposits 718,305.73 ACH 07/02/20 Payroll taxes 190,612.66 CHECKS 07/16/20 Net payroll, checks 21,229.89 ACH 07/16/20 Net payroll, direct deposits 778,785.59 ACH 07/16/20 Payroll taxes 224,981.33 CHECKS 07/16/20 Net payroll, checks 139.90 ACH 07/16/20 Net payroll, direct deposits 5,461.90 ACH 07/16/20 Payroll taxes 2,508.40 CHECKS 07/30/20 Net payroll, checks 10,926.22 ACH 07/30/20 Net payroll, direct deposits 799,778.75 ACH 07/30/20 Payroll taxes 226,775.25 Total net payroll and payroll taxes 2,996,148.77 605838 07/02/20 Franchise Tax Board 1,206.31 10040 07/02/20 Vernon Police Officers Benefit Association 2,132.07 10041 07/02/20 IBEW Union Dues 3,342.76 10042 07/02/20 Vernon Firemen’s Association 2,613.00 10043 07/02/20 ICMA Retirement Trust 457 36,658.79 9928 07/02/20 Blue Shield of California 306,608.16 9929 07/02/20 MetLife - Group Benefits 16,119.62 9930 07/02/20 Mutual of Omaha 10,568.42 10067 07/08/20 Colonial 5,684.97 10066 07/08/20 AFLAC 11,955.34 10065 07/07/20 MES Vision 4,782.57 10046 07/08/20 CalPERS 241,293.19 10047 07/03/20 State Disbursement Unit 789.22 605931 07/16/20 Franchise Tax Board 1,206.31 10048 07/16/20 Vernon Police Officers Benefit Association 2,132.07 10049 07/16/20 Teamsters Local 911 2,160.00 10050 07/16/20 Vernon Firemen’s Association 2,613.00 10051 07/16/20 ICMA Retirement Trust 457 38,334.78 10054 07/28/20 CalPERS 262,287.38 10055 07/17/20 State Disbursement Unit 789.22 605993 07/30/20 Franchise Tax Board 1,206.31 10069 07/30/20 Vernon Police Officers Benefit Association 2,191.37 10068 07/30/20 Vernon Firemen’s Association 2,613.00 10070 07/30/20 ICMA Retirement Trust 457 35,169.83 10073 07/31/20 CalPERS 266,754.98 10074 07/30/20 State Disbursement Unit 789.22 Payroll related disbursements, paid through Operating bank account 1,262,001.89 Total net payroll, taxes, and related disbursements 4,258,150.66$ Page 1 of 1 City Council Agenda Item Report Agenda Item No. COV-312-2020 Submitted by: John Lau Submitting Department: Finance/Treasury Meeting Date: September 1, 2020 SUBJECT Operating Account Warrant Register Recommendation: Approve Operating Account Warrant Register No. 51, for the period of July 19 through August 15, 2020, which totals $10,223,414.19 and consists of ratification of electronic payments totaling $9,796,376.07 and ratification of the issuance of early checks totaling $427,038.12. Background: Section 2.13 of the Vernon Municipal Code indicates the City Treasurer, or an authorized designee, shall prepare warrants covering claims or demands against the City which are to be presented to City Council for its audit and approval. Pursuant to the aforementioned code section, the City Treasurer has prepared Operating Account Warrant Register No. 51 covering claims and demands presented during the period of July 19 through August 15, 2020, drawn, or to be drawn, from East West Bank for City Council approval. Fiscal Impact: The fiscal impact of approving Operating Account Warrant Register No. 51, totals $10,223,414.19. The Finance Department has determined that sufficient funds to pay such claims/demands, are available in the respective accounts referenced on Operating Account Warrant Register No. 51. Attachments: 1. Operating Account Warrant Register No. 51 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020I hereby cerƟfy that claims and/or demands included in above listed warrantregister have been audited for accuracy and availability of funds for payments andthat said claims and/or demands are accurate and that the funds are available forpayments thereof.____________________________________________________________ScoƩ WilliamsDirector of Finance / City TreasurerDate: _______________________________________________________This is to cerƟfy that the claims or demands covered by the above listed warrantshave been audited by the City Council of the City of Vernon and that all of saidwarrants are approved for payments except Warrant Numbers:________________________________________________________________________________________________________________________Printed: 8/19/2020 1:45:45PM8/20/2020 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020ELECTRONICVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTPAYMENTNUMBERPAYMENTDATE055.9200.500150 $ 105,202.08 IniƟal Charges 07/20 202007143146110685CALIFORNIA ISO002412 ‐ 055.9200.500170 $ 12,806.44 IniƟal Charges 07/20 202007143146110685055.9200.500210 $ 16,358.39 IniƟal Charges 07/20 202007143146110685055.9200.500151 $ ‐0.07 IniƟal Charges 07/20 202007143146110685055.9200.500190 $ ‐10,404.24 IniƟal Charges 07/20 202007143146110685055.9200.500150 $ ‐32,818.60 RecalculaƟon Charges 06/20 202007143146110685055.9200.500151 $ ‐0.03 RecalculaƟon Charges 06/20 202007143146110685055.9200.500170 $ ‐600.30 RecalculaƟon Charges 06/20 202007143146110685055.9200.500190 $ ‐163.63 RecalculaƟon Charges 06/20 202007143146110685055.9200.500210 $ ‐67.87 RecalculaƟon Charges 06/20 202007143146110685$ 90,312.1707/20/2020 9997055.9200.500180 $ 225,608.00 Minimum Cost 07/20 PV0720SO CAL PUBLIC POWER AUTHORITY002517 ‐ 055.9200.500150 $ 52,118.00 Variable Cost 06/20 PV0720055.122100 $ 10,000.00 PSF Cost 06/20 PV0720$ 287,726.0007/21/2020 9998Printed: 8/19/2020 1:45:45PMPage 1 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020ELECTRONICVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTPAYMENTNUMBERPAYMENTDATE055.9000.592010 $ 1,100.00 Depository Agent & Audit ConfirmaƟon 2522303807BANK OF NEW YORK MELLON002533 ‐ $ 1,100.0007/21/2020 9999011.1004.520000 $ 425.32 Postage 770235NDS006687 ‐ $ 425.3207/21/2020 10000055.9200.596200 $ 381.49 Electronic Tagging~ 156341 055.0002734OPEN ACCESS TECHNOLOGY INTL, I000629 ‐ 055.9200.596200 $ 460.27 Charges: January ‐ June 2020~ 156341 055.0002734$ 841.7607/21/2020 10001011.1043.595200 $ 6,430.00 ADA Self EvaluaƟon & TransiƟon Plan 245624SALLY SWANSON ARCHITECTS, INC006702 ‐ $ 6,430.0007/21/2020 10002011.1003.596200 $ 1,324.88 Storage Services 513879WILLIAMS DATA MANAGEMENT003584 ‐ $ 1,324.8807/21/2020 10003055.9200.500170 $ 21,870.00 Electric Energy TransacƟons GA196848DEPARTMENT OF WATER & POWER002468 ‐ 055.9200.500260 $ 575.00 Electric Energy TransacƟons GA196848$ 22,445.0007/23/2020 10004055.9200.500160 $ 134,085.00 Natural Gas 06/20 62428CALPINE ENERGY SERVICES, L.P.002060 ‐ $ 134,085.0007/23/2020 10005Printed: 8/19/2020 1:45:45PMPage 2 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020ELECTRONICVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTPAYMENTNUMBERPAYMENTDATE055.9200.500160 $ 46,550.00 Natural Gas 06/20 620105372CIMA ENERGY, LP006298 ‐ $ 46,550.0007/23/2020 10006011.9019.590110 $ 535.60 Veeam Backup for MicrosoŌ Office 365 ‐ 1100742429 011.0014409INSIGHT PUBLIC SECTOR, INC003606 ‐ $ 535.6007/23/2020 10007055.9200.500160 $ 518,941.25 Natural Gas 06/20 GASI00140491MACQUARIE ENERGY, LLC006086 ‐ $ 518,941.2507/23/2020 10008055.9200.500160 $ 111,174.15 Natural Gas 06/20 272869MIECO, INC006318 ‐ $ 111,174.1507/23/2020 10009055.9200.500160 $ 53,860.00 Natural Gas 06/20 229047PACIFIC SUMMIT ENERGY, LLC005908 ‐ $ 53,860.0007/23/2020 10010055.9200.500160 $ 449,532.43 Natural Gas 06/20 3202466MERCURIA ENERGY AMERICA, INC006262 ‐ $ 449,532.4307/23/2020 10011055.9200.500150 $ 29,647.96 Boulder Canyon Project Charges 06/20 GG1766W0620US DEPARTMENT OF ENERGY002227 ‐ 055.9200.500180 $ 25,180.17 Boulder Canyon Project Charges 06/20 GG1766W0620$ 54,828.1307/23/2020 10012011.1004.401250 $ 61,692.80 Sales Tax Sharing Agreement~ 071520NATIONAL READY MIXED CONCRETE006571 ‐ $ 61,692.8007/23/2020 10013Printed: 8/19/2020 1:45:45PMPage 3 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020ELECTRONICVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTPAYMENTNUMBERPAYMENTDATE056.200100 $ 378,844.48 Refund receipt #: 0019335~ Ref000225999SMUD006483 ‐ $ 378,844.4807/23/2020 10014055.9200.500154 $ 246,634.16 Antelope DSR 1 Solar Project DSR10720SO CAL PUBLIC POWER AUTHORITY002517 ‐ $ 246,634.1607/23/2020 10015011.120030 $ 3,321.14 Diesel Fuel 2202352 011.0014402MERRIMAC ENERGY GROUP000209 ‐ 011.120030 $ 3.75 AB32 Fee 2202352 011.0014402011.120030 $ 709.56 State Diesel Tax 2202352 011.0014402011.120030 $ 1.97 Lust Fee 2202352 011.0014402011.120030 $ 507.33 Clear Diesel Sales Tax 2202352011.120030 $ 10,253.85 Unleaded Fuel 2202353 011.0014402011.120030 $ 20.80 Ca Enviro / Federal Oil Spill Tax 2202353 011.0014402011.120030 $ 8.87 Ca. Childhood Lead Fee 2202353 011.0014402011.120030 $ 22.93 AB32 Fee 2202353 011.0014402011.120030 $ 2,795.43 State Gasoline Tax 2202353 011.0014402011.120030 $ 5.91 Lust Fee 2202353 011.0014402011.120030 $ 589.83 Fuel Sales Tax 4.50% 2202353$ 18,241.3707/24/2020 10016011.1033.850000 $ 158,059.45 Rental Payment 855869PNC EQUIPMENT FINANCE, LLC005872 ‐ $ 158,059.4507/24/2020 10017Printed: 8/19/2020 1:45:45PMPage 4 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020ELECTRONICVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTPAYMENTNUMBERPAYMENTDATE055.9200.500150 $ 2,108.41 RecalculaƟon Charges 04/20 202007213146192007CALIFORNIA ISO002412 ‐ 055.9200.500190 $ 490.98 RecalculaƟon Charges 04/20 202007213146192007055.9200.500151 $ ‐0.48 RecalculaƟon Charges 04/20 202007213146192007055.9200.500170 $ ‐142.72 RecalculaƟon Charges 04/20 202007213146192007055.9200.500180 $ ‐10.76 RecalculaƟon Charges 04/20 202007213146192007055.9200.500150 $ 7,472.34 RecalculaƟon Charges 07/20 202007213146192007055.9200.500190 $ 346.56 RecalculaƟon Charges 07/20 202007213146192007055.9200.500210 $ 256.84 RecalculaƟon Charges 07/20 202007213146192007055.9200.500151 $ ‐0.01 RecalculaƟon Charges 07/20 202007213146192007055.9200.500170 $ ‐82.75 RecalculaƟon Charges 07/20 202007213146192007055.9200.500150 $ 154,874.68 IniƟal Charges 07/20 202007213146192007055.9200.500210 $ 16,008.39 IniƟal Charges 07/20 202007213146192007055.9200.500151 $ ‐0.39 IniƟal Charges 07/20 202007213146192007055.9200.500170 $ ‐6,780.93 IniƟal Charges 07/20 202007213146192007Printed: 8/19/2020 1:45:45PMPage 5 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020ELECTRONICVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTPAYMENTNUMBERPAYMENTDATE055.9200.500190 $ ‐14,391.86 IniƟal Charges 07/20 202007213146192007CALIFORNIA ISO002412 ‐ 055.9200.500150 $ 2,285.47 RecalculaƟon Charges 06/20 202007213146192007055.9200.500170 $ 34,480.56 RecalculaƟon Charges 06/20 202007213146192007055.9200.500190 $ 320.01 RecalculaƟon Charges 06/20 202007213146192007055.9200.500210 $ 40.29 RecalculaƟon Charges 06/20 202007213146192007055.9200.500240 $ 213.92 RecalculaƟon Charges 06/20 202007213146192007055.9200.500180 $ ‐0.37 RecalculaƟon Charges 06/20 202007213146192007$ 197,488.1807/27/2020 10018055.200230 $ 80,544.00 Electrical Energy Surcharge 04/20 ‐ 072320CA DEPARTMENT OF TAX & FEE ADM002242 ‐ $ 80,544.0007/28/2020 10019055.9200.596200 $ 5,910.00 Bloomberg Terminal~ 5605600075BLOOMBERG FINANCE, LP001479 ‐ $ 5,910.0007/28/2020 10020055.9200.596200 $ 1,250.00 OTC Commission Adjustment 620001688088ICE US OTC COMMODITY MARKETS,004500 ‐ $ 1,250.0007/28/2020 10021Printed: 8/19/2020 1:45:45PMPage 6 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020ELECTRONICVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTPAYMENTNUMBERPAYMENTDATE057.1057.550000 $ 103.59 Reimb. Internet Charges 10/19‐12/19 072820DIANA MORALES GONZALES005365 ‐ $ 103.5907/28/2020 10022055.9000.595200 $ 286,918.33 Re: Bicent PPA Outage~ 4440583MORGAN, LEWIS & BOCKIUS, LLP001441 ‐ 055.9000.595200 $ 282,924.10 Re: Bicent PPA Outage~ 4463820055.9000.595200 $ 199,658.35 Re: Bicent PPA Outage~ 4484994$ 769,500.7807/28/2020 10023011.1033.594000 $ 5,950.00 HMN4080A~ 16089612 011.0014181MOTOROLA SOLUTIONS, INC000016 ‐ 011.1033.594000 $ 565.25 Sales Tax 9.5% 16089612$ 6,515.2507/28/2020 10024055.9200.596200 $ 6,393.75 SoŌware Services Fee 08/20 VERN57POWER SETTLEMENTS CONSULTING &005658 ‐ $ 6,393.7507/28/2020 10025055.9200.500154 $ 268,640.57 Puente Hills Landfill Gas Project PHL0720SO CAL PUBLIC POWER AUTHORITY002517 ‐ $ 268,640.5707/28/2020 10026055.9200.596200 $ 10,509.03 ResoluƟon Billing 720SO CAL PUBLIC POWER AUTHORITY002517 ‐ 055.9000.596700 $ 2,157.87 ResoluƟon Billing 720055.7200.596702 $ 1,923.18 ResoluƟon Billing 720055.9000.596200 $ 3,290.00 ResoluƟon Billing 720$ 17,880.0807/28/2020 10027Printed: 8/19/2020 1:45:45PMPage 7 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020ELECTRONICVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTPAYMENTNUMBERPAYMENTDATE055.9200.500170 $ 24,669.00 Laguna Bell 07/20 7501146386SO CAL EDISON000059 ‐ 055.9200.500170 $ 53,460.00 Victorville Lugo Vernon 07/20 7501146426055.9200.500170 $ 126,360.00 Mead Laguna Bell 07/20 7501146427$ 204,489.0007/28/2020 10028055.9200.550022 $ 25,000.00 Natural Gas 06/20 202006GS022THE GAS COMPANY001581 ‐ $ 25,000.0007/28/2020 10029055.9200.550022 $ 192,853.95 ReservaƟon & Transmission Charges 06/20 071320THE GAS COMPANY001581 ‐ $ 192,853.9507/28/2020 10030011.200250 $ 135.36 2Q20 Use Tax Payment 063020CA DEPARTMENT OF TAX & FEE ADM002242 ‐ 020.200250 $ 505.64 2Q20 Use Tax Payment 063020$ 641.0007/30/2020 10031011.1024.593200 $ 17,500.00 Monthly Retainer 07/20 071620ALVAREZ‐GLASMAN & COLVIN006865 ‐ $ 17,500.0007/30/2020 10032011.1026.594200 $ 6,105.33 TPA Fees 07/20 IVC21850ATHENS INSURANCE SERVICES, INC004303 ‐ $ 6,105.3307/30/2020 10033057.1057.500173 $ 8,976.29 Internet Access Services 130187752LEVEL 3 COMMUNICATIONS, LLC003053 ‐ $ 8,976.2907/30/2020 10034Printed: 8/19/2020 1:45:45PMPage 8 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020ELECTRONICVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTPAYMENTNUMBERPAYMENTDATE056.5600.900000 $ 9,746.00 6" GTS‐175, 30 DEG ROTOR~ 215466 056.0000604MEASUREMENT CONTROL SYSTEMS, I000839 ‐ 056.5600.900000 $ 14,751.84 4" GTS, 740 PSIG~ 215466 056.0000604056.5600.900000 $ 2,327.29 Sales Tax 9.5% 215466$ 26,825.1307/30/2020 10035011.1026.502031 $ 14,177.82 Medical ReƟrees~ 123653689ANTHEM BLUE CROSS005182 ‐ $ 14,177.8207/30/2020 10036Printed: 8/19/2020 1:45:45PMPage 9 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020ELECTRONICVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTPAYMENTNUMBERPAYMENTDATE055.9000.560010 $ 834.75 Period: 03/20 040720_MULTIPLE(2)VERIZON WIRELESS001481 ‐ 055.8000.560010 $ 1,817.52 Period: 03/20 040720_MULTIPLE(2)055.8200.560010 $ 3,465.49 Period: 03/20 040720_MULTIPLE(2)056.5600.560010 $ 346.52 Period: 03/20 040720_MULTIPLE(2)011.9019.560010 $ 274.21 Period: 04/20 050720_MULTIPLE011.9019.560010 $ 297.04 Period: 04/20 050720_MULTIPLE011.9019.560010 $ 186.18 Period: 04/20 050720_MULTIPLE011.9019.560010 $ 1,722.59 Period: 04/20 050720_MULTIPLE011.9019.560010 $ 2,147.99 Period: 04/20 050720_MULTIPLE011.9019.560010 $ 2,320.51 Period: 04/20 050720_MULTIPLE011.9019.560010 $ 431.95 Period: 04/20 050720_MULTIPLE011.9019.560010 $ 757.27 Period: 04/20 050720_MULTIPLE011.9019.560010 $ 846.94 Period: 04/20 050720_MULTIPLE011.9019.560010 $ 84.76 Period: 04/20 050720_MULTIPLE055.9000.560010 $ 798.46 Period: 04/20 050720_MULTIPLE(2)055.8000.560010 $ 1,834.79 Period: 04/20 050720_MULTIPLE(2)055.8200.560010 $ 2,537.69 Period: 04/20 050720_MULTIPLE(2)056.5600.560010 $ 336.67 Period: 04/20 050720_MULTIPLE(2)Printed: 8/19/2020 1:45:45PMPage 10 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020ELECTRONICVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTPAYMENTNUMBERPAYMENTDATE011.9019.560010 $ 229.36 Period: 05/20 060720_MULTIPLEVERIZON WIRELESS001481 ‐ 011.9019.560010 $ 241.37 Period: 05/20 060720_MULTIPLE011.9019.560010 $ 138.47 Period: 05/20 060720_MULTIPLE011.9019.560010 $ 866.74 Period: 05/20 060720_MULTIPLE011.9019.560010 $ 3,946.01 Period: 05/20 060720_MULTIPLE011.9019.560010 $ 2,076.02 Period: 05/20 060720_MULTIPLE011.9019.560010 $ 414.46 Period: 05/20 060720_MULTIPLE011.9019.560010 $ 558.52 Period: 05/20 060720_MULTIPLE011.9019.560010 $ 851.36 Period: 05/20 060720_MULTIPLE011.9019.560010 $ 48.18 Period: 05/20 060720_MULTIPLE055.9000.560010 $ 547.01 Period: 05/20 060720_MULTIPLE(2)055.8000.560010 $ 1,597.82 Period: 05/20 060720_MULTIPLE(2)055.8200.560010 $ 2,645.13 Period: 05/20 060720_MULTIPLE(2)056.5600.560010 $ 274.42 Period: 05/20 060720_MULTIPLE(2)$ 35,476.2007/20/2020 10056011.1043.560000 $ 50.49 Period: 06/20 063020SO CAL EDISON000059 ‐ 055.8100.560010 $ 37.26 Period: 06/20 063020(2)011.1043.560000 $ 287.90 Period: 06/20 070220$ 375.6507/23/2020 10057Printed: 8/19/2020 1:45:45PMPage 11 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020ELECTRONICVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTPAYMENTNUMBERPAYMENTDATE011.210210 $ 33.71 Medicare Tax: 3rd Party Sick Pay 070820THE DEPARTMENT OF THE TREASURY004075 ‐ $ 33.7107/23/2020 10058056.5600.520000 $ 128.19 Period: 06/20 704330371FEDEX000249 ‐ 055.9000.520000 $ 25.45 Period: 06/20 704976885$ 153.6407/24/2020 10059011.1033.520000 $ 143.63 Small Tools, Plumbing, & Building 062720_MULTIPLE 011.0013950HOME DEPOT CREDIT SERVICES001552 ‐ $ 143.6307/24/2020 10060011.1031.520000 $ 213.21 Supplies 491427869001OFFICE DEPOT002190 ‐ 011.1031.520000 $ 20.25 Sales Tax 9.5% 491427869001011.1031.520000 $ 11.99 Supplies 491444363001011.1031.520000 $ 1.14 Sales Tax 9.5% 491444363001011.1031.520000 $ 30.20 Supplies 491444364001011.1031.520000 $ 2.87 Sales Tax 9.5% 491444364001011.1031.520000 $ 2.74 Supplies 491444365001011.1031.520000 $ 0.26 Sales Tax 9.5% 491444365001$ 282.6607/24/2020 10061055.9200.560010 $ 652.66 Period: 06/20 070220(2)SO CAL EDISON000059 ‐ $ 652.6607/24/2020 10062Printed: 8/19/2020 1:45:45PMPage 12 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020ELECTRONICVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTPAYMENTNUMBERPAYMENTDATE011.1033.520000 $ 31.68 Period: 06/20 933312250(2)UPS001617 ‐ 011.1041.520000 $ 31.00 Period: 06/20 933312250(2)011.1041.520000 $ 31.00 Period: 06/20 933312260(2)$ 93.6807/27/2020 10063Printed: 8/19/2020 1:45:45PMPage 13 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020ELECTRONICVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTPAYMENTNUMBERPAYMENTDATE011.1001.502020 $ 1,407.01 Monthly Expense of UAL~ 100000016090306CALPERS000714 ‐ 011.1002.502020 $ 9,185.37 Monthly Expense of UAL~ 100000016090306011.1003.502020 $ 5,282.91 Monthly Expense of UAL~ 100000016090306011.1004.502020 $ 19,485.72 Monthly Expense of UAL~ 100000016090306011.1024.502020 $ 4,672.32 Monthly Expense of UAL~ 100000016090306011.1026.502020 $ 9,557.03 Monthly Expense of UAL~ 100000016090306011.1031.502020 $ 16,485.87 Monthly Expense of UAL~ 100000016090306011.1033.502020 $ 3,743.17 Monthly Expense of UAL~ 100000016090306011.1040.502020 $ 6,636.83 Monthly Expense of UAL~ 100000016090306011.1041.502020 $ 8,787.16 Monthly Expense of UAL~ 100000016090306011.1043.502020 $ 27,025.15 Monthly Expense of UAL~ 100000016090306011.1046.502020 $ 5,123.63 Monthly Expense of UAL~ 100000016090306011.1047.502020 $ 4,884.70 Monthly Expense of UAL~ 100000016090306011.1048.502020 $ 2,468.90 Monthly Expense of UAL~ 100000016090306011.1049.502020 $ 5,309.46 Monthly Expense of UAL~ 100000016090306057.1057.502020 $ 1,035.34 Monthly Expense of UAL~ 100000016090306011.1060.502020 $ 11,415.34 Monthly Expense of UAL~ 100000016090306020.1084.502020 $ 21,954.62 Monthly Expense of UAL~ 100000016090306056.5600.502020 $ 9,875.60 Monthly Expense of UAL~ 100000016090306055.7100.502020 $ 5,070.53 Monthly Expense of UAL~ 100000016090306055.7200.502020 $ 584.04 Monthly Expense of UAL~ 100000016090306055.8000.502020 $ 8,972.99 Monthly Expense of UAL~ 100000016090306055.8100.502020 $ 23,096.15 Monthly Expense of UAL~ 100000016090306Printed: 8/19/2020 1:45:45PMPage 14 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020ELECTRONICVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTPAYMENTNUMBERPAYMENTDATE055.8400.502020 $ 929.16 Monthly Expense of UAL~ 100000016090306CALPERS000714 ‐ 055.9000.502020 $ 18,344.17 Monthly Expense of UAL~ 100000016090306011.9019.502020 $ 9,079.18 Monthly Expense of UAL~ 100000016090306055.9100.502020 $ 16,220.40 Monthly Expense of UAL~ 100000016090306055.9200.502020 $ 8,840.25 Monthly Expense of UAL~ 100000016090306011.1031.502020 $ 188,509.00 Monthly Expense of UAL~ 100000016090320011.1033.502020 $ 770.00 Monthly Expense of UAL~ 100000016090330011.1031.502020 $ 296.00 Monthly Expense of UAL~ 100000016090340011.1033.502020 $ 300,854.00 Monthly Expense of UAL~ 100000016090348011.1024.502020 $ 54.00 Monthly Expense of UAL~ 100000016090356$ 755,956.0007/29/2020 10064Printed: 8/19/2020 1:45:45PMPage 15 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020ELECTRONICVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTPAYMENTNUMBERPAYMENTDATE055.9200.500150 $ 165,556.16 IniƟal Charges 07/20 202007283146252426CALIFORNIA ISO002412 ‐ 055.9200.500210 $ 15,510.09 IniƟal Charges 07/20 202007283146252426055.9200.500151 $ ‐0.24 IniƟal Charges 07/20 202007283146252426055.9200.500170 $ ‐2,922.73 IniƟal Charges 07/20 202007283146252426055.9200.500190 $ ‐18,620.55 IniƟal Charges 07/20 202007283146252426055.9200.500150 $ 98,414.25 RecalculaƟon Charges 07/20 202007283146252426055.9200.500190 $ 644.89 RecalculaƟon Charges 07/20 202007283146252426055.9200.500210 $ 385.89 RecalculaƟon Charges 07/20 202007283146252426055.9200.500170 $ ‐3,921.80 RecalculaƟon Charges 07/20 202007283146252426$ 255,045.9608/03/2020 10075055.9200.500160 $ 15,955.75 Biomethane RPS62020BIOFUEL GENERATION SERVICES, L005067 ‐ $ 15,955.7508/04/2020 10076057.1057.550000 $ 121.95 Reimb. Internet Charges 04/20‐06/20 073020WILLIAM DAVIS001906 ‐ $ 121.9508/04/2020 10077Printed: 8/19/2020 1:45:45PMPage 16 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020ELECTRONICVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTPAYMENTNUMBERPAYMENTDATE011.1046.520000 $ 335.56 fs131r weed eater 126918 011.0014233GARVEY EQUIPMENT COMPANY000399 ‐ 011.1046.520000 $ 335.56 fs131r weed eater 126918 011.0014233011.1046.520000 $ 233.92 425 4 gallon backpack sprayer 126918 011.0014233011.1046.520000 $ 85.98 Sales Tax 9.5% 126918011.1046.520000 $ 406.96 br700 backpack blower 130489 011.0014370011.1046.520000 $ 406.96 backpack blower 130489 011.0014370011.1046.520000 $ 369.96 sƟhl fs131r loop handle 130489 011.0014370011.1046.520000 $ 36.09 42821410300 air filter 130489 011.0014370011.1046.520000 $ 56.70 41801410300 air filter 130489 011.0014370011.1046.520000 $ 21.00 cmr6h spark plug 130489 011.0014370011.1046.520000 $ 72.30 tj27031a air filter 130489 011.0014370011.1046.520000 $ 44.60 bpmr7a spark plug 130489 011.0014370011.1046.520000 $ 929.00 eu2200ita generator 130489 011.0014370011.1046.520000 $ 240.22 Sales Tax 10.25 130489$ 3,574.8108/04/2020 10078057.1057.550000 $ 121.95 Reimb. Internet Charges 04/20‐06/20 073020DIANA MORALES GONZALES005365 ‐ $ 121.9508/04/2020 10079011.9019.560010 $ 539.14 Audio Conferencing Charges USINV2006120584NTT CLOUD COMMUNICATIONS U.S.006801 ‐ $ 539.1408/04/2020 10080Printed: 8/19/2020 1:45:45PMPage 17 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020ELECTRONICVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTPAYMENTNUMBERPAYMENTDATE011.1024.593200 $ 88.50 Re: Torres / Ong LiƟgaƟon 872118RUTAN & TUCKER, LLP005433 ‐ $ 88.5008/04/2020 10081020.1084.500110 $ 12,265.23 Central Basin Watermaster Service~ CBWM200143WATER REPLENISHMENT DISTRICT001658 ‐ $ 12,265.2308/04/2020 10082011.1033.596200 $ 1,298.02 Billing Services 04/20 2004069WITTMAN ENTERPRISES, LLC004527 ‐ 011.1033.596200 $ 1,494.38 Billing Services 05/20 2005069011.1033.596200 $ 1,532.75 Billing Services 06/20 2006069$ 4,325.1508/04/2020 10083057.1057.550000 $ 121.95 Reimb. Internet Charges 04/20‐06/20 073020MELISSA YBARRA004856 ‐ $ 121.9508/04/2020 10084011.9019.520010 $ 5,151.70 Universal license, sold by bundles of B11919136 011.0014422SHI INTERNATIONAL CORP005925 ‐ $ 5,151.7008/04/2020 10085011.1033.850000 $ 737,351.64 Pay off of Lease No. 191184000 072420PNC EQUIPMENT FINANCE, LLC005872 ‐ $ 737,351.6408/04/2020 10086011.1033.850000 $ 1,207,954.39 Pay Off of Lease No. 206155000 072420(2)PNC EQUIPMENT FINANCE, LLC005872 ‐ $ 1,207,954.3908/04/2020 10087055.9000.592010 $ 2,000.00 Trustee Fee 2522305714BANK OF NEW YORK MELLON002533 ‐ $ 2,000.0008/06/2020 10088Printed: 8/19/2020 1:45:45PMPage 18 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020ELECTRONICVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTPAYMENTNUMBERPAYMENTDATE057.1057.500173 $ 4,139.00 Internet Access Services BBUS00031192BROADBAND LLC000267 ‐ $ 4,139.0008/06/2020 10089020.1084.500130 $ 103,433.89 Potable & Recycled Water VERJUN20CENTRAL BASIN MWD001401 ‐ $ 103,433.8908/06/2020 10090055.9000.596200 $ 19,225.25 Env Support Services 697275CH022CH2M HILL ENGINEERS, INC002426 ‐ $ 19,225.2508/06/2020 10091020.1084.900000 $ 9,250.00 FabricaƟon labor hours to build PP2 10227(2) 011.0014450LENORD'S CUSTOM FABRICATION005004 ‐ 020.1084.900000 $ 1,194.80 2"x 3/16" square steel tubing per for 10227(2) 011.0014450020.1084.900000 $ 809.47 Sales Tax 7.75% 10227(2)$ 11,254.2708/06/2020 10092055.9200.596200 $ 23,750.00 SeƩleCore Perpetual License Fee VERNPLF3POWER SETTLEMENTS CONSULTING &005658 ‐ $ 23,750.0008/06/2020 10093020.1084.500110 $ 174,035.65 Groundwater ProducƟon & Assessment~ 080920WATER REPLENISHMENT DISTRICT001658 ‐ $ 174,035.6508/06/2020 10094Printed: 8/19/2020 1:45:45PMPage 19 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020ELECTRONICVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTPAYMENTNUMBERPAYMENTDATE055.9200.500150 $ ‐308.81 IniƟal Charges 10/17 202008043146363415CALIFORNIA ISO002412 ‐ 055.9200.500190 $ ‐1,046.06 IniƟal Charges 10/17 202008043146363415055.9200.500150 $ 0.07 RecalculaƟon Charges 07/17 202008043146363415055.9200.500150 $ 6,055.85 IniƟal Charges 08/20 202008043146363415055.9200.500210 $ 3,893.68 IniƟal Charges 08/20 202008043146363415055.9200.500151 $ ‐0.01 IniƟal Charges 08/20 202008043146363415055.9200.500170 $ ‐338.01 IniƟal Charges 08/20 202008043146363415055.9200.500190 $ ‐3,423.60 IniƟal Charges 08/20 202008043146363415055.9200.500150 $ 41,346.19 RecalculaƟon Charges 07/20 202008043146363415055.9200.500190 $ 853.44 RecalculaƟon Charges 07/20 202008043146363415055.9200.500210 $ 493.54 RecalculaƟon Charges 07/20 202008043146363415055.9200.500151 $ ‐0.05 RecalculaƟon Charges 07/20 202008043146363415055.9200.500170 $ ‐1,355.12 RecalculaƟon Charges 07/20 202008043146363415055.9200.500150 $ 132,351.45 IniƟal Charges 07/20 202008043146363415Printed: 8/19/2020 1:45:45PMPage 20 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020ELECTRONICVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTPAYMENTNUMBERPAYMENTDATE055.9200.500170 $ 1,212,854.45 IniƟal Charges 07/20 202008043146363415CALIFORNIA ISO002412 ‐ 055.9200.500180 $ 331.77 IniƟal Charges 07/20 202008043146363415055.9200.500210 $ 13,132.05 IniƟal Charges 07/20 202008043146363415055.9200.500240 $ 17,105.83 IniƟal Charges 07/20 202008043146363415055.9200.500170 $ ‐24.35 `IniƟal Charges 07/20 202008043146363415055.9200.500151 $ ‐0.28 `IniƟal Charges 07/20 202008043146363415055.9200.500190 $ ‐14,916.90 `IniƟal Charges 07/20 202008043146363415$ 1,407,005.1308/10/2020 10095011.1026.594200 $ 6,105.33 TPA Fees 08/20 IVC22096ATHENS INSURANCE SERVICES, INC004303 ‐ $ 6,105.3308/11/2020 10096011.9019.520010 $ 1,888.00 WD Blue 3D NAND SATA SSD WDS250G2B0A ‐ZLH3195 011.0014484CDW GOVERNMENT, INC000447 ‐ 011.9019.520010 $ 279.00 Logitech Wireless Combo MK270 ‐ ZLH3195 011.0014484011.9019.520010 $ 148.80 Logitech M510 USB Wireless Mouse 2113710ZLH3195 011.0014484011.9019.520010 $ 83.90 Logitech M325 USB Wireless Mouse ZLH3195 011.0014484011.9019.520010 $ 227.98 Sales Tax 9.5% ZLH3195$ 2,627.6808/11/2020 10097Printed: 8/19/2020 1:45:45PMPage 21 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020ELECTRONICVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTPAYMENTNUMBERPAYMENTDATE020.1084.900000 $ 6,457.37 Well & Booster Pump Repairs 28047GENERAL PUMP COMPANY, INC000147 ‐ $ 6,457.3708/11/2020 10098011.1021.797000 $ 13,750.00 Professional Services~ JUL20JEMMOTT ROLLINS GROUP, INC005108 ‐ $ 13,750.0008/11/2020 10099011.1060.595200 $ 3,000.00 Health Officer Services V003LAURENE MASCOLA006869 ‐ 011.1060.595200 $ 2,550.00 Health Officer Services V004$ 5,550.0008/11/2020 10100011.9019.590110 $ 16,579.00 Astro System Advanced Package~ 8320283134MOTOROLA SOLUTIONS, INC000016 ‐ $ 16,579.0008/11/2020 10101020.1084.900000 $ 81,133.00 Design Services 4095PACIFIC ADVANCED CIVIL ENGINEE006787 ‐ 020.1084.900000 $ 27,465.00 Design Services 4207$ 108,598.0008/11/2020 10102055.9000.596200 $ 25,000.00 ConsulƟng & Support Services VERNPVHJULY2020PORT CANAVERAL PWR CONSULTANTS002459 ‐ $ 25,000.0008/11/2020 10103011.1024.593200 $ 49.81 Re: Los Angeles MS4 Permit PeƟƟon 227676RICHARDS, WATSON & GERSHON003900 ‐ $ 49.8108/11/2020 10104Printed: 8/19/2020 1:45:45PMPage 22 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020ELECTRONICVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTPAYMENTNUMBERPAYMENTDATE055.9200.500154 $ 186,166.51 Astoria 2 Solar Project ATSP0820SO CAL PUBLIC POWER AUTHORITY002517 ‐ $ 186,166.5108/11/2020 10105011.1043.590000 $ 3,239.00 Traffic Signal Maintenance 06/20 5610231851SIEMENS MOBILITY, INC001079 ‐ 011.1043.590000 $ 1,275.46 Traffic Signal Maintenance 06/20 5620029769011.1043.590000 $ 1,176.00 Traffic Signal Maintenance 05/20 5620030977$ 5,690.4608/11/2020 10106011.1043.520000 $ 249.88 Asphalt~ 72547909 011.0013901VULCAN MATERIALS CO001695 ‐ $ 249.8808/11/2020 10107011.1003.596200 $ 375.00 Storage Services 516597WILLIAMS DATA MANAGEMENT003584 ‐ 011.1003.596200 $ 2,952.66 Storage Services 517515$ 3,327.6608/11/2020 10108011.9019.520010 $ 9,072.90 Dell 960GB SSD SAS Mainstream Read~ K15568020101 011.0014453ZONES, INC005784 ‐ 011.9019.520010 $ 1,092.16 Dell 1.8TB 10K RPM SAS 12Gbps 512e 2.5in K15568020101 011.0014453011.9019.520010 $ 965.68 Sales Tax 9.5% K15568020101$ 11,130.7408/11/2020 10109Printed: 8/19/2020 1:45:45PMPage 23 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020ELECTRONICVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTPAYMENTNUMBERPAYMENTDATE056.5600.520000 $ 1,206.82 Service ConnecƟon Materials~ 215467 056.0000566MEASUREMENT CONTROL SYSTEMS, I000839 ‐ 056.5600.520000 $ 843.05 Service ConnecƟon Materials~ 215759 056.0000566056.5600.520000 $ 1,321.47 Service ConnecƟon Materials~ 216817 056.0000566056.5600.520000 $ ‐1,206.82 Service ConnecƟon Materials~ C216816 056.0000566$ 2,164.5208/13/2020 10110056.5600.596200 $ 350.00 CalibraƟon Services~ 114736IN 056.0000572WILMINGTON INSTRUMENT COMPANY,003177 ‐ 056.5600.596200 $ 504.43 CalibraƟon Services~ 114995IN 056.0000572056.5600.596200 $ 2,388.13 CalibraƟon Services~ 115080IN 056.0000572056.5600.596200 $ 359.85 CalibraƟon Services~ 115261IN 056.0000572056.5600.520000 $ 1,032.69 CalibraƟon Services~ 115299IN 056.0000572056.5600.520000 $ 1,773.86 CalibraƟon Services~ 119603 056.0000572056.5600.596200 $ 179.93 CalibraƟon Services~ 119610 056.0000572$ 6,588.8908/13/2020 10111011.1024.593200 $ 17,500.00 Monthly Retainer 08/20 080320ALVAREZ‐GLASMAN & COLVIN006865 ‐ $ 17,500.0008/13/2020 10112011.9019.590110 $ 18,213.69 Onboard & Perform SubscripƟon~ INV‐14255NEOGOV004882 ‐ 011.9019.590110 $ 10,207.15 Governmentjobs & Insight SubscripƟon~ INV14747011.9019.590110 $ 450.00 Candidate Text Messaging SubscripƟon~ INV15955$ 28,870.8408/13/2020 10113Printed: 8/19/2020 1:45:45PMPage 24 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020ELECTRONICVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTPAYMENTNUMBERPAYMENTDATE055.9200.596200 $ 841.76 Electronic Tagging~ 157257 055.0002815OPEN ACCESS TECHNOLOGY INTL, I000629 ‐ $ 841.7608/13/2020 10114056.5600.590000 $ 3,900.50 Pipeline Integrity InspecƟon 219772TECHCORR USA MANAGEMENT LLC004854 ‐ $ 3,900.5008/13/2020 10115Printed: 8/19/2020 1:45:45PMPage 25 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020ELECTRONICVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTPAYMENTNUMBERPAYMENTDATE011.1043.520000 $ 394.25 Supplies 062220US BANK CORPORATE005594 ‐ 056.5600.520000 $ 191.82 Supplies 062220(10)011.1070.550000 $ 310.00 GiŌ Cards / GraduaƟon CelebraƟon 062220(11)011.1023.596600 $ 56.00 LA Times SubscripƟon 062220(11)011.1001.596500 $ 200.00 RegistraƟon / C. Menke 062220(11)011.1070.550000 $ 452.19 Supplies / GraduaƟon CelebraƟon 062220(11)011.1002.570000 $ 300.00 Detailing Services 062220(12)011.1002.520000 $ 27.36 Supplies 062220(12)011.1043.520000 $ 123.74 Face Shields 062220(13)011.9019.520010 $ 16.99 Adobe SubscripƟon 062220(14)011.9019.520010 $ 148.50 GoToAssist Licenses 062220(14)011.9019.520010 $ 14.00 GoToMeeƟng SubscripƟon 062220(14)011.9019.590110 $ 681.00 GoToMeeƟng SubscripƟon 062220(14)011.9019.520010 $ 306.90 Helpdesk SoŌware 062220(14)011.9019.520010 $ 9.99 MicrosoŌ BI SubscripƟon 062220(14)011.9019.520010 $ 64.20 MicrosoŌ Office 365 SubscripƟon 062220(14)011.9019.520010 $ 165.00 MicrosoŌ OneDrive 062220(14)011.9019.520010 $ 30.00 MicrosoŌ Project SubscripƟon 062220(14)011.9019.520010 $ 14.22 Prime Membership Fee 062220(14)011.9019.520010 $ 655.80 Printer 062220(14)011.9019.520010 $ 52.99 Adobe SubscripƟon 062220(14)011.9019.520010 $ 358.07 Printhead 062220(14)011.9019.520010 $ 38.85 Publishing SoŌware for VPU 062220(14)Printed: 8/19/2020 1:45:45PMPage 26 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020ELECTRONICVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTPAYMENTNUMBERPAYMENTDATE011.9019.520010 $ 9.99 SoŌware for PMS 062220(14)US BANK CORPORATE005594 ‐ 011.9019.520010 $ 561.58 Spare Printer 062220(14)011.9019.520010 $ 306.53 Spare Webcams 062220(14)011.9019.520010 $ 75.51 Spare Wireless Keyboard 062220(14)011.9019.520010 $ 159.68 USB Extender / Council Chamber Project 062220(14)011.9019.520010 $ 155.38 Waste Cartridge 062220(14)011.9019.520010 $ 329.49 Webcam / Council Chamber Project 062220(14)011.9019.520010 $ 554.98 Wildcard CerƟficate Renewal 062220(14)011.9019.520010 $ 15.00 Approval SoŌware 062220(14)011.9019.520010 $ 9.99 Arlo Camera Plan 062220(14)011.9019.520010 $ 60.57 Charge Cable & Adapter 062220(14)011.9019.520010 $ 29.00 Council Webinar Camera SoŌware 062220(14)011.9019.520010 $ 595.61 Docking StaƟon 062220(14)011.9019.590110 $ 69.99 Domain Name Renewal 062220(14)011.9019.520010 $ 888.37 Google Gsuite 062220(14)011.1046.596700 $ 223.21 AES Study Guides 062220(15)011.1046.520000 $ 2,737.50 Electric Bed Cover for L1004 062220(15)011.1046.520000 $ 403.50 LiŌ InspecƟon Services 062220(15)011.1046.520000 $ 159.74 Supplies 062220(15)011.1004.596500 $ 39.21 Fuel for City Vehicle 062220(16)011.1033.540000 $ 232.86 Uniforms 062220(17)011.1004.596600 $ 129.00 Books & PublicaƟons 062220(18)011.1031.540000 $ 28.42 Badge Repair 062220(19)Printed: 8/19/2020 1:45:45PMPage 27 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020ELECTRONICVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTPAYMENTNUMBERPAYMENTDATE011.1031.596700 $ 450.00 Training / Staff 062220(19)US BANK CORPORATE005594 ‐ 011.1031.540000 $ 2,455.61 Uniforms 062220(19)011.1031.570000 $ 66.02 Vehicle Expense 062220(19)055.8300.520000 $ 547.49 Camera for StaƟon 76 062220(2)011.1070.550000 $ 200.00 GiŌ Cards / GraduaƟon CelebraƟon 062220(2)011.1001.596500 $ 232.73 Meals / Jawbone Canyon Trip 062220(2)011.1002.596500 $ 97.16 Meals / MeeƟng 062220(2)011.1070.550000 $ 9.00 Parking / GraduaƟon CelebraƟon 062220(2)011.1070.550000 $ 829.32 Supplies / GraduaƟon CelebraƟon 062220(2)011.1001.596500 $ 3.82 Supplies / Jawbone Canyon Trip 062220(2)011.1049.520000 $ 459.83 Forehead Thermometers 062220(20)011.1049.520000 $ 49.82 Supplies 062220(20)011.1049.520000 $ 1,314.00 Toilet ParƟƟons 062220(20)055.9000.540000 $ 2,474.34 Uniforms 062220(21)011.1003.596550 $ 90.00 Membership Dues 062220(22)011.1003.596550 $ 40.00 Membership Dues / S. Dolson 062220(22)011.1003.596700 $ 35.00 Training / CCAC 062220(22)011.1004.520000 $ 81.99 Supplies 062220(23)011.1033.520000 $ 238.69 Supplies 062220(24)011.1031.570000 $ 6.00 Vehicle Expense 062220(25)011.1046.520000 $ 580.00 Detailing Services 062220(26)011.1046.520000 $ 711.85 Hybrid BaƩery H201 062220(26)011.1046.520000 $ 70.00 Stereo InstallaƟon L1004 062220(26)Printed: 8/19/2020 1:45:45PMPage 28 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020ELECTRONICVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTPAYMENTNUMBERPAYMENTDATE011.1049.520000 $ 2,367.41 Disinfectant Cleaner & Spray BoƩle 062220(27)US BANK CORPORATE005594 ‐ 011.1049.520000 $ 606.38 Face Masks 062220(27)011.1049.520000 $ 137.89 Floors Signs for Social Distancing 062220(27)011.1049.520000 $ 262.77 Supplies 062220(27)011.1048.520000 $ 352.00 Supplies 062220(28)011.1031.520000 $ 302.18 Supplies 062220(29)055.9000.596700 $ 2,685.00 Training 062220(3)055.9000.596200 $ 1,126.36 TranslaƟon Services 062220(3)011.1049.520000 $ 541.41 Parts for City Hall Maintenance 062220(30)057.1057.590000 $ 509.60 Wi‐Fi Range Extender 062220(31)020.1084.550000 $ 411.21 AdverƟsement & PromoƟon 062220(32)020.1084.900000 $ 1,584.03 SCADA / Electrical Upgrades 062220(32)020.1084.900000 $ 2,561.01 Doors & Assembly Parts 062220(33)020.1084.520000 $ 517.15 SCADA / Electrical Upgrades 062220(33)011.1033.520000 $ 32.31 Supplies 062220(34)055.9000.596550 $ 77.66 Cable SubscripƟon 062220(4)011.5031.560000 $ 61.56 Cable SubscripƟon 062220(5)011.1031.520000 $ 2,978.40 Gloves 062220(5)011.1031.540000 $ 4,773.34 Uniforms 062220(5)011.1002.570000 $ 70.00 Fuel for City Vehicle 062220(6)011.1033.520000 $ 61.17 Supplies 062220(7)011.1043.596700 $ 250.00 Training Material 062220(8)011.1033.590000 $ 557.37 CalibraƟon Gas 062220(9)Printed: 8/19/2020 1:45:45PMPage 29 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020ELECTRONICVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTPAYMENTNUMBERPAYMENTDATE$ 46,255.8608/13/2020 10116011.1043.560000 $ 73.09 Period: 06/15/20 ‐ 07/16/20 071720SO CAL EDISON000059 ‐ $ 73.0908/07/2020 10117055.9100.502070 $ 5,400.00 Unemployment Insurance Benefit Charge~ L1721822944EMPLOYMENT DEVELOPMENT DEPT.001635 ‐ 011.1004.502070 $ 5,440.00 Unemployment Insurance Benefit Charge~ L1721822944011.1004.502070 $ 5,328.00 Unemployment Insurance Benefit Charge~ L1721822944011.1031.502070 $ 1,127.00 Unemployment Insurance Benefit Charge~ L1721822944011.1026.502070 $ 4,248.00 Unemployment Insurance Benefit Charge~ L1721822944$ 21,543.0008/10/2020 10118011.1033.520000 $ 18.02 Period: 05/20 933312270UPS001617 ‐ 011.1041.520000 $ 57.92 Period: 05/20 933312270011.1041.520000 $ 73.25 Period: 06/20 933312280(2)055.8000.590000 $ 67.49 Period: 06/20 933312290(2)011.1041.520000 $ 31.00 Period: 06/20 933312290(2)$ 247.6808/11/2020 10119Printed: 8/19/2020 1:45:45PMPage 30 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020ELECTRONICVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTPAYMENTNUMBERPAYMENTDATE011.1048.560000 $ 24.76 Period: 06/20 071020THE GAS COMPANY001581 ‐ 011.1049.560000 $ 665.85 Period: 06/20 071320(2)011.1049.560000 $ 428.05 Period: 06/20 071320(3)011.1043.560000 $ 214.02 Period: 06/20 071320(3)020.1084.560000 $ 214.02 Period: 06/20 071320(3)056.5600.560000 $ 21.71 Period: 06/20 071320(4)$ 1,568.4108/03/2020 10120011.1033.560000 $ 14.19 Period: 06/20 071020(2)THE GAS COMPANY001581 ‐ 011.1033.560000 $ 97.63 Period: 06/20 071020(3)011.1033.560000 $ 47.01 Period: 06/20 071020(4)$ 158.8308/14/2020 10121011.1049.520000 $ 340.13 Supplies 512002302001OFFICE DEPOT002190 ‐ 011.1049.520000 $ 32.31 Sales Tax 9.5% 512002302001$ 372.4408/14/2020 10122TOTAL ELECTRONIC$ 9,796,376.07Printed: 8/19/2020 1:45:45PMPage 31 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020EARLY CHECKSVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTCHECKNUMBERPAYMENTDATE011.1033.540000 $ 296.68 Haix Structure Boots~ 224479 011.0013980ALLSTAR FIRE EQUIPMENT, INC001624 ‐ $ 296.6807/21/2020 605922011.1049.590000 $ 6,500.00 Replace AC for Server Room 2601AL'S MECHANICAL, INC006680 ‐ $ 6,500.0007/21/2020 605923011.1043.560000 $ 44.75 Period: 06/20 062220(2)CALIFORNIA WATER SERVICE CO000778 ‐ $ 44.7507/21/2020 605924020.1084.540000 $ 139.09 Uniforms 4052764031CINTAS CORPORATION005490 ‐ 055.8000.540000 $ 41.11 Uniforms 4052764031055.8100.540000 $ 260.41 Uniforms 4052764031056.5600.540000 $ 52.64 Uniforms 4052764031020.1084.540000 $ 148.28 Uniforms 4053534833055.8000.540000 $ 41.10 Uniforms 4053534833055.8100.540000 $ 164.12 Uniforms 4053534833056.5600.540000 $ 70.47 Uniforms 4053534833020.1084.540000 $ 140.11 Uniforms 4054154966055.8000.540000 $ 41.11 Uniforms 4054154966055.8100.540000 $ 164.12 Uniforms 4054154966056.5600.540000 $ 52.63 Uniforms 4054154966$ 1,315.1907/21/2020 605925Printed: 8/19/2020 1:45:45PMPage 32 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020EARLY CHECKSVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTCHECKNUMBERPAYMENTDATE011.1049.590000 $ 3,375.00 Replace Hinge on Door 18809COMMERCIAL DOOR OF LOS ANGELES000331 ‐ $ 3,375.0007/21/2020 605926055.8000.590000 $ 3,484.00 CH 4OOA 3PH /4W 48OV 65K~ 262328 055.0002794CURRENT WHOLESALE ELECTRIC SUP001336 ‐ 055.8000.590000 $ 315.00 EM15 15 CLIP METER SOCKET 262328 055.0002794055.8000.590000 $ 692.00 GHB31OOI 1OOA 3 POLE ~ 262328 055.0002794055.8000.590000 $ 280.00 GHB31OOI 30 A 3 POLE ~ 262328 055.0002794055.8000.590000 $ 453.25 Sales Tax 9.5% 262328011.1049.520000 $ 30.44 Electrical Supplies & Hardware~ 262904 011.0013889011.1049.520000 $ 18.59 Electrical Supplies & Hardware~ 262999 011.0013889011.1049.520000 $ 60.01 Electrical Supplies & Hardware~ 263085 011.0013889011.1049.520000 $ 70.08 Electrical Supplies & Hardware~ 263344 011.0013889011.1049.520000 $ 204.77 Electrical Supplies & Hardware~ 263345 011.0013889011.1049.520000 $ 52.56 Electrical Supplies & Hardware~ 263346 011.0013889011.1049.520000 $ 52.34 Electrical Supplies & Hardware~ 263347 011.0013889$ 5,713.0407/21/2020 605927011.1004.410212 $ 50.00 Ref. Alarm System Permit Fee~ 100319EMS FASHION GROUP006673 ‐ $ 50.0007/21/2020 605928Printed: 8/19/2020 1:45:45PMPage 33 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020EARLY CHECKSVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTCHECKNUMBERPAYMENTDATE011.1049.520000 $ 232.88 (0500‐100) Regular Coffee 42 ‐ 1.5oz 4073011 011.0014413F GAVINA & SONS, INC001926 ‐ 011.1049.520000 $ 2,451.60 (0500‐105) Gavina Gourmet Drip Coffee 4073011 011.0014413011.1049.520000 $ 20.00 (0500‐141) Coffee SƟr SƟcks 7" 4073011 011.0014413011.1049.520000 $ 15.68 (0500‐145) Coffee Filters 12 cups 4073011 011.0014413011.1049.520000 $ 1,064.00 (0500‐200) Coffee Beans, 5 pd. Bags#4073011 011.0014413011.1049.520000 $ 300.54 (0500‐210) French Vanilla Powder # 546 4073011 011.0014413011.1049.520000 $ 273.00 (0500‐220) Chocolate Powder # 665 4073011 011.0014413011.1049.520000 $ 474.00 (0500‐230) Cream Powder # 3008 4073011 011.0014413011.1049.520000 $ 3.39 Sales Tax 9.5% 4073011$ 4,835.0907/21/2020 605929011.1033.596500 $ 63.82 Woman Only Advanced Handgun Course 070920TERESA FLORES006887 ‐ $ 63.8207/21/2020 605930011.9019.560010 $ 55.01 Period: 05/16/20 ‐ 06/15/20 051620FRONTIER005825 ‐ $ 55.0107/21/2020 605932011.1043.595200 $ 40,000.00 AdministraƟon & Cost Sharing~ LARUR22008GATEWAY WATER MGMT AUTHORITY005421 ‐ 011.1043.596200 $ 60,000.00 AdministraƟon & Cost Sharing~ LARUR22008$ 100,000.0007/21/2020 605933011.1026.594200 $ 75.00 ParƟcipaƟon Fee 218772IGOE & COMPANY, INC000686 ‐ $ 75.0007/21/2020 605934Printed: 8/19/2020 1:45:45PMPage 34 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020EARLY CHECKSVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTCHECKNUMBERPAYMENTDATE011.9019.560010 $ 49.28 Storage Services 202151593IRON MOUNTAIN000829 ‐ $ 49.2807/21/2020 605935011.1049.590000 $ 210.00 Pool Maintenance 5407LA POOL GUYS005340 ‐ $ 210.0007/21/2020 605936011.1049.590000 $ 13,425.62 Free Standing Sneeze Guards 16520MONTEBELLO GLASS & MIRROR CO.005780 ‐ $ 13,425.6207/21/2020 605937055.9000.596500 $ 397.40 EUSERC MeeƟng 062920CHARLES MONTOYA002173 ‐ $ 397.4007/21/2020 605938011.1031.596500 $ 315.00 RegistraƟon / K. Stevenson 071320NATIONAL TRAINING CONCEPTS, IN003276 ‐ $ 315.0007/21/2020 605939011.1046.590000 $ 117.00 Car Wash Services 1006NCM CARWASH006613 ‐ $ 117.0007/21/2020 605940011.1046.520000 $ 325.00 Materials 3778 011.0014372NICK ALEXANDER RESTORATION000610 ‐ 011.1046.590000 $ 525.00 Labor 3778 011.0014372011.1046.520000 $ 33.31 Sales Tax 10.25 3778$ 883.3107/21/2020 605941011.9019.520010 $ 215.00 Time Tracking System 50330ONEPOINT HUMAN CAPITAL MGMT006475 ‐ $ 215.0007/21/2020 605942Printed: 8/19/2020 1:45:45PMPage 35 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020EARLY CHECKSVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTCHECKNUMBERPAYMENTDATE011.1049.590000 $ 9,005.38 Janitorial Services 69798PRIORITY BUILDING SERVICES, LL006416 ‐ 011.1049.590000 $ 8,660.00 Day Porter Services 69800$ 17,665.3807/21/2020 605943011.1049.520000 $ 2,329.07 Water FiltraƟon Units INV02520745QUENCH USA, INC006486 ‐ $ 2,329.0707/21/2020 605944011.1043.520000 $ 589.02 Concrete 727496ROBERTSON'S003271 ‐ 011.1043.520000 $ 666.43 Concrete 732117$ 1,255.4507/21/2020 605945055.7100.520000 $ 79.00 Business Cards (VPU) ‐ Hilda Moreno~ 27153 055.0002810SILVA'S PRINTING NETWORK003775 ‐ 055.7100.520000 $ 7.51 Sales Tax 9.5% 27153$ 86.5107/21/2020 605946011.1031.596500 $ 79.25 Less Lethal Instructor's Course 071320KENT STEVENSON JR000318 ‐ $ 79.2507/21/2020 605947011.1031.596500 $ 55.77 Woman Only Advanced Handgun Course 070920MARISSA VELEZ006205 ‐ $ 55.7707/21/2020 605948011.1043.590000 $ 10,250.00 Street Sweeping Services 06/20 LB5387WEBCO LB, LLC005699 ‐ $ 10,250.0007/21/2020 605949Printed: 8/19/2020 1:45:45PMPage 36 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020EARLY CHECKSVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTCHECKNUMBERPAYMENTDATE011.1033.520000 $ 5,371.20 Monsato Phos Check Class "A" Foam in 5 225048 011.0014405ALLSTAR FIRE EQUIPMENT, INC001624 ‐ 011.1033.520000 $ 510.26 Sales Tax 9.5% 225048$ 5,881.4607/28/2020 605950055.9200.560010 $ 152.00 Period: 05/19/20 ‐ 06/18/20 6098865505AT&T001948 ‐ $ 152.0007/28/2020 605951011.1026.596200 $ 11,776.66 Re: Jerrick Torres & City of Vernon 072120STEPHEN M. BIERSMITH006624 ‐ $ 11,776.6607/28/2020 605952011.1024.593200 $ 279.00 Re: Garcia‐MarƟnez v. City of Vernon 256130BURKE, WILLIAMS & SORENSEN, LL005078 ‐ 011.1024.593200 $ 16.59 Re: Lopez, Reina v. City of Vernon 256133$ 295.5907/28/2020 605953011.1043.596200 $ 5,426.81 CY2019 Hazardous Waste Generator Fee 072220CA DEPARTMENT OF TAX & FEE ADM002242 ‐ $ 5,426.8107/28/2020 605954011.1041.595200 $ 249.30 2nd Qtr 04/01/20 ‐ 06/30/20 072020CA BUILDING STANDARDS COMMISSI003749 ‐ $ 249.3007/28/2020 605955Printed: 8/19/2020 1:45:45PMPage 37 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020EARLY CHECKSVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTCHECKNUMBERPAYMENTDATE011.1043.540000 $ 66.57 Uniforms 4049899977CINTAS CORPORATION005490 ‐ 011.1046.540000 $ 44.38 Uniforms 4049899977011.1047.540000 $ 44.38 Uniforms 4049899977011.1049.540000 $ 66.56 Uniforms 4049899977011.1043.540000 $ 66.57 Uniforms 4050467899011.1046.540000 $ 44.38 Uniforms 4050467899011.1047.540000 $ 44.38 Uniforms 4050467899011.1049.540000 $ 66.56 Uniforms 4050467899011.1043.540000 $ 66.57 Uniforms 4051147131011.1046.540000 $ 44.38 Uniforms 4051147131011.1047.540000 $ 44.38 Uniforms 4051147131011.1049.540000 $ 66.56 Uniforms 4051147131011.1043.540000 $ 66.57 Uniforms 4051636755011.1046.540000 $ 44.38 Uniforms 4051636755011.1047.540000 $ 44.38 Uniforms 4051636755011.1049.540000 $ 66.56 Uniforms 4051636755011.1043.540000 $ 65.80 Uniforms 4052321496011.1046.540000 $ 43.86 Uniforms 4052321496011.1047.540000 $ 43.86 Uniforms 4052321496011.1049.540000 $ 65.80 Uniforms 4052321496011.1043.540000 $ 63.77 Uniforms 4052888683011.1046.540000 $ 42.51 Uniforms 4052888683011.1047.540000 $ 42.51 Uniforms 4052888683Printed: 8/19/2020 1:45:45PMPage 38 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020EARLY CHECKSVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTCHECKNUMBERPAYMENTDATE011.1049.540000 $ 63.78 Uniforms 4052888683CINTAS CORPORATION005490 ‐ 011.1043.540000 $ 65.99 Uniforms 4053535065011.1046.540000 $ 43.99 Uniforms 4053535065011.1047.540000 $ 43.99 Uniforms 4053535065011.1049.540000 $ 65.98 Uniforms 4053535065011.1043.540000 $ 84.57 Uniforms 4054154824011.1046.540000 $ 56.38 Uniforms 4054154824011.1047.540000 $ 56.38 Uniforms 4054154824011.1049.540000 $ 84.56 Uniforms 4054154824020.1084.540000 $ 139.09 Uniforms 4054721456055.8000.540000 $ 41.11 Uniforms 4054721456055.8100.540000 $ 164.12 Uniforms 4054721456056.5600.540000 $ 52.63 Uniforms 4054721456020.1084.540000 $ 139.10 Uniforms 4055430049055.8000.540000 $ 41.11 Uniforms 4055430049055.8100.540000 $ 166.15 Uniforms 4055430049056.5600.540000 $ 52.63 Uniforms 4055430049020.1084.540000 $ 139.09 Uniforms 4056059636055.8000.540000 $ 41.11 Uniforms 4056059636055.8100.540000 $ 164.11 Uniforms 4056059636056.5600.540000 $ 52.64 Uniforms 4056059636$ 3,014.1807/28/2020 605956Printed: 8/19/2020 1:45:45PMPage 39 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020EARLY CHECKSVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTCHECKNUMBERPAYMENTDATE011.1060.595200 $ 1,426.37 Animal Control Services~ 234447CITY OF DOWNEY001473 ‐ $ 1,426.3707/28/2020 605957055.8400.590000 $ 975.22 Maintenance & Repairs 36489COMPRESSED AIR SPECIALTIES INC000988 ‐ $ 975.2207/28/2020 605958Printed: 8/19/2020 1:45:45PMPage 40 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020EARLY CHECKSVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTCHECKNUMBERPAYMENTDATE020.1084.590000 $ 1,331.66 Emergency Purchase for Washington Sump 262859 011.0014343CURRENT WHOLESALE ELECTRIC SUP001336 ‐ 020.1084.590000 $ 126.51 Sales Tax 9.5% 262859020.1084.590000 $ 183.53 Emergency Purchase for Washington Sump 262860 011.0014343020.1084.590000 $ 17.44 Sales Tax 9.5% 262860020.1084.590000 $ 3,277.43 Emergency Purchase for Washington Sump 262861 011.0014343020.1084.590000 $ 311.36 Sales Tax 9.5% 262861020.1084.590000 $ 38.85 Emergency Purchase for Washington Sump 262862 011.0014343020.1084.590000 $ 3.69 Sales Tax 9.5% 262862020.1084.590000 $ 1,000.07 Emergency Purchase for Washington Sump 262863 011.0014343020.1084.590000 $ 95.01 Sales Tax 9.5% 262863020.1084.590000 $ 431.37 Emergency Purchase for Washington Sump 262864 011.0014343020.1084.590000 $ 40.98 Sales Tax 9.5% 262864020.1084.590000 $ 354.82 Emergency Purchase for Washington Sump 262865 011.0014343020.1084.590000 $ 33.71 Sales Tax 9.5% 262865020.1084.590000 $ 797.90 Emergency Purchase for Washington Sump 262866 011.0014343020.1084.590000 $ 75.80 Sales Tax 9.5% 262866020.1084.590000 $ 135.30 Emergency Purchase for Washington Sump 262867 011.0014343020.1084.590000 $ 12.85 Sales Tax 9.5% 262867$ 8,268.2807/28/2020 605959011.1041.595200 $ 1,521.59 Mapping Fee 2nd Qtr 2020 072020DEPARTMENT OF CONSERVATION000977 ‐ $ 1,521.5907/28/2020 605960Printed: 8/19/2020 1:45:45PMPage 41 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020EARLY CHECKSVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTCHECKNUMBERPAYMENTDATE055.8400.590000 $ 122.00 Pest Control Services 13447251DEWEY PEST CONTROL002566 ‐ 056.5600.590000 $ 65.00 Pest Control Services 13527214$ 187.0007/28/2020 605961011.1033.520000 $ 5,700.00 Item No. SVC‐Flowtest~ 93266 011.0014398EXTREME SAFETY, INC004730 ‐ 011.1033.520000 $ 150.00 Item No. SVC‐Travel~ 93266 011.0014398011.1033.520000 $ 555.75 Sales Tax 9.75% 93266$ 6,405.7507/28/2020 605962056.5600.590000 $ 7,150.00 Corrosion Engineering Services 20073INFARWEST CORROSION CONTROL CO.002947 ‐ $ 7,150.0007/28/2020 605963011.1043.596550 $ 15,000.00 Membership Dues FY 2020‐2021 202126GATEWAY WATER MGMT AUTHORITY005421 ‐ $ 15,000.0007/28/2020 605964011.1041.595200 $ 1,440.00 Building Plan Check & InspecƟon 60381INTERWEST CONSULTING GROUP, IN004143 ‐ 011.1041.595200 $ 146.33 Building Plan Check & InspecƟon 60382011.1041.595200 $ 1,800.00 Building Plan Check & InspecƟon 61147$ 3,386.3307/28/2020 605965011.1060.520000 $ 1,560.00 2021‐2021 VEHICLE DECALS 81008 011.0014399KENNEDY NAMEPLATE COMPANY, INC001832 ‐ 011.1060.520000 $ 148.20 Sales Tax 9.5% 81008$ 1,708.2007/28/2020 605966Printed: 8/19/2020 1:45:45PMPage 42 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020EARLY CHECKSVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTCHECKNUMBERPAYMENTDATE011.1049.520000 $ 51.45 Plumbing & Building Hardware~ 108179 011.0013893LB JOHNSON HARDWARE CO #1000804 ‐ 011.1049.520000 $ 30.40 Plumbing & Building Hardware~ 108372 011.0013893011.1048.520000 $ 20.79 Plumbing & Building Hardware~ 108560 011.0013893011.1049.520000 $ 24.08 Plumbing & Building Hardware~ 108727 011.0013893$ 126.7207/28/2020 605967011.1046.520000 $ 220.42 XTP MulƟcolor 8 LED Split Lights 1172851 011.0014371LU'S LIGHTHOUSE, INC000121 ‐ 011.1046.520000 $ 220.42 XTP MulƟcolor 8 LED Split Lights 1172851 011.0014371011.1046.520000 $ 41.88 Sales Tax 9.5% 1172851$ 482.7207/28/2020 605968011.1041.520000 $ 2,414.69 Plan Check Services 14245MELVYN GREEN & ASSOCIATES, INC001096 ‐ $ 2,414.6907/28/2020 605969011.1046.520000 $ 399.28 Glow Plug Module 3522 011.0014373PACIFIC AUTO REPAIR004831 ‐ 011.1046.590000 $ 95.00 Labor for Diagnosis 3522 011.0014373011.1046.590000 $ 295.00 Labor to Install & Program 3522 011.0014373011.1046.520000 $ 40.93 Sales Tax 10.25 3522$ 830.2107/28/2020 605970011.1049.590000 $ 500.00 Janitorial Services 70109PRIORITY BUILDING SERVICES, LL006416 ‐ $ 500.0007/28/2020 605971Printed: 8/19/2020 1:45:45PMPage 43 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020EARLY CHECKSVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTCHECKNUMBERPAYMENTDATE056.5600.590000 $ 677.68 Parts & Services~ W6477535 056.0000580RDO UNDER EXCHANGE #80‐5800006324 ‐ $ 677.6807/28/2020 605972011.1046.520000 $ 79.55 Rebuild carburetor & complete tune up 39356011.0014375S&A ENGINE, INC001685 ‐ 011.1046.590000 $ 75.00 Labor to rebuild carburetor & complete 39356 011.0014375011.1046.520000 $ 8.15 Sales Tax 10.25 39356$ 162.7007/28/2020 605973011.1060.520000 $ 187.50 Return Envelopes~ 27132 011.0014340SILVA'S PRINTING NETWORK003775 ‐ 011.1060.520000 $ 17.81 Sales Tax 9.5% 27132$ 205.3107/28/2020 605974011.1060.520000 $ 79.00 Business Cards ‐ Freddie Agyin ~ 27121 011.0014310SILVA'S PRINTING NETWORK003775 ‐ 011.1060.520000 $ 79.00 Business Cards ‐ Melissa Nano~ 27121 011.0014310011.1060.520000 $ 15.01 Sales Tax 9.5% 27121$ 173.0107/28/2020 605975011.1004.520000 $ 31.25 Signature Stamp~ OE82032 011.0014318THE HITT COMPANIES, INC006780 ‐ 011.1004.520000 $ 9.50 Freight OE82032 011.0014318011.1004.520000 $ 2.97 Sales Tax 9.5% OE82032$ 43.7207/28/2020 605976011.4031.596200 $ 1,610.22 West InformaƟon Charges 842595847THOMSON REUTERS ‐ WEST000141 ‐ $ 1,610.2207/28/2020 605977Printed: 8/19/2020 1:45:45PMPage 44 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020EARLY CHECKSVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTCHECKNUMBERPAYMENTDATE011.1046.520000 $ 675.00 2455518 Tires 13413583 011.0014239TIREHUB, LLC006371 ‐ 011.1046.520000 $ 464.00 2355517 Tires 13413583 011.0014239011.1046.590000 $ 15.75 Tire Fee 13413583 011.0014239011.1046.520000 $ 108.21 Sales Tax 9.5% 13413583$ 1,262.9607/28/2020 605978011.1033.410211 $ 500.00 Ref. Fireworks Stand Deposits~ 071620TNT FIREWORKS005338 ‐ 011.1033.410211 $ 250.00 Ref. Fireworks Stand Deposits~ 071620(2)$ 750.0007/28/2020 605979055.8300.596200 $ 130.45 New Ticket Charges 620200784UNDERGROUND SERVICE ALERT000449 ‐ 055.8300.596200 $ 65.43 CA State Fee for Regulatory Costs DSB20193761$ 195.8807/28/2020 605980055.9000.560010 $ 11.12 Period: 05/24/20 ‐ 06/23/20 9857361037VERIZON WIRELESS001481 ‐ $ 11.1207/28/2020 605981055.8200.596200 $ 711.00 Innergen InspecƟon 3493844ADT COMMERCIAL006480 ‐ 055.8400.596200 $ 2,844.00 Innergen InspecƟon 3493844$ 3,555.0008/04/2020 605982055.8400.590000 $ 378.66 Disposal Services I50000551138ASBURY ENVIRONMENTAL SERVICES002308 ‐ 055.8400.590000 $ 602.96 Disposal Services I50000569470055.8400.590000 $ 602.96 Disposal Services I50000581439$ 1,584.5808/04/2020 605983Printed: 8/19/2020 1:45:45PMPage 45 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020EARLY CHECKSVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTCHECKNUMBERPAYMENTDATE011.9019.560010 $ 46.23 Period: 06/09/20 ‐ 07/08/20 832176480X07162020AT&T MOBILITY002889 ‐ $ 46.2308/04/2020 605984055.8400.590000 $ 300.00 CalibraƟon ‐ Monitors~ INVVOL0003643 055.0002797ATLAS SAFETY SOLUTIONS006309 ‐ $ 300.0008/04/2020 605985020.1084.900000 $ 505.46 Cla‐Val Replacement and Remote 800020CLA‐VAL004360 ‐ $ 505.4608/04/2020 605986020.1084.500140 $ 990.00 Water Quality TesƟng & ReporƟng 975388CLINICAL LAB OF SAN BERNARDINO003088 ‐ $ 990.0008/04/2020 605987011.1033.596200 $ 1,969.29 BaƩalion Chief Services C0009530COUNTY OF LOS ANGELES001444 ‐ $ 1,969.2908/04/2020 605988011.1047.520000 $ 196.05 Oxygen, Acetylene, Propane and Welding 636476 011.0013888CRAIG WELDING SUPPLY, CO000310 ‐ 055.8400.590000 $ 53.09 Cylinder Refills~ 636528 055.0002739$ 249.1408/04/2020 605989011.1049.520000 $ 40.19 Electrical & Hardware Supplies~ 262579 011.0013889CURRENT WHOLESALE ELECTRIC SUP001336 ‐ $ 40.1908/04/2020 605990011.1060.410240 $ 122.00 Refund Health Permit IN0022920~ 072820DONG PHUONG, INC006894 ‐ $ 122.0008/04/2020 605991Printed: 8/19/2020 1:45:45PMPage 46 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020EARLY CHECKSVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTCHECKNUMBERPAYMENTDATE011.1049.590000 $ 20,800.00 Paint Complete Interior 228ELEMENT PAINTING & DECOR006857 ‐ $ 20,800.0008/04/2020 605992011.1043.596200 $ 696.76 Cost Sharing for Monitoring Equipment~ HTU2059GATEWAY WATER MGMT AUTHORITY005421 ‐ $ 696.7608/04/2020 605994011.1049.520000 $ 623.72 Small Tools, Plumbing, Electrical & 9568535208 011.0013900GRAINGER, CO001712 ‐ 011.1043.520000 $ 127.47 Small Tools, Plumbing, Electrical & 9568616131 011.0013900$ 751.1908/04/2020 605995011.1046.520000 $ 320.00 Brushes 7873222 C63844 011.0014376HAAKER EQUIPMENT COMPANY001346 ‐ 011.1046.520000 $ 32.80 Sales Tax 10.25 C63844$ 352.8008/04/2020 605996055.8400.596200 $ 142.00 Disposal & Recycling Services 06X03165HAUL AWAY RUBBISH SERVICE CO,005350 ‐ 055.8400.596200 $ 605.10 Disposal & Recycling Services 06X03166$ 747.1008/04/2020 605997011.1043.502030 $ 750.00 IniƟal ContribuƟon / J. Duran 072820HSA BANK004239 ‐ $ 750.0008/04/2020 605998Printed: 8/19/2020 1:45:45PMPage 47 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020EARLY CHECKSVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTCHECKNUMBERPAYMENTDATE011.1060.595200 $ 2,940.20 Compliance Outreach Training & 2INDUSTRIAL ENVIRONMENTAL ASSOC006358 ‐ 011.1060.595200 $ 2,385.18 Compliance Outreach Training & 3011.1060.595200 $ 2,544.06 Compliance Outreach Training & 4$ 7,869.4408/04/2020 605999057.1057.550000 $ 121.95 Reimb. Internet Charges 04/20‐06/20 073020LETICIA LOPEZ005863 ‐ $ 121.9508/04/2020 606000011.1026.596200 $ 62.00 Reimb. Live Scan Fee 072820DIEGO MENDOZA006896 ‐ $ 62.0008/04/2020 606001057.1057.550000 $ 121.95 Reimb. Internet Charges 04/20‐06/20 073020CAROL MENKE006592 ‐ $ 121.9508/04/2020 606002011.1046.590000 $ 84.32 Police Department Car Wash Services ~ 1011 011.0013898NCM CARWASH006613 ‐ $ 84.3208/04/2020 606003011.1026.597000 $ 187.00 Medical Services 68449476OCCUPATIONAL HEALTH CENTERS OF006586 ‐ 011.1026.597000 $ 169.50 Medical Services 68512110$ 356.5008/04/2020 606004056.5600.900000 $ 4,494.00 G‐1026‐DRESSER 3M175 ~ 101752 056.0000606PFT‐ALEXANDER, INC005762 ‐ 056.5600.900000 $ 426.93 Sales Tax 9.5% 101752$ 4,920.9308/04/2020 606005Printed: 8/19/2020 1:45:45PMPage 48 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020EARLY CHECKSVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTCHECKNUMBERPAYMENTDATE020.1084.520000 $ 34.12 Plumbing Hardware & Supplies~ S1235785001 011.0013884PLUMBING & INDUSTRIAL SUPPLY001943 ‐ 020.1084.520000 $ 45.09 Plumbing Hardware & Supplies~ S1235951001 011.0013884020.1084.520000 $ 108.23 Plumbing Hardware & Supplies~ S1235972001 011.0013884020.1084.520000 $ 123.81 Plumbing Hardware & Supplies~ S1236443001 011.0013884020.1084.520000 $ 39.86 Plumbing Hardware & Supplies~ S1236751001 011.0013884$ 351.1108/04/2020 606006055.8300.596200 $ 595.63 Janitorial Services 07/20 69799PRIORITY BUILDING SERVICES, LL006416 ‐ 055.8400.596200 $ 718.90 Janitorial Services 07/20 69799056.5600.596200 $ 821.45 Janitorial Services 07/20 69799$ 2,135.9808/04/2020 606007011.9019.860000 $ 7,469.00 SG550XG‐48T‐K9‐NA SG550XG‐48T 48‐Port 8652443 011.0014393PROVANTAGE, LLC004307 ‐ 011.9019.860000 $ 709.56 Sales Tax 9.5% 8652443$ 8,178.5608/04/2020 606008011.1049.590000 $ 135.00 Plumbing Maintenance Services 25863QUALITY JET ROOTER, INC004451 ‐ 011.1049.590000 $ 225.00 Plumbing Maintenance Services 26027011.1049.590000 $ 264.00 Plumbing Maintenance Services 26155$ 624.0008/04/2020 606009011.1003.596300 $ 991.37 ElecƟon Services 202034REGISTRAR‐RECORDER/COUNTY CLK001931 ‐ $ 991.3708/04/2020 606010Printed: 8/19/2020 1:45:45PMPage 49 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020EARLY CHECKSVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTCHECKNUMBERPAYMENTDATE055.9000.540000 $ 151.45 ArcLite Air Hi‐Vis FR Rain Jacket ~ 36080 055.0002799RITZ SAFETY, LLC006727 ‐ 055.9000.540000 $ 151.45 ArcLite Air Hi‐Vis FR Rain Jacket ~ 36080 055.0002799055.9000.540000 $ 34.62 ArcLite Air FR Rain Hood ~ 36080 055.0002799055.9000.540000 $ 32.06 Sales Tax 9.5% 36080055.9000.540000 $ 87.13 ArcLite Air Hi‐Vis FR Rain Pant ~ 36298 055.0002799055.9000.540000 $ 8.28 Sales Tax 9.5% 36298055.9000.540000 $ 87.13 ArcLite Air Hi‐Vis FR Rain Pant ~ 36323 055.0002799055.9000.540000 $ 8.28 Sales Tax 9.5% 36323$ 560.4008/04/2020 606011011.1060.520000 $ 158.00 Business Cards ‐ D. ODONNELL & L. 27154 011.0014454SILVA'S PRINTING NETWORK003775 ‐ 011.1060.520000 $ 15.01 Sales Tax 9.5% 27154$ 173.0108/04/2020 606012055.9000.900000 $ 1,587.50 Meteorological Services 2006SIMON WIND, INC005790 ‐ $ 1,587.5008/04/2020 606013Printed: 8/19/2020 1:45:45PMPage 50 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020EARLY CHECKSVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTCHECKNUMBERPAYMENTDATE011.1033.590000 $ 124.46 Annual Renewal Fees 3673306SOUTH COAST AQMD001158 ‐ 011.1033.590000 $ 421.02 Annual Renewal Fees 3673326011.1033.590000 $ 421.02 Annual Renewal Fees 3673328011.1033.590000 $ 421.02 Annual Renewal Fees 3673329011.1033.590000 $ 136.40 Emissions Fees 3676354011.1033.590000 $ 136.40 Emissions Fees 3676416011.1033.590000 $ 136.40 Emissions Fees 3676418011.1033.590000 $ 136.40 Emissions Fees 3676419$ 1,933.1208/04/2020 606014011.1026.597000 $ 400.00 Psychological EvaluaƟons 2005046SUSAN SAXE‐CLIFFORD, PH.D.001159 ‐ $ 400.0008/04/2020 606015011.1001.520000 $ 39.30 (1) Women's LOG101~ 3052362426 011.0014355UNIFIRST CORPORATION005296 ‐ 011.1001.520000 $ 3.73 Sales Tax 9.5% 3052362426011.1001.520000 $ 39.30 (1) Women's LOG101 ~ 3052363424 011.0014355011.1001.520000 $ 3.73 Sales Tax 9.5% 3052363424$ 86.0608/04/2020 606016011.9019.560010 $ 833.44 Period: 06/11/20 ‐ 07/10/20 9858386565VERIZON WIRELESS001481 ‐ $ 833.4408/04/2020 606017Printed: 8/19/2020 1:45:45PMPage 51 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020EARLY CHECKSVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTCHECKNUMBERPAYMENTDATE020.1084.500140 $ 15.00 Water Quality TesƟng & ReporƟng W0F1489COVERNONWECK LABORATORIES, INC001628 ‐ 020.1084.500140 $ 45.00 Water Quality TesƟng & ReporƟng W0F1490COVERNON$ 60.0008/04/2020 606018011.1004.595200 $ 4,000.00 AudiƟng Services 206459WHITE NELSON DIEHL EVANS, LLP006872 ‐ $ 4,000.0008/04/2020 606019011.9019.590110 $ 415.00 Disaster Recovery Services 132088AGILITY RECOVERY SOLUTIONS005348 ‐ $ 415.0008/11/2020 606020011.9019.560010 $ 20.88 Period: 06/06/20 ‐ 07/05/20 14998273AT&T001948 ‐ 011.9019.560010 $ 2,356.89 Period: 06/10/20 ‐ 07/09/20 15008321011.9019.560010 $ 40.36 Period: 06/10/20 ‐ 07/09/20 15008322055.9000.560010 $ 230.07 Period: 06/10/20 ‐ 07/09/20 15008323011.9019.560010 $ 2,141.16 Period: 06/10/20 ‐ 07/09/20 15008324011.9019.560010 $ 1,014.52 Period: 06/10/20 ‐ 07/09/20 15008325056.5600.560010 $ 600.60 Period: 06/10/20 ‐ 07/09/20 15008326056.5600.560010 $ 20.88 Period: 06/10/20 ‐ 07/09/20 15008425011.9019.560010 $ 777.45 Period: 06/10/20 ‐ 07/09/20 15008757011.9019.560010 $ 19.25 Period: 06/15/20 ‐ 07/14/20 15050170$ 7,222.0608/11/2020 606021Printed: 8/19/2020 1:45:45PMPage 52 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020EARLY CHECKSVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTCHECKNUMBERPAYMENTDATE011.9019.590110 $ 1,979.40 Period: 06/19/20 ‐ 07/18/20 071920AT&T001948 ‐ 055.9200.560010 $ 308.60 Period: 07/19/20 ‐ 08/18/20 3119775939055.9200.560010 $ 152.00 Period: 06/19/20 ‐ 07/18/20 8233725502$ 2,440.0008/11/2020 606022011.9019.560010 $ 256.90 Period: 06/20/20 ‐ 07/19/20 072020AT&T001948 ‐ 011.9019.560010 $ 978.18 Period: 06/20/20 ‐ 07/19/20 072020(2)$ 1,235.0808/11/2020 606023056.5600.590000 $ 175.00 Gas Supplies~ 145780 056.0000621BASIN VALVE COMPANY002177 ‐ $ 175.0008/11/2020 606024020.1084.900000 $ 29.07 Electrical Supplies~ 262649 011.0013878CURRENT WHOLESALE ELECTRIC SUP001336 ‐ 020.1084.900000 $ 323.94 Electrical Supplies~ 262841 011.0013878055.8000.590000 $ 53.22 Electrical Parts~ 263086 055.0002740020.1084.900000 $ 341.29 Electrical Supplies~ 263594 011.0013878$ 747.5208/11/2020 606025011.120010 $ 1,635.00 Water Parts~ S1399830001 011.0013890DANGELO CO000970 ‐ 011.120010 $ 960.73 Water Parts~ S1409196001 011.0013890$ 2,595.7308/11/2020 606026011.1060.595200 $ 6,080.51 OperaƟons & Maintenance Agreement 19SM4953DEPT OF TOXIC SUBSTANCES CTRL000620 ‐ $ 6,080.5108/11/2020 606027Printed: 8/19/2020 1:45:45PMPage 53 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020EARLY CHECKSVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTCHECKNUMBERPAYMENTDATE011.9019.560010 $ 55.01 Period: 07/16/20 ‐ 08/15/20 071620FRONTIER005825 ‐ $ 55.0108/11/2020 606028011.9019.590110 $ 1,100.00 Annual SoŌware Maintenance Fee ‐ GST 17608 011.0014395GEOSPATIAL TECHNOLOGIES, INC003917 ‐ 011.9019.590110 $ 2,000.00 Annual SoŌware Maintenance Fee ‐ GST 17608 011.0014395011.9019.590110 $ 1,600.00 Annual SoŌware Maintenance Fee ‐ CAD 17608 011.0014395$ 4,700.0008/11/2020 606029056.5600.590000 $ 405.23 CalibraƟon Services~ 1065612 056.0000564HEATH CONSULTANTS INCORPORATED004222 ‐ $ 405.2308/11/2020 606030020.1084.900000 $ 5,238.10 Professional Services 05/20 12665INFRASTRUCTURE ENGINEERING COR000706 ‐ 020.1084.900000 $ 27,200.50 Professional Services 06/20 12797$ 32,438.6008/11/2020 606031055.8400.590000 $ 61.24 Small Tools, Plumbing, & Building 108061 055.0002742LB JOHNSON HARDWARE CO #1000804 ‐ 055.8000.590000 $ 108.63 Small Tools, Plumbing, & Building 108092 055.0002742055.8400.590000 $ 295.61 Small Tools, Plumbing, & Building 108099 055.0002742020.1084.520000 $ 19.56 Plumbing & Building Hardware~ 108564 011.0013882020.1084.520000 $ 300.83 Plumbing & Building Hardware~ 108826 011.0013882$ 785.8708/11/2020 606032Printed: 8/19/2020 1:45:45PMPage 54 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020EARLY CHECKSVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTCHECKNUMBERPAYMENTDATE055.8000.590000 $ 216.64 Hardware Supplies~ 39822135 055.0002743MCMASTER CARR SUPPLY COMPANY001150 ‐ 020.1084.900000 $ 457.10 Hardware Supplies~ 40858913 011.0013883$ 673.7408/11/2020 606033011.1026.596200 $ 6,249.70 Workplace InvesƟgaƟon 20016NORMAN A. TRAUB ASSOCIATES005250 ‐ $ 6,249.7008/11/2020 606034011.199999 $ 3,744.75 Ref Cancl'd Permit F‐2020‐1546 Ref000226246DEAN OLIVER006898 ‐ $ 3,744.7508/11/2020 606035011.1049.590000 $ 9,005.38 Janitorial Services 70406PRIORITY BUILDING SERVICES, LL006416 ‐ $ 9,005.3808/11/2020 606036011.9019.860000 $ 13,100.00 NEXUS 3524X 24 10G PORTS~ 8682678 011.0014419PROVANTAGE, LLC004307 ‐ 011.9019.860000 $ 1,244.50 Sales Tax 9.5% 8682678$ 14,344.5008/11/2020 606037011.1046.520000 $ 56.62 319 9512 Spring Assembly PC810892398 011.0014377QUINN COMPANY001457 ‐ 011.1046.520000 $ 5.37 Sales Tax 9.5% PC810892398011.1046.520000 $ 12.28 Freight PC810892521 011.0014377$ 74.2708/11/2020 606038056.5600.520000 $ 62.15 Pipe & Fiƫngs~ S3540283001 056.0000570SMARDAN SUPPLY CO004229 ‐ 056.5600.520000 $ 181.60 Pipe & Fiƫngs~ S3541147001 056.0000570$ 243.7508/11/2020 606039Printed: 8/19/2020 1:45:45PMPage 55 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020EARLY CHECKSVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTCHECKNUMBERPAYMENTDATE011.1031.596200 $ 243.00 Medical Services 521139085STACY MEDICAL CENTER000380 ‐ $ 243.0008/11/2020 606040011.1031.520000 $ 6.30 Laundry Services~ 11946 011.0014447STATE STREET LAUNDRY000191 ‐ 011.1031.520000 $ 7.20 Laundry Services~ 11947 011.0014447011.1031.520000 $ 10.80 Laundry Services~ 11948 011.0014447011.1031.520000 $ 7.20 Laundry Services~ 11949 011.0014447011.1031.520000 $ 7.20 Laundry Services~ 11950 011.0014447$ 38.7008/11/2020 606041011.1040.520000 $ 9.25 Nameplate ‐ Jazmine Hooks~ OE82464 011.0014427THE HITT COMPANIES, INC006780 ‐ 011.1043.520000 $ 11.25 Nameplate ‐ John Cordova ~ OE82464 011.0014427011.1043.520000 $ 8.25 #94‐12 2"x12" Standard Aluminum Wall OE82464011.0014427011.1040.520000 $ 5.25 Freight OE82464 011.0014427011.1043.520000 $ 5.25 Freight OE82464 011.0014427011.1040.520000 $ 0.88 Sales Tax 9.5% OE82464011.1043.520000 $ 1.85 Sales Tax 9.5% OE82464$ 41.9808/11/2020 606042011.1024.596600 $ 235.00 West InformaƟon Charges 842577150THOMSON REUTERS ‐ WEST000141 ‐ $ 235.0008/11/2020 606043011.1024.596600 $ 481.49 CA Municipal Law Handbook 916290UNIVERSITY OF CA001714 ‐ $ 481.4908/11/2020 606044Printed: 8/19/2020 1:45:45PMPage 56 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020EARLY CHECKSVENDOR NAME AND NUMBERACCOUNTNUMBERINVOICEAMOUNTDESCRIPTIONINVOICEP.O.#PAYMENTAMOUNTCHECKNUMBERPAYMENTDATE011.9019.560010 $ 627.57 Period: 06/20 71539269VERIZON BUSINESS SERVICES001481 ‐ $ 627.5708/11/2020 606045055.8000.590000 $ 1,375.00 SubstaƟon Oil Samples 5900273346WEIDMANN ELECTRICAL TECHNOLOGY002075 ‐ 055.8000.590000 $ 342.31 SubstaƟon Oil Samples 5900279395055.8000.590000 $ 240.00 SubstaƟon Oil Samples 5900279396055.8000.590000 $ 320.00 SubstaƟon Oil Samples 5900280099055.8000.590000 $ 240.00 SubstaƟon Oil Samples 5900280262055.8000.590000 $ 275.00 SubstaƟon Oil Samples 5900281715$ 2,792.3108/11/2020 606046011.9019.590110 $ 3,219.30 Lease Payment 2189884XEROX FINANCIAL SERVICES, LLC000743 ‐ $ 3,219.3008/11/2020 606047011.1043.900000 $ 4,736.39 Regulatory Signs & MounƟng Hardware~ 88899 011.0013896ZUMAR INDUSTRIES, INC001153 ‐ $ 4,736.3908/11/2020 606048011.1004.595200 $ 150.00 Audit ConfirmaƟon LisƟng Fee 081220STATE CONTROLLER'S OFFICE003400 ‐ $ 150.0008/13/2020 606049TOTAL EARLY CHECKS$ 427,038.12Printed: 8/19/2020 1:45:45PMPage 57 of 58 CITY OF VERNONOPERATING ACCOUNTWARRANT REGISTER NO. 51SEPTEMBER 1, 2020RECAP BY FUNDFUNDELECTRONIC TOTALEARLY CHECK TOTALWARRANT TOTALGRAND TOTALS$ 3,073,755.08$ 3,417,790.56$0.00$ 344,035.48011 ‐ GENERAL443,792.09488,722.090.0044,930.00020 ‐ WATER5,834,200.785,856,615.360.0022,414.58055 ‐ LIGHT & POWER429,498.45444,912.610.0015,414.16056 ‐ NATURAL GAS15,129.6715,373.570.00243.90057 ‐ FIBER OPTICGRAND TOTAL$10,223,414.19$0.00$427,038.12$9,796,376.07TOTAL CHECKS TO BE PRINTED 0Printed: 8/19/2020 1:45:45PMPage 58 of 58 City Council Agenda Item Report Agenda Item No. COV-274-2020 Submitted by: Adriana Ramos Submitting Department: Fire Department Meeting Date: September 1, 2020 SUBJECT Fire Department Activity Report Recommendation: Receive and file the June 2020 Report. Background: Attached is a copy of the Vernon Fire Department Activity Report which covers the period of June 1 through June 30, 2020. This report covers hours for Fire Prevention, Training, Pre-Incident, Periodic Testing, Public Service Programs and Routine Maintenance. It is important to note the following: *Due to the COVID-19 pandemic resulting in the temporary closure of non-essential businesses and in adherence to the Los Angeles County Health Officer's Orders and guidelines for social distancing to minimize COVID-19 exposure, Fire inspections ceased during the months of April and May, impacting the year-to-date figures in the activity report. The Fire Department resumed inspections effective June 1, 2020. *Due to a recent change to LA County's National Fire Incident Reporting System (NFIRS), the department's activity report will no longer include the response time per call. Instead, LA County Fire has provided a new report titled the Vernon Incident Analysis listing only the number of responses, and first-in arrivals per unit. Fiscal Impact: There is no fiscal impact associated with this report. Attachments: 1. Fire Department Activity Report - 06/01/20 to 06/30/20 ACTIVITY TYPE This Period Last Year This This Year FIRE PREVENTION:Last Year To Date Period To Date Regular Inspections (#):48 616 3 106 Re-Inspections (#):12 105 0 4 Spec. Haz. Inspections (#):5 14 3 4 Total Inspections: 65 735 6 114 Total Staff Hours:97 1131 13 172 PRE-INCIDENT (HOURS): This Period Last Year This This Year Last Year To Date Period To Date Planning 189 1065 185 1087 District Familiarization 195 1057 198 1071 Total Hours:384 2122 383 2158 PERIODIC TEST (HOURS): This Period Last Year This This Year Last Year To Date Period To Date Hose Testing 2 4 2 10 Pump Testing 2 17 8 28 Total Hours: 4 21 10 38 VERNON FIRE DEPARTMENT COMPANY ACTIVITIES June 1, 2020 to June 30, 2020 *Reduction in activity due to transitioning to electronic inspection reporting system. 0 100 200 300 400 500 600 700 800 Last Year To Date Period To Date This Period Last Year This This Year Annual Business Fire Inspections Page 1 TRAINING (HOURS): This Period Last Year This This Year Last Year To Date Period To Date Firefighting 226 1411 275 1559 Hazardous Materials 68 359 72 480 Safety 238 1487 240 1431 Apparatus Operations 243 1522 275 536 Equipment Operations 237 1504 250 1458 CPR 11 20 13 116 First Aid 64 422 123 734 Total Hours:1087 6725 1248 6314 PUBLIC SERVICE PROGRAMS (HOURS): This Period Last Year This This Year Last Year To Date Period To Date School Programs 2 22 2 6 Fire Brigades 2 6 4 10 Emergency Preparedness 57 149 24 270 Total Hours:61 177 30 286 ROUTINE MAINTENANCE (HOURS): This Period Last Year This This Year Last Year To Date Period To Date Station 241 1487 236 1497 Apparatus 242 1473 262 1515 Equipment 243 1487 256 1542 Total Hours:726 4447 754 4554 Personnel Activity Total By Hours:2359 14623 2438 13522 275 72 240 275 250 13 123 1248 Fire Training Hours Firefighting Hazardous Materials Safety Apparatus Operations Equipment Operations CPR First Aid Page 2 Vernon Incident Analysis June 2020 Unit All Responses First-In BC776 0 0 E777 54 49 E778 47 41 E779 24 21 RA778 53 0 T776 14 13 BC13 3 0 BC3 2 0 Q164 1 1 Total 198 125 City Council Agenda Item Report Agenda Item No. COV-285-2020 Submitted by: Gregory Garcia Submitting Department: Police Department Meeting Date: September 1, 2020 SUBJECT Police Department Activity Report Recommendation: Receive and file the June 2020 Report. Background: The Vernon Police Department's activity report consists of activity during the specified reporting period, including a summary of calls for service, and statistical information regarding arrests, traffic collisions, stored and impounded vehicles, recovered stolen vehicles, the number of citations issued, and the number of reports filed. Fiscal Impact: There is no fiscal impact associated with this report. Attachments: 1. Police Department Activity Report – June 2020 Type VERNON POLICE DEPARTMENT Department Activity Report Jurisdiction: First Date: Last Date: 06/01/2020 06/30/2020 Department All Units Primary Unit VERNON Description Complaint VPD 10-6 OFFICER IS 10-6 C7,961,962,10-10, WASH, EQUIPMENT,ETC 172 169 10-96C 10-96 CHARLES (CITY HALL SECURITY CHECK)14 14 10-96H PICK UP THE JAIL PAPER WORK FROM HP JAIL 3 3 140 SUPPLEMENTAL REPORT 1 1 20001 INJURY HIT AND RUN 6 1 20001R INJURY HIT AND RUN REPORT 3 2 20002 NON-INJURY HIT AND RUN 13 3 20002R NON-INJURY HIT AND RUN REPORT 9 7 211R ROBBERY REPORT 1 1 211S SILENT ROBBERY ALARM 14 4 242 BATTERY 9 3 242R BATTERY REPORT 2 1 273.5 DOMESTIC VIOLENCE 7 2 273.5R DOMESTIC VIOLENCE REPORT 5 1 314 INDECENT EXPOSURE 5 3 415 DISTURBING THE PEACE 44 19 417 BRANDISHING A WEAPON 7 4 422R TERRORIST THREATS REPORT 4 2 451R ARSON REPORT 3 1 459 BURGLARY 18 4 459A AUDIBLE BURGLARY ALARM 259 136 459R BURGLARY REPORT 22 11 459S SILENT BURGLARY ALARM 19 10 459VR BURGLARY TO A VEHICLE REPORT 10 7 476R FRAUD REPORT 1 1 484 PETTY THEFT 23 7 484R PETTY THEFT REPORT 25 17 487 GRAND THEFT 4 1 487R GRAND THEFT REPORT 34 21 586 PARKING PROBLEM 41 35 594 VANDALISM 11 3 594R VANDALISM REPORT 28 15 602 TRESPASS 49 20 653MR ANNOYING PHONE CALLS REPORT 2 1 901T INJURY TRAFFIC COLLISION 19 6 901TR INJURY TRAFFIC COLLISION REPORT 6 3 902T NON-INJURY TRAFFIC COLLISION 42 27 902TR NON-INJURY TRAFFIC COLLISION REPORT 7 5 909E TRAFFIC ENFORCEMENT 3 2 909T TRAFFIC HAZARD 5 5 911 911 MISUSE / HANGUP 2 2 911A CONTACT THE REPORTING PARTY 38 21 911NR 911 CALL NO RESPONSE REQUIRED 4 2 917A ABANDONED VEHICLE 6 3 920PR LOST PROPERTY REPORT 1 1 925 SUSPICIOUS CIRCUMSTANCES 100 41 927 UNKNOWN TROUBLE 7 2 1Page of 307/02/2020 14:32:17 Type VERNON POLICE DEPARTMENT Department Activity Report Jurisdiction: First Date: Last Date: 06/01/2020 06/30/2020 Department All Units Primary Unit VERNON Description Complaint VPD A459R ATTEMPT BURGLARY REPORT 5 4 A484R ATTEMPT PETTY THEFT REPORT 3 1 A487 ATTEMPT GRAND THEFT 7 2 A487R ATTEMPT GRAND THEFT REPORT 3 2 AGTAR ATTEMPT GRAND THEFT AUTO REPORT 13 6 ASSISTFD ASSIST FIRE DEPARTMENT 54 19 BARCK BAR CHECK 2 1 BOSIG BROKEN SIGNAL OR LIGHT 2 2 BOVEH BROKEN DOWN VEHICLE 13 9 CITCK CITATION CHECK 7 6 CIVIL CIVIL MATTER 5 3 CODE5 SURVEILLANCE/STAKE-OUT 3 1 COP COP DETAIL 2 2 DEMOSTRA DEMONSTRATION 3 2 DET DETECTIVE INVESTIGATION 46 26 DETAIL DETAIL 2 1 DPTAST DEPARTMENTAL ASSIST 13 4 DUI DRIVING UNDER THE INFLUENCE 6 2 FILING OFFICER IS 10-6 REPORT WRITING 125 124 FOUND FOUND PROPERTY REPORT 9 5 FU FOLLOW UP 7 5 GTAR GRAND THEFT AUTO REPORT 39 28 HBC HAILED BY A CITIZEN 20 12 ILLDPG ILLEGAL DUMPING 2 2 ILLDPG RPT ILLEGAL DUMPING REPORT 2 1 LOCATE LOCATED VERNON STOLEN VEHICLE / PLATES VIA TELETYPE 11 11 LOJACK LOJACK HIT 10 7 LPR LICENSE PLATE READER 18 10 MISPLOCATE LOCATED MISSING PERSON REPORT 4 2 MISPR MISSING PERSON REPORT 2 1 MR60 MISC REPORT 1 1 PAPD PUBLIC ASSIST-POLICE 16 9 PATCK PATROL CHECK 241 187 PEDCK PEDESTRIAN CHECK 84 47 REC RECOVERED STOLEN VEHICLE IN THE FIELD 17 7 RECKLESS DRV RECKLESS DRIVING (23103)13 8 REPO REPOSSESSION 1 1 ROADRAGE ROAD RAGE 4 2 RR RAIL ROAD PROBLEM 1 1 SPEED SPEED CONTEST OR SPEEDING (23109)13 4 SRMET SRMET DETAIL 10 3 SUBPOENA SUBPOENA SERVICE 3 1 SUICIDAL SUB SUICIDAL SUBJECT 3 1 TRAFFIC STOP TRAFFIC STOP 91 65 UNATTACHEDTRUNATTACHED TRAILER 1 1 VCK VEHICLE CHECK 89 68 VEH RELEASE VEHICLE RELEASE 5 5 2Page of 307/02/2020 14:32:17 Type VERNON POLICE DEPARTMENT Department Activity Report Jurisdiction: First Date: Last Date: 06/01/2020 06/30/2020 Department All Units Primary Unit VERNON Description Complaint VPD WELCK WELFARE CHECK 34 17 Department: 2173 1379 Overall: 2173 1379 3Page of 307/02/2020 14:32:17 VERNON POLICE DEPARTMENT Police Activity Report Period Ending: 06/30/20 TRAFFIC COLLISIONS NO. PROPERTY RECOVERED TOTAL 29 VEHICLES: $120,100.00 NON-INJURY 15 INJURY 14 Persons Injured 18 Pedestrian 0 Fatalities 0 City Property Damage 3 Hit & Run (Felony) 4 Hit & Run (Misdemeanor) 7 VEHICLES STORED PROPERTY RECOVERED FOR Unlicensed Driver 5 OTHER DEPARTMENTS Abandoned/Stored Vehicle 7 VEHICLES: $19,600.00 Unattached Trailer 1 Traffic Hazard 2 CITATIONS Citations Iss (Prisoner Release) 32 Citations Iss (Other Violations) 0 Parking 19 Hazardous 21 Non-Hazardous 14 Citations Iss (Moving) 35 Citations Iss (Total) 54 CASES CLEARED BY ARREST AR20-168 CR20-0848 496 PC AR20-185 CR20-0913 487 PC AR20-169 CR20-0857 459 PC AR20-187 CR20-0915 11364 HS AR20-171 CR20-0860 10851 VC AR20-188 CR20-0930 10851 VC AR20-172 CR20-0869 496 PC AR20-189 CR20-0937 11377 HS AR20-175 CR20-0877 273.5(A) PC AR20-190 CR20-0939 602 PC AR20-177 CR20-0883 11377 HS AR20-191 CR20-0940 11377 HS AR20-178 CR20-0894 10851 VC AR20-192 CR20-0958 11377 HS AR20-179 CR20-0895 20001 VC AR20-193 CR20-0995 664/10851 VC AR20-180 CR20-0901 10851 VC AR20-194 CR20-1003 602 PC AR20-181 CR20-0902 484(A) PC AR20-196 CR20-1020 594 PC AR20-182 CR20-0907 602(M) PC AR20-197 CR20-1044 20002(A) VC MALE FEMALE TOTAL BURGLARY (& ATTEMPTED)1 1 2 DRIVING UNDER THE INFLUENCE w/ INJURY 0 DOMESTIC VIOLENCE 1 1 2 GRAND THEFT: AUTO (& ATTEMPTED)5 5 GRAND THEFT: PROPERTY 2 2 HIT & RUN w/ INJURY 1 1 POSSESSION OF STOLEN PROPERTY 2 1 3 WARRANT (VERNON CASE)0 WARRANT (OUTSIDE AGENCY)0 TOTAL FELONY ARRESTS 12 3 15 MALE FEMALE TOTAL CARRY CONCEALED DAGGER 0 COURT ORDER VIOLATION 0 DRIVING RECKLESSLY 0 DRIVING UNDER THE INFLUENCE 1 1 2 DRIVING WITH A SUSPENDED LICENSE 0 HIT & RUN 1 1 PETTY THEFT 1 1 POSSESSION OF NARCOTICS 4 4 POSSESSION OF PARAPHERNALIA 1 1 POSSESSION OF NITROUS OXIDE 0 TRESPASSING 5 5 VANDALISM 1 1 WARRANT (VERNON CASE)0 WARRANT (OUTSIDE AGENCY)0 TOTAL MISD. ARRESTS 14 1 15 MALE FEMALE TOTAL BURGLARY 0 CARRY LOADED FIREARM IN PUBLIC 0 ROBBERY 0 VANDALISM 0 WARRANT 0 TOTAL JUVENILES DET.0 0 0 59 134 4 197 TOTAL FELONY ARRESTS (ADULT) TO DATE: TOTAL MISDEMEANOR ARRESTS (ADULT) TO DATE: TOTAL JUVENILES DETAINED (FELONY AND MISDEMEANOR) TO DATE: TOTAL ARRESTS AND DETAINED JUVENILES (FELONY AND MISDEMEANOR) TO DATE: VERNON POLICE DEPARTMENT REPORT FOR PERSONS ARRESTED ADULT FELONY ARRESTS AND DISPOSITIONS PERIOD ENDING: 06/30/2020 ADULT MISDEMEANOR ARRESTS AND DISPOSITIONS JUVENILES DETAINED --- FELONY AND MISDEMEANOR VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/01/202006/01/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene20200610771E 37TH // SOTO, VERNONFOUND01:24:3806/01/2020FISOWRPTDepartmentOCA NumberRMS JurisVPD CR20200846 CA0197300VPDGODOY,RAYMOND/MANNINO,NICHOLAS*32W02:14:3001:24:39VPDSWINFORD,PHILLIP/FLORES,TERESA4102:14:3001:24:4920200610779PACIFIC BL // 46TH, VERNONHBC04:28:1906/01/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200847 CA0197300VPDCERDA,PAUL,JR/MADRIGAL,ALFONSO*40E04:59:0404:28:19VPDSWINFORD,PHILLIP/FLORES,TERESA4104:35:4104:35:4604:31:0320200610783S BOYLE AV // 44TH, VERNONPEDCK05:03:1506/01/2020RPT1015DepartmentOCA NumberRMS JurisVPD CR20200848 CA0197300VPDESTRADA,IGNACIO/STEVENSON,KENT,JR*3105:51:3705:03:15VPDGODOY,RAYMOND/MANNINO,NICHOLAS32W06:11:2905:16:05VPDCERDA,PAUL,JR/MADRIGAL,ALFONSO40E05:13:2105:42:5505:19:00VPDSWINFORD,PHILLIP/FLORES,TERESA4105:42:5705:17:15202006107892901 FRUITLAND AV, VERNON459VROWENS BROCKWAY06:08:0306/01/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200849 CA0197300VPDSWINFORD,PHILLIP/FLORES,TERESA*4106:13:02 06:13:3006:40:20202006107918901 ALDEN AVE, SOUTH GATELOCATESOUTH GATE PD06:13:3606/01/2020VRECRPT202006107964553 SEVILLE AV, VERNONGTARHOLLANDER HOME FASHIONS06:49:3206/01/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200850 CA01973001Page of 406/02/202000:42:31 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/01/202006/01/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene202006107964553 SEVILLE AV, VERNONGTARHOLLANDER HOME FASHIONS06:49:3206/01/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200850 CA0197300VPDOURIQUE,CARLOS/SALDANA,CARLOS*40W06:52:32 06:53:0207:53:2307:38:12202006108122133 E 38TH, VERNON487RA PEACH09:45:0606/01/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200851 CA0197300VPDESCOBEDO,ALEXY/CAM,PATRICK*32E09:54:58 09:54:5811:17:0610:00:46VPDSALDANA,CARLOS40W09:52:5610:01:15202006108145008 S BOYLE AV, VERNON487RDAVID GARMENT10:40:0306/01/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200852 CA0197300VPDHERNANDEZ,EDWARD/REYNA,JOSE S*3110:41:54 10:44:0511:02:52 11:38:2211:05:05VPDESCOBEDO,ALEXY/CAM,PATRICK32E11:02:5011:31:06VPDSALDANA,CARLOS40W10:44:5010:51:0410:44:44202006108163001 BANDINI BL, VERNONGTARJUMBO SALES11:38:3906/01/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200853 CA0197300VPDESCOBEDO,ALEXY/CAM,PATRICK*32E11:40:17 11:40:4312:36:0711:44:2820200610818S DISTRICT BL // ATLANTIC BL, VERNON20002RESMERALDA13:07:1006/01/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200855 CA0197300VPDESCOBEDO,ALEXY/CAM,PATRICK*32E13:32:5614:13:2913:42:11202006108192300 E 57TH, VERNONGTARJETRO13:13:3506/01/2020RPTVRECDepartmentOCA NumberRMS JurisVPD CR20200854 CA0197300VPDSALDANA,CARLOS*40W13:16:05 13:16:2014:26:5413:21:37VPDESCOBEDO,ALEXY/CAM,PATRICK32E13:32:46 13:32:4713:32:502Page of 406/02/202000:42:31 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/01/202006/01/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene202006108215005 E SLAUSON AV, VERNON459RBLACKSTEN INDUSTRIAL ELECTRICAL14:38:4206/01/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200856 CA0197300VPDGAYTAN,LORENZO*4316:01:2415:40:30202006108224555 EVERETT AV, VERNON459PRINCESS PAPER14:45:1106/01/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200857 CA0197300VPDESCOBEDO,ALEXY/CAM,PATRICK*32E14:46:1616:22:2614:48:16VPDHERNANDEZ,EDWARD/REYNA,JOSE S3114:46:19 14:49:4416:19:5314:52:43VPDSALDANA,CARLOS40W17:46:3814:54:27VPDGAYTAN,LORENZO4315:40:2914:49:47VPDCROSS,JEREMYS415:37:0515:01:08VPDMARTINEZ,GABRIELS515:37:0715:01:0520200610823UNION PACIFIC AVE // WOODS AVE, EAST LOS ANGELESLOCATELASO EAST LA17:27:2106/01/2020VREC202006108324675 52D DR, VERNON S/A 115484MARIA ACOSTA20:08:0806/01/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200858 CA0197300VPDGODOY,RAYMOND*38E20:08:48 20:09:4722:29:0220:11:55VPDCERDA,PAUL,JR/NEWTON,TODD2620:26:0820:17:38VPDSWINFORD,PHILLIP4320:08:50 20:09:5721:19:3920:09:46202006108334010 E 26TH, VERNONASSISTFDREHRIG PACIFIC20:13:4906/01/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200859 CA0197300VPDLUCAS,JASON*32W20:14:38 20:15:0121:24:1420:17:19VPDONOPA,DANIELS721:17:2520:38:26202006108383Page of 406/02/202000:42:31 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/01/202006/01/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene202006108383031 E VERNON AV, VERNONRECAMPM22:23:2806/01/2020VREC1015RPTDepartmentOCA NumberRMS JurisVPD CR20200860 CA0197300VPDLUCAS,JASON*32W22:25:08 22:25:1623:56:3722:32:39VPDGODOY,RAYMOND38E23:56:3722:29:05VPDSTEVENSON,KENT,JR/VASQUEZ,LUIS4123:56:3723:16:38VPDSWINFORD,PHILLIP4323:56:3822:32:41MR C TOWMR C TO23:17:2023:56:3823:25:21VPDONOPA,DANIELS723:52:3323:18:23* Denotes Primary Unit4Page of 406/02/202000:42:31 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/02/202006/02/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene202006108493737 S SOTO, VERNON594RMCDONALDS07:14:2306/02/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200861 CA0197300VPDVALENZUELA,FERNANDO/VELEZ,MARISSA*31W07:17:27 07:17:5108:21:0507:24:38VPDZOZAYA,OSCAR/FLORES,TERESA4108:27:5308:00:2220200610856E 37TH // SOTO, VERNONLOJACK09:46:1506/02/2020RPT40EDepartmentOCA NumberRMS JurisVPD CR20200862 CA0197300VPDVALENZUELA,FERNANDO/VELEZ,MARISSA*31W10:12:5209:46:15VPDOURIQUE,CARLOS/SALDANA,CARLOS40E09:56:1911:53:5210:06:11VPDGAYTAN,LORENZO/RAMOS,JOSE4309:55:3710:13:21202006108573701 S SANTA FE AV, VERNONA459RSTASE LLC10:10:0306/02/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200863 CA0197300VPDVALENZUELA,FERNANDO/VELEZ,MARISSA*31W10:13:2611:19:1910:31:512020061086013008 CARFAX AVE, DOWNEYLOCATEDOWNEY PD11:48:1106/02/2020VREC20200610862S BOYLE AV // 46TH, VERNON901TVERIZON WIRELESS 1-800-451-524214:05:0106/02/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200864 CA0197300VPDOURIQUE,CARLOS/SALDANA,CARLOS*40E14:05:31 14:05:3115:10:5014:15:52VPDVALENZUELA,FERNANDO/VELEZ,MARISSA31W15:10:5414:07:58VPDCAM,PATRICK3215:10:4614:15:44USTOWUS TOW14:20:29 14:21:4015:10:4914:25:09202006108644768 S ALAMEDA, VERNON422RWEST COAST RAGS15:29:0206/02/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200867 CA01973001Page of 306/03/202002:08:51 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/02/202006/02/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene202006108644768 S ALAMEDA, VERNON422RWEST COAST RAGS15:29:0206/02/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200867 CA0197300VPDVALENZUELA,FERNANDO/VELEZ,MARISSA*31W17:08:3716:37:19 17:50:1815:35:46VPDCAM,PATRICK3216:14:3715:50:07VPDVELEZ,MARISSA5D3417:50:1815:50:13202006108655601 DOWNEY RD, VERNON20002R15:37:5306/02/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200865 CA0197300VPDCAM,PATRICK*3215:40:42 15:40:4815:41:09VPDOURIQUE,CARLOS/SALDANA,CARLOS40E15:40:5216:37:5815:50:41MR C TOWMR C TO15:57:53 15:57:5416:34:2716:06:28202006108672957 E 46TH, VERNON484RQFX16:33:4606/02/2020RPT202006108702528 E 37TH, VERNONGTARRANCHO FOODS17:01:5206/02/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200866 CA0197300VPDCAM,PATRICK*3217:08:44 17:10:1618:14:2917:16:15202006108794020 BANDINI BL, VERNON925BAKER COMMODITIES21:16:0606/02/2020VIDepartmentOCA NumberRMS JurisVPD CR20200868 CA0197300VPDCERDA,PAUL,JR*32E21:16:4222:12:5821:22:34VPDGODOY,RAYMOND38W21:17:5822:11:13 22:16:2121:22:31VPDSWINFORD,PHILLIP4021:16:4421:33:2221:20:27MR C TOWMR C TO21:52:1422:12:5221:58:59202006108842Page of 306/03/202002:08:51 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/02/202006/02/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene202006108841945 E 55TH, VERNONPEDCK22:23:0406/02/2020RPT1015SRVDVSDepartmentOCA NumberRMS JurisVPD CR20200869 CA0197300VPDESTRADA,IGNACIO*S323:39:1522:23:04VPDDOCHERTY,MICHAEL/LUCAS,JASON2123:58:3722:29:11VPDSTEVENSON,KENT,JR/VASQUEZ,LUIS2200:10:0122:29:13VPDGODOY,RAYMOND38W22:23:5400:10:0122:31:12VPDSWINFORD,PHILLIP4022:23:1000:07:5222:26:04USTOWUS TOW23:01:08 23:01:3023:48:5823:22:57* Denotes Primary Unit3Page of 306/03/202002:08:51 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/03/202006/03/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene202006108932503 E VERNON AV, VERNON901TCAMINO REAL01:30:3406/03/2020RPT1015VIDepartmentOCA NumberRMS JurisVPD CR20200870 CA0197300VPDSWINFORD,PHILLIP*4001:31:0602:31:49 03:45:1802:22:4001:32:05VPDCERDA,PAUL,JR32E02:48:4901:32:12VPDGODOY,RAYMOND38W02:43:0201:52:27VPDONOPA,DANIELS702:37:2501:33:03202006109102750 S ALAMEDA, VERNONA487R10:07:2306/03/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200871 CA0197300VPDOURIQUE,CARLOS*41W10:34:1310:07:23VPDVALENZUELA,FERNANDO31W10:07:2810:27:5310:09:00202006109155508 S SANTA FE AV, VERNON484RVGI10:54:5406/03/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200872 CA0197300VPDZOZAYA,OSCAR/FLORES,TERESA*40E11:00:5711:01:54VPDVALENZUELA,FERNANDO31W11:01:5012:12:3511:10:17202006109163033 BANDINI BL, VERNONMR60AT&T MOBILITY 800 635 6840 411:15:4906/03/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200873 CA0197300VPDZOZAYA,OSCAR/FLORES,TERESA*40E11:17:3412:08:1011:28:3120200610921E 28TH // SANTA FE AV, VERNON20001RSUGEY VILLANUEVA13:21:5406/03/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200874 CA0197300VPDZOZAYA,OSCAR/FLORES,TERESA*40E13:27:0114:31:3313:29:54202006109275699 S DISTRICT BL, VERNON902TRJOES PLASTIC INC14:38:1206/03/2020RPTORDepartmentOCA NumberRMS JurisVPD CR20200875 CA01973001Page of 206/04/202001:35:00 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/03/202006/03/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene202006109275699 S DISTRICT BL, VERNON902TRJOES PLASTIC INC14:38:1206/03/2020RPTORDepartmentOCA NumberRMS JurisVPD CR20200875 CA0197300VPDOURIQUE,CARLOS*41W14:39:1115:46:4214:42:28VPDENCINAS,ANTHONY4314:39:4215:46:4214:41:33202006109303805 S SOTO, VERNON594RZ`S PLACE15:43:2606/03/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200876 CA0197300VPDZOZAYA,OSCAR/FLORES,TERESA*40E16:22:2415:43:26* Denotes Primary Unit2Page of 206/04/202001:35:00 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/04/202006/04/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene20200610959S SANTA FE AV // 57TH, VERNONAGTARMOISES08:21:0306/04/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200878 CA0197300VPDVALENZUELA,FERNANDO*32W08:23:1008:57:0208:23:43VPDZOZAYA,OSCAR/FLORES,TERESA4008:23:3909:36:1308:27:53VPDCERDA,EUGENIO41W08:37:0608:57:0408:38:23VPDNEWTON,TODD/ARANA,ANDRE43E09:09:4008:39:08VPDRAMOS,JOSEXS09:34:3108:44:50202006109604863 E 50TH, VERNON586STERIGENICS08:55:3606/04/2020RPTVSDepartmentOCA NumberRMS JurisVPD CR20200879 CA0197300VPDCERDA,EUGENIO*41W08:57:5909:53:4709:11:10202006109762916 SANTA FE, VERNONGTAR12:59:1006/04/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200880 CA0197300VPDZOZAYA,OSCAR/FLORES,TERESA*4013:05:3313:50:0513:05:332020061097784TH // HOOVER, LOS ANGELESLOCATEAL TOWING13:11:3106/04/2020VRECVPDRECORDS BUREAU*RECD13:30:4113:18:11202006109814889 LOMA VISTA AV, VERNONGTARWINKLER PLASTIC13:44:3106/04/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200881 CA0197300VPDZOZAYA,OSCAR/FLORES,TERESA*4014:56:1013:50:0820200610982E VERNON AV // SANTA FE AV, VERNON925LUIS14:05:0706/04/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200882 CA0197300VPDCERDA,EUGENIO*41W14:06:5214:22:59 17:13:1214:14:09VPDVALENZUELA,FERNANDO32W14:06:5316:13:0314:14:101Page of 206/05/202005:44:16 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/04/202006/04/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene20200610982E VERNON AV // SANTA FE AV, VERNON925LUIS14:05:0706/04/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200882 CA0197300VPDHERNANDEZ,EDWARD5D3214:23:0514:10:5520200611004E DISTRICT BL // CORONA AV, VERNONPEDCK22:59:5406/04/20201015RPTDepartmentOCA NumberRMS JurisVPD CR20200883 CA0197300VPDMADRIGAL,ALFONSO*26E23:57:4422:59:54VPDSTEVENSON,KENT,JR/MANNINO,NICHOLAS2223:52:5523:05:36VPDGODOY,RAYMOND38W23:00:3223:52:5823:01:48* Denotes Primary Unit2Page of 206/05/202005:44:16 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/05/202006/05/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene2020061102623RD // MINERVA, LOS ANGELESREC09:10:2506/05/2020VRECDepartmentOCA NumberRMS JurisVPD CR20200884 CA0197300VPDNEWTON,TODD/ARANA,ANDRE*2610:27:1909:10:26202006110274800 E 26TH, VERNONA459RHOOVER TRADING09:25:4906/05/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200885 CA0197300VPDCERDA,EUGENIO*40E09:28:23 09:28:2410:05:2409:32:19202006110294641 HAMPTON, VERNONGTARANCON TRANSPORT11:03:2906/05/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200886 CA0197300VPDDOCHERTY,MICHAEL*41W11:07:16 11:07:3412:27:5411:10:39202006110424519 EVERETT AV, VERNON902TWEST COAST CLOSEOUT16:42:3006/05/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200888 CA0197300VPDCERDA,EUGENIO*40E16:44:07 16:44:2917:01:0516:48:51VPDNEWTON,TODD/ARANA,ANDRE2616:46:2317:37:5617:01:07* Denotes Primary Unit1Page of 106/06/202005:41:40 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/06/202006/06/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene202006110934889 LOMA VISTA AV, VERNONGTARWINKLER PLASTIC07:39:1906/06/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200889 CA0197300VPDREDONA,BRYAN*26W07:40:07 07:40:0807:40:34VPDNEWTON,TODD/ARANA,ANDRE4107:40:3208:26:1107:43:0920200611114W 53RD ST // S FLOWER ST, LOS ANGELESLOCATE11:39:3506/06/2020VREC202006111193420 VERNON, VERNONPEDCKPASSER BY13:01:4306/06/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200890 CA0197300VPDOURIQUE,CARLOS*40E13:05:27 13:05:3015:23:1913:07:46VPDREDONA,BRYAN26W13:18:2013:36:5113:26:10VPDCERDA,EUGENIO4313:18:2613:40:5813:20:30202006111302059 E 37TH, VERNON459RSS CUSTOM FURNITURE16:43:3606/06/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200891 CA0197300VPDREDONA,BRYAN*26W16:50:45 16:50:4817:22:2916:55:39VPDOURIQUE,CARLOS40E17:18:4916:56:4320200611142S ATLANTIC BL // DISTRICT BL, VERNON901TLA CO FIRE21:32:0506/06/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200892 CA0197300VPDLUCAS,JASON*31E21:32:40 21:33:0322:06:5721:35:42VPDVELEZ,MARISSA2621:33:1321:49:5921:35:45VPDMANNINO,NICHOLAS38W21:56:1021:38:28VPDRAMOS,JOSE4321:32:41 21:33:0522:06:5721:37:29VPDESTRADA,IGNACIOS321:48:1022:06:5821:56:24202006111431Page of 206/07/202001:44:41 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/06/202006/06/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene202006111434305 S SANTA FE AV, VERNONLOCATELASO CENTURY21:54:0906/06/2020VRECRPT* Denotes Primary Unit2Page of 206/07/202001:44:41 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/07/202006/07/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene202006111562043 ROSS, VERNON487RTOP WRENCH00:56:5806/07/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200893 CA0197300VPDMANNINO,NICHOLAS*38W01:00:22 01:00:2302:11:5201:07:18VPDVELEZ,MARISSA2602:02:5801:29:3520200611161PORTER // SANTA FE, LOS ANGELESLPR04:29:2006/07/2020VRECRPT1015DepartmentOCA NumberRMS JurisVPD CR20200894 CA0197300VPDLUCAS,JASON*31E07:03:2404:30:08VPDMANNINO,NICHOLAS38W04:30:3206:23:2004:31:13VPDRAMOS,JOSE4306:34:1204:30:37MR C TOWMR C TO05:41:41 05:48:0306:32:0205:53:20VPDESTRADA,IGNACIOS304:49:2004:36:3920200611166PACIFIC BL // 45TH, VERNON901T08:39:0606/07/2020RPTVS1015CITEDepartmentOCA NumberRMS JurisVPD CR20200895 CA0197300VPDREDONA,BRYAN*26E08:40:22 08:40:2209:30:1408:41:17VPDCAM,PATRICK41W09:36:2708:41:08VPDOURIQUE,CARLOS/SALDANA,CARLOS4308:41:1610:32:5108:42:45USTOWUS TOW08:56:20 08:56:4809:30:0509:10:45202006111752929 E 54TH, VERNONA487RXPO12:26:5806/07/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200896 CA0197300VPDREDONA,BRYAN*31E13:08:0112:26:58202006111844632 PACIFIC BL, VERNON459RTECTRON INTERNATIONAL15:39:0306/07/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200897 CA01973001Page of 206/08/202000:22:25 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/07/202006/07/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene202006111844632 PACIFIC BL, VERNON459RTECTRON INTERNATIONAL15:39:0306/07/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200897 CA0197300VPDCAM,PATRICK*41W15:42:36 15:42:3616:26:0515:51:35VPDREDONA,BRYAN31E15:56:3716:07:2015:57:21VPDOURIQUE,CARLOS/SALDANA,CARLOS4315:53:4815:56:25 16:57:4316:09:15* Denotes Primary Unit2Page of 206/08/202000:22:25 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/08/202006/08/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene202006112256047 MALBURG WY, VERNON487RBARKLEY TIRES08:28:4306/08/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200898 CA0197300VPDOURIQUE,CARLOS/SALDANA,CARLOS*4308:32:22 08:32:4809:04:2308:37:23202006112305608 S SOTO, VERNON S/A 8459RXESS BRAND PRODUCTS09:17:2406/08/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200899 CA0197300VPDCAM,PATRICK*40E09:18:4109:19:54VPDOURIQUE,CARLOS/SALDANA,CARLOS4309:19:5210:14:5110:03:46202006112352675 S SANTA FE AV, VERNON484RUNK10:33:3406/08/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200900 CA0197300VPDOURIQUE,CARLOS/SALDANA,CARLOS*4311:08:4910:34:59202006112454535 S SOTO, VERNONGTARBNB WHOLESALE14:28:0306/08/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200901 CA0197300VPDCAM,PATRICK*40E14:28:4416:04:4114:32:03VPDVALENZUELA,FERNANDO41W14:30:4115:12:1614:33:29VPDOURIQUE,CARLOS/SALDANA,CARLOS4317:07:18 17:12:4014:33:10VPDMARTINEZ,GABRIELS514:33:4115:09:3614:36:17202006112574900 E 50TH, VERNON484VESTA HOME20:47:4906/08/2020RPT1015DepartmentOCA NumberRMS JurisVPD CR20200902 CA0197300VPDVASQUEZ,LUIS*26E20:50:2622:07:0720:51:45VPDSWINFORD,PHILLIP3120:50:2822:07:0720:52:28VPDGODOY,RAYMOND38W20:50:2922:07:0820:52:39VPDVILLEGAS,RICHARDXS21:38:0220:54:27* Denotes Primary Unit1Page of 106/09/202006:08:50 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/09/202006/09/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene202006112662909 LEONIS BL, VERNON459RBON APPETIT01:41:0606/09/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200903 CA0197300VPDVASQUEZ,LUIS*26E01:45:0104:00:5501:45:33VPDSWINFORD,PHILLIP3101:45:0404:00:5501:46:10VPDGODOY,RAYMOND38W01:45:0503:39:5901:45:56VPDVILLEGAS,RICHARDXS03:39:5701:57:53202006112735700 S ALAMEDA, VERNON487RPRAXAIR07:18:3806/09/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200904 CA0197300VPDENCINAS,ANTHONY*4107:23:04 07:23:1507:23:53VPDOURIQUE,CARLOS/SALDANA,CARLOS43W07:23:5008:05:5707:28:46202006112764020 BANDINI BL, VERNON484RBAKER COMMODITIES08:14:3106/09/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200905 CA0197300VPDZOZAYA,OSCAR/FLORES,TERESA*40E08:16:2009:24:2508:21:14202006112814901 BANDINI BL, VERNONVCK09:57:0606/09/2020VSDepartmentOCA NumberRMS JurisVPD CR20200906 CA0197300VPDENCINAS,ANTHONY*4110:33:2109:57:06VPDZOZAYA,OSCAR/FLORES,TERESA40E10:27:3810:27:34MR C TOWMR C TO10:02:56 10:03:3510:33:2110:12:57202006112855610 ALCOA AV, VERNONPATCK10:50:5206/09/2020RPT1015DepartmentOCA NumberRMS JurisVPD CR20200907 CA0197300VPDZOZAYA,OSCAR/FLORES,TERESA*40E11:58:1610:50:52VPDENCINAS,ANTHONY4110:55:2111:58:16VPDOURIQUE,CARLOS/SALDANA,CARLOS43W10:55:3411:58:1711:10:58202006112901Page of 306/10/202005:11:28 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/09/202006/09/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene202006112904825 S SOTO, VERNONA487UNK13:52:4006/09/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200908 CA0197300VPDZOZAYA,OSCAR/FLORES,TERESA*40E13:52:5914:19:25VPDENCINAS,ANTHONY4113:53:0014:35:2713:59:31VPDOURIQUE,CARLOS/SALDANA,CARLOS43W14:35:2713:54:33VPDCROSS,JEREMY5D3014:35:2713:58:23VPDGAYTAN,LORENZO5d3114:35:2814:13:12VPDESCOBEDO,ALEXY5d3314:35:2814:13:13202006112926074 MALBURG WY, VERNON459VRUNK14:36:1606/09/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200909 CA0197300VPDENCINAS,ANTHONY*4114:36:33 14:39:2614:40:00VPDZOZAYA,OSCAR/FLORES,TERESA40E14:39:4915:45:2614:42:53VPDOURIQUE,CARLOS/SALDANA,CARLOS43W14:36:35 14:39:2815:13:3514:42:5120200611294FRUITLAND AV // GIFFORD AV, VERNONGTAR15:12:2106/09/2020UTLRPTDepartmentOCA NumberRMS JurisVPD CR20200911 CA0197300VPDOURIQUE,CARLOS/SALDANA,CARLOS*43W15:13:4715:24:0815:18:56VPDZOZAYA,OSCAR/FLORES,TERESA40E16:09:5316:52:5416:13:41202006112955512 S SANTA FE AV, VERNON484EL RUISENOR15:24:1206/09/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200910 CA0197300VPDENCINAS,ANTHONY*4115:24:33 15:25:4815:43:3315:26:21VPDOURIQUE,CARLOS/SALDANA,CARLOS43W15:24:37 15:25:5016:09:2115:43:37VPDRAMOS,JOSEXS15:36:3315:36:19202006113183805 S SOTO, VERNON459AZS PLACE23:17:5706/09/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200912 CA0197300VPDSWINFORD,PHILLIP*31W23:19:5700:11:01 01:01:0223:21:132Page of 306/10/202005:11:28 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/09/202006/09/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene202006113183805 S SOTO, VERNON459AZS PLACE23:17:5706/09/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200912 CA0197300VPDVASQUEZ,LUIS2623:22:4100:10:5523:24:54VPDGODOY,RAYMOND38E23:20:0400:11:1223:24:53* Denotes Primary Unit3Page of 306/10/202005:11:28 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/10/202006/10/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene202006113212485 E VERNON AV, VERNON487LITO`S CUTTING SERVICE00:00:3006/10/20201015RPT XSVSDepartmentOCA NumberRMS JurisVPD CR20200913 CA0197300VPDVILLEGAS,RICHARD*XS00:01:0202:07:19 02:52:3300:08:47VPDVASQUEZ,LUIS2602:39:1800:10:58VPDSWINFORD,PHILLIP31W01:01:0802:43:0801:04:32VPDGODOY,RAYMOND38E02:39:2702:39:4400:11:14202006113345050 S SANTA FE AV, VERNON484RROGERS POULTRY07:48:5306/10/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200914 CA0197300VPDRAMOS,JOSE*4307:51:06 07:51:3907:56:17VPDZOZAYA,OSCAR/FLORES,TERESA31W10:17:0507:56:15202006113373308 BANDINI BL, VERNON925EMPLOYEE JESSIE11:07:2106/10/2020NCERPTDepartmentOCA NumberRMS JurisVPD CR20200915 CA0197300VPDZOZAYA,OSCAR/FLORES,TERESA*31W11:09:5312:10:39 11:22:5311:16:04VPDVALENZUELA,FERNANDO26E11:25:0512:11:17 11:22:5211:13:01VPDRAMOS,JOSE4311:09:5512:10:46 11:22:5311:15:24202006113384726 LOMA VISTA AV, VERNONGTARLA BRAND11:44:5506/10/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200916 CA0197300VPDRAMOS,JOSE*4312:10:4812:11:24VPDVALENZUELA,FERNANDO26E12:11:2313:23:3212:12:25202006113393001 BANDINI BL, VERNON484RJUMBO SALES11:58:3606/10/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200917 CA0197300VPDZOZAYA,OSCAR/FLORES,TERESA*31W12:10:4213:01:1312:16:28202006113401Page of 206/11/202000:35:03 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/10/202006/10/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene20200611340E 37TH // SOTO, VERNON20001RMARIA ELENA PORTILLO13:25:3406/10/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200918 CA0197300VPDZOZAYA,OSCAR/FLORES,TERESA*31W13:27:2313:26:59VPDRAMOS,JOSE4314:33:5613:27:21202006113603333 DOWNEY RD, VERNONFOUNDUPS20:44:4506/10/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200919 CA0197300VPDGODOY,RAYMOND*38E20:46:13 20:46:3321:07:0120:56:36VPDOURIQUE,CARLOS4121:07:2120:56:40202006113675151 ALCOA AV, VERNON487RRITE WAY MEAT PACKERS22:41:1406/10/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200920 CA0197300VPDGODOY,RAYMOND*38E22:43:18 22:43:2222:43:44VPDOURIQUE,CARLOS4122:43:4223:04:1622:51:51* Denotes Primary Unit2Page of 206/11/202000:35:03 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/11/202006/11/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene202006113724901 BANDINI BL, VERNON487RLINEAGE SERVICES00:16:1506/11/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200921 CA0197300VPDOURIQUE,CARLOS*4100:19:1701:15:3000:29:00202006113792901 FRUITLAND AV, VERNONGTAROWENS BROCKWAY06:03:4806/11/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200922 CA0197300VPDGODOY,RAYMOND*38E06:09:28 06:09:2907:01:1906:12:55202006113875837 S DISTRICT BL, VERNON459VRFARM FRESH TO YOU08:53:2106/11/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200923 CA0197300VPDNEWTON,TODD/ARANA,ANDRE*31E08:59:13 09:00:0809:44:0909:09:43202006113892011 E 27TH, VERNONMISPLOCATE09:48:5606/11/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200924 CA0197300VPDCERDA,EUGENIO*4309:52:53 09:52:5716:56:5609:55:23VPDNEWTON,TODD/ARANA,ANDRE31E09:52:54 09:52:5910:36:0409:59:24VPDGAYTAN,LORENZO5D3110:36:0110:01:38202006113962300 E 52D, VERNON902T13:59:3606/11/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200925 CA0197300VPDNEWTON,TODD/ARANA,ANDRE*31E14:03:09 14:03:1115:27:0914:12:4520200611400S ATLANTIC BL // BANDINI BL, VERNON20002RVERIZON WIRELESS 1-800-451-524215:33:5306/11/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200926 CA0197300VPDNEWTON,TODD/ARANA,ANDRE*31E15:52:48 15:52:4916:48:1016:08:15202006114011Page of 206/12/202006:48:43 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/11/202006/11/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene202006114013451 E 26TH, VERNONGTARUNITED STEEL FENCE15:37:2106/11/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200927 CA0197300VPDZOZAYA,OSCAR/FLORES,TERESA*32W16:03:19 16:03:2016:49:4916:15:51202006114054305 S SANTA FE AV, VERNON594R18:59:5206/11/2020RPTCITYDepartmentOCA NumberRMS JurisVPD CR20200928 CA0197300VPDCERDA,PAUL,JR*40W19:06:3418:59:52* Denotes Primary Unit2Page of 206/12/202006:48:43 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/12/202006/12/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene202006114312750 S ALAMEDA, VERNONPATCK01:15:4706/12/2020RPTRPTDepartmentOCA NumberRMS JurisVPD CR20200930 CA0197300VPD CR20200931 CA0197300VPDOURIQUE,CARLOS*4101:16:1603:55:4001:15:47VPDMADRIGAL,ALFONSO20E01:22:5103:59:0601:26:36VPDCERDA,PAUL,JR40W03:40:0101:16:13VPDESTRADA,IGNACIOS303:16:1801:22:4920200611432AYERS AV // BANDINI BL, VERNONVCK01:18:5506/12/2020RPTVRECVPDMADRIGAL,ALFONSO*20E01:22:4401:18:55VPDOURIQUE,CARLOS4103:55:4004:57:1404:00:55202006114546023 ALCOA AV, VERNONGTARVEST INC11:36:0906/12/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200932 CA0197300VPDZOZAYA,OSCAR*32E11:40:17 11:40:1812:25:5511:56:56202006114662623 SLAUSON AV, VERNONMISPLOCATEHP COMMUNITY HOSPITAL15:54:3906/12/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200933 CA0197300VPDZOZAYA,OSCAR*32E15:54:3916:41:4716:13:01202006114693341 E 50TH, VERNONGTARPAPA CANTELLAS17:09:3006/12/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200934 CA0197300VPDZOZAYA,OSCAR*32E17:15:45 17:15:4517:16:52VPDCERDA,EUGENIO43W17:16:5117:53:4617:25:0720200611478S ATLANTIC BL // BANDINI BL, VERNON902TT-MOBILE (877) 653-791120:58:0706/12/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200935 CA01973001Page of 206/13/202005:22:28 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/12/202006/12/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene20200611478S ATLANTIC BL // BANDINI BL, VERNON902TT-MOBILE (877) 653-791120:58:0706/12/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200935 CA0197300VPDLUCAS,JASON*32E20:59:12 20:59:3822:38:0421:04:55VPDMADRIGAL,ALFONSO20W21:00:2121:34:4621:04:58VPDESTRADA,IGNACIOS321:26:0321:06:01202006114832820 S SOTO, VERNON902TRSTEVE22:50:3806/12/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200936 CA0197300VPDLUCAS,JASON*32E22:53:26 22:53:5123:59:5322:56:23VPDMADRIGAL,ALFONSO20W23:59:5222:55:06* Denotes Primary Unit2Page of 206/13/202005:22:28 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/13/202006/13/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene202006114892068 E 37TH, VERNONPEDCK00:42:4406/13/20201015RPTDepartmentOCA NumberRMS JurisVPD CR20200937 CA0197300VPDLUCAS,JASON*32E01:44:4100:42:44VPDMADRIGAL,ALFONSO20W01:54:1400:42:48202006115065685 ALCOA AV, VERNONREC11:02:2106/13/2020VRECDepartmentOCA NumberRMS JurisVPD CR20200938 CA0197300VPDREDONA,BRYAN*26E11:37:2011:02:21USTOWUS TOW11:15:11 11:16:1211:37:2011:28:11202006115073716 S ALAMEDA, VERNON602JDM TRUST MOTORS11:03:2506/13/20201015CITERPTDepartmentOCA NumberRMS JurisVPD CR20200939 CA0197300VPDDOCHERTY,MICHAEL*43W11:04:52 11:05:2212:11:4511:11:57VPDNEWTON,TODD/ARANA,ANDRE3111:18:13 11:18:1412:11:4511:21:29* Denotes Primary Unit1Page of 106/14/202000:01:48 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/14/202006/14/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene202006115752401 SANTA FE, VERNONLOCATEUS TOW16:26:1606/14/2020VRECVPDRECORDS BUREAU*RECD16:49:2716:30:43202006115852110 E 37TH, VERNON484PRIVY INC20:33:2906/14/20201015RPTFISOWDepartmentOCA NumberRMS JurisVPD CR20200940 CA0197300VPDFINO,MARCUS*26W20:35:26 20:36:0121:57:2120:38:07VPDVILLEGAS,RICHARD32E20:36:2221:57:2220:39:37VPDGODOY,RAYMOND3820:35:27 20:35:4221:57:2220:37:57VPDESTRADA,IGNACIOS320:42:5921:37:2020:45:53* Denotes Primary Unit1Page of 106/15/202000:09:02 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/15/202006/15/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene202006116103768 BANDINI BL, VERNON902T06:10:1906/15/2020RPTVSDepartmentOCA NumberRMS JurisVPD CR20200941 CA0197300VPDVILLEGAS,RICHARD*32E06:11:13 06:11:4407:04:0506:17:20VPDGODOY,RAYMOND3806:53:0006:18:24MR C TOWMR C TO06:20:46 06:21:2706:51:0506:31:40202006116194519 EVERETT AV, VERNON484RWEST COAST CLOSEOUT08:27:0406/15/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200942 CA0197300VPDOURIQUE,CARLOS/SALDANA,CARLOS*3108:33:51 08:33:5109:04:2708:38:34202006116222110 E 37TH, VERNON487RPRIVY INC08:57:2706/15/2020RPTRept 31DepartmentOCA NumberRMS JurisVPD CR20200943 CA0197300VPDVALENZUELA,FERNANDO*41W08:58:5109:00:13VPDOURIQUE,CARLOS/SALDANA,CARLOS3109:04:3211:18:2609:20:53VPDMARTINEZ,GABRIELS509:35:0710:05:51202006116333155 LEONIS BL, VERNON487RSHOSHO FASHION12:57:3406/15/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200945 CA0197300VPDOURIQUE,CARLOS/SALDANA,CARLOS*3113:04:1214:15:5113:25:49202006116342211 E 27TH, VERA484REUNINA13:17:0206/15/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200944 CA0197300VPDVALENZUELA,FERNANDO*41W13:19:52 13:20:2315:06:2513:25:29VPDCAM,PATRICK40E13:49:2615:12:2813:57:23VPDMARTINEZ,GABRIELS515:05:3714:24:5620200611644PACIFIC BL // SANTA FE AV, VERNONWELCK18:58:3206/15/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200946 CA01973001Page of 206/16/202000:21:02 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/15/202006/15/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene20200611644PACIFIC BL // SANTA FE AV, VERNONWELCK18:58:3206/15/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200946 CA0197300VPDFINO,MARCUS*2618:58:5320:16:3018:59:23VPDGODOY,RAYMOND38E19:08:4419:12:25VPDVILLEGAS,RICHARDXS19:23:2919:05:28202006116474755 E DISTRICT BL, VERNON594RVERNON WELL SITE 2020:13:0206/15/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200947 CA0197300VPDGODOY,RAYMOND*38E20:15:2620:41:0620:17:40VPDFINO,MARCUS2620:16:3420:39:5920:25:45VPDVASQUEZ,LUIS32W20:15:2820:40:0220:17:41VPDVILLEGAS,RICHARDXS20:41:0720:19:10* Denotes Primary Unit2Page of 206/16/202000:21:02 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/16/202006/16/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene20200611661755 LEONARD ST, LOS ANGELESLOCATECITY WIDE TOW/ LASO EAST LA04:21:2206/16/2020VREC20200611675E 50TH // ALCOA AV, VERNONREC08:52:1006/16/2020VRECDepartmentOCA NumberRMS JurisVPD CR20200948 CA0197300VPDENCINAS,ANTHONY*4109:24:3408:52:10VPDOURIQUE,CARLOS/SALDANA,CARLOS31W10:33:5709:13:44VPDZOZAYA,OSCAR/FLORES,TERESA40E08:52:13 08:57:2309:24:2409:03:38USTOWUS TOW09:54:23 09:54:5510:52:1310:14:00202006116762320 E 49TH, VERNON487RNAXA ELECTRONICS09:10:1906/16/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200952 CA0197300VPDENCINAS,ANTHONY*4109:24:3609:57:4209:56:27VPDOURIQUE,CARLOS/SALDANA,CARLOS31W11:02:5712:18:3211:07:27202006116776190 S BOYLE AV, VERNON459VRIRON MOUNTAIN09:20:0606/16/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200949 CA0197300VPDZOZAYA,OSCAR/FLORES,TERESA*40E09:24:2611:15:0709:28:3220200611678E 25TH // SANTA FE AV, VERNON901TR09:50:2006/16/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200951 CA0197300VPDENCINAS,ANTHONY*4109:57:46 09:57:4711:13:06202006116793228 E 50TH, VERNONA487PACIFIC DESIGNS INC10:33:5506/16/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200950 CA0197300VPDOURIQUE,CARLOS/SALDANA,CARLOS*31W11:02:5310:33:571Page of 206/17/202000:08:10 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/16/202006/16/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene20200611691S SANTA FE AV // 37TH, VERNONGTAR18:10:3906/16/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200953 CA0197300VPDZOZAYA,OSCAR/FLORES,TERESA*40E18:14:10 18:15:5718:44:2018:19:35VPDOURIQUE,CARLOS/SALDANA,CARLOS31W18:19:5919:02:1818:23:45VPDVILLEGAS,RICHARD4118:14:3718:29:52202006117043255 SACO, VERNONUNATTACHEDTR20:57:5206/16/2020VIDepartmentOCA NumberRMS JurisVPD CR20200954 CA0197300VPDVASQUEZ,LUIS*3221:59:2520:57:52MR C TOWMR C TO21:07:5321:59:2621:19:54* Denotes Primary Unit2Page of 206/17/202000:08:10 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/17/202006/17/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene202006117313055 BANDINI BL, VERNON487RSUPERIOR LITHOGRAPHICS08:10:1706/17/2020RPTDepartmentOCA NumberRMS JurisVPD 20200611731 CA0197300VPD 20200611731 CA0197300VPD 20200611731 CA0197300VPD CR20200955 CA0197300VPDZOZAYA,OSCAR/FLORES,TERESA*31W08:30:2009:19:4708:37:42202006117332424 E 26TH, VERNON487RJACOB SUPPLIES09:14:1506/17/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200956 CA0197300VPDRAMOS,JOSE*3209:16:2009:38:40VPDZOZAYA,OSCAR/FLORES,TERESA31W09:19:5110:25:0709:24:27202006117341912 E VERNON AV, VERNON902TRED CHAMBER CO09:33:5306/17/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200957 CA0197300VPDVALENZUELA,FERNANDO*26E09:36:4810:28:5609:46:44202006117405200 S SOTO, VERNONPEDCK11:32:0506/17/20201015RPTDepartmentOCA NumberRMS JurisVPD CR20200958 CA0197300VPDZOZAYA,OSCAR/FLORES,TERESA*31W12:22:0511:32:05202006117472150 E 37TH, VERNON314IRENE ACEDO15:18:5706/17/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200959 CA0197300VPDZOZAYA,OSCAR/FLORES,TERESA*31W15:20:2417:22:5915:21:51VPDVALENZUELA,FERNANDO26E15:20:2815:40:5315:24:08VPDRAMOS,JOSE3215:20:2615:47:3415:24:03VPDMARTINEZ,GABRIELS515:47:1715:24:10202006117491Page of 206/18/202001:54:20 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/17/202006/17/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene20200611749E VERNON AV // SEVILLE AV, VERNON901TT-MOBILE (877) 653-791115:45:2506/17/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200961 CA0197300VPDVALENZUELA,FERNANDO*26E15:45:5916:57:5115:47:43VPDRAMOS,JOSE3215:47:3916:10:01VPDMARTINEZ,GABRIELS516:57:5115:47:26202006117513056 BANDINI BL, VERNONGTARPACIFIC COAST TIRES16:05:4006/17/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200960 CA0197300VPDRAMOS,JOSE*3216:13:3016:53:3916:19:21* Denotes Primary Unit2Page of 206/18/202001:54:20 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/18/202006/18/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene20200611779E 25TH // SANTA FE AV, VERNON911A07:43:1706/18/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200962 CA0197300VPDRAMOS,JOSE*4307:48:38 07:48:3807:49:17VPDCERDA,EUGENIO/ARANA,ANDRE32E07:49:1508:50:0807:59:47202006117864525 E DISTRICT BL, VERNON487RBON APPETIT09:51:3706/18/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200964 CA0197300VPDCERDA,EUGENIO/ARANA,ANDRE*32E09:54:16 09:54:2510:59:0809:58:07202006117894501 S SANTA FE AV, VERNONFOUND10:09:4206/18/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200963 CA0197300VPDZOZAYA,OSCAR/FLORES,TERESA*31W10:14:31 10:14:3611:01:2910:20:35202006118005088 FRUITLAND AV, VERNONGTARHARBOR MARINE PROD14:47:1106/18/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200965 CA0197300VPDCERDA,EUGENIO/ARANA,ANDRE*32E14:49:58 14:51:4816:05:2115:03:08202006118012700 NAOMI AVE, LOS ANGELESLOCATE15:25:3906/18/2020VRECVPDDISPATCH*DISP15:38:5415:26:01202006118045151 ALCOA AV, VERNON484RT-MOBILE (877) 653-791116:01:2006/18/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200966 CA0197300VPDRAMOS,JOSE*4316:05:25 16:05:3616:05:57VPDCERDA,EUGENIO/ARANA,ANDRE32E16:05:5516:55:2816:10:46* Denotes Primary Unit1Page of 106/19/202005:29:36 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/19/202006/19/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene20200611832PACIFIC BL // 52D, VERNONLOCATEHPPD04:53:4606/19/2020VRECVPDRECORDS BUREAU*RECD05:14:4005:14:31202006118473055 BANDINI BL, VERNONAGTARSUPERIOR LITHOGRAPHICS12:36:0706/19/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200967 CA0197300VPDOURIQUE,CARLOS*31E12:38:1413:53:2212:57:44VPDNEWTON,TODD/ARANA,ANDRE4113:02:3213:53:1613:06:39202006118555111 HAMPTON, VERNONAGTARUNITED FINISHING APPAREL14:28:3606/19/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200968 CA0197300VPDOURIQUE,CARLOS*31E14:30:3714:56:1814:34:08VPDNEWTON,TODD/ARANA,ANDRE4114:40:5614:48:0914:45:03202006118602111 ANDERSON, VERNONAGTARBLACK BIRD DESIGN15:25:5306/19/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200969 CA0197300VPDNEWTON,TODD/ARANA,ANDRE*4115:36:4716:30:4615:48:02202006118623222 E WASHINGTON BL, VERNON653MRGARMENT LINE16:03:1006/19/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200971 CA0197300VPDCERDA,EUGENIO*43W16:18:3316:21:43VPDOURIQUE,CARLOS31E16:27:2717:45:3016:31:5220200611864CUDAHY // DISTRICT, VERNON20002RT-MOBILE (877) 653-791116:21:5806/19/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200970 CA0197300VPDNEWTON,TODD/ARANA,ANDRE*4116:31:1017:43:3916:48:29202006118811Page of 206/20/202005:49:58 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/19/202006/19/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene20200611881BANDINI BL // ATLANTIC BL, VERNONVCK22:44:3406/19/2020VIRPTDepartmentOCA NumberRMS JurisVPD CR20200972 CA0197300VPDMANNINO,NICHOLAS*20E23:18:4622:44:34VPDSTEVENSON,KENT,JR2222:44:4323:07:4722:52:34* Denotes Primary Unit2Page of 206/20/202005:49:58 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/20/202006/20/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene202006119205899 DOWNEY RD, VERNONGTARDOWNTOWN WHOLESALERS16:48:2406/20/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200973 CA0197300VPDREDONA,BRYAN*31E16:51:22 16:51:2318:12:2816:56:3820200611922HAMPTON // FRUITLAND AV, VERNONHBC19:26:5906/20/2020FISOWADVPAWCRPTNRDDepartmentOCA NumberRMS JurisVPD CR20200974 CA0197300VPDMANNINO,NICHOLAS*20W21:07:2819:26:59VPDMADRIGAL,ALFONSO38E19:28:0321:07:2919:31:23VPDLUCAS,JASON4019:27:0319:55:30 21:07:2919:31:18VPDESTRADA,IGNACIOS320:14:4020:45:0220:18:5820200611934E 46TH // BOYLE AV, VERNONDUICARLA CHAVEZ SERRANO22:14:5006/20/2020VIRPTDepartmentOCA NumberRMS JurisVPD CR20200975 CA0197300VPDMADRIGAL,ALFONSO*38E22:17:2723:35:4022:17:32VPDMANNINO,NICHOLAS20W23:35:1322:21:32VPDLUCAS,JASON4022:46:4022:17:37MR C TOWMR C TO23:08:11 23:08:1223:39:5823:15:47* Denotes Primary Unit1Page of 106/21/202000:04:38 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/21/202006/21/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene202006119545600 ALCOA AV, VERNONREC08:05:2306/21/2020VRECRPTDepartmentOCA NumberRMS JurisVPD CR20200976 CA0197300VPDOURIQUE,CARLOS/SALDANA,CARLOS*4108:45:5108:05:23MR C TOWMR C TO08:21:02 08:21:4108:38:4508:27:55202006119602601 S SOTO, VERNON594RJOE K RESTAURANT10:15:5406/21/2020RPTRept 41DepartmentOCA NumberRMS JurisVPD CR20200977 CA0197300VPDDOCHERTY,MICHAEL*43W10:17:5410:19:30VPDOURIQUE,CARLOS/SALDANA,CARLOS4110:19:2711:44:0610:41:26202006119722950 E VERNON AV, VERNON594RLA METRO16:28:3806/21/2020RPTRept 41DepartmentOCA NumberRMS JurisVPD CR20200978 CA0197300VPDDOCHERTY,MICHAEL*43W16:29:5716:41:25VPDOURIQUE,CARLOS/SALDANA,CARLOS4116:30:5217:05:5816:33:54* Denotes Primary Unit1Page of 106/22/202000:00:14 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/22/202006/22/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene202006119945526 S SOTO, VERNON459 L A CLOSEOUT INC01:08:0806/22/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200979 CA0197300VPDGODOY,RAYMOND*38E01:10:09 01:10:0902:38:1701:13:23VPDFINO,MARCUS26W01:10:4102:20:3701:13:30VPDVILLEGAS,RICHARD3101:10:11 01:10:1102:38:1701:14:13VPDESTRADA,IGNACIOS301:45:3701:15:22202006120182627 S SOTO, VERNON594RJ AND K08:46:3306/22/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200980 CA0197300VPDRAMOS,JOSE*40W08:49:26 08:54:1708:55:56VPDOURIQUE,CARLOS/SALDANA,CARLOS4108:55:5309:15:5309:00:12202006120242221 E 55TH, VERNON484RRECYCLE YARD10:33:2206/22/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200981 CA0197300VPDRAMOS,JOSE*40W10:35:1811:04:5710:42:18202006120251875 E 27TH, VERNON925VERNON PALLETS10:48:0006/22/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200982 CA0197300VPDOURIQUE,CARLOS/SALDANA,CARLOS*4110:49:1211:23:0210:54:35VPDCAM,PATRICK32E10:49:1311:23:0111:06:03202006120265950 ALCOA AV, VERNON459VRAMERIPRIDE10:54:5806/22/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200984 CA0197300VPDCAM,PATRICK*32E11:23:10 11:23:3912:37:1911:31:40202006120274425 E 49TH, VERNON594RI WOOD DESIGN INC11:14:3606/22/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200983 CA0197300VPDOURIQUE,CARLOS/SALDANA,CARLOS*4111:23:05 11:23:2412:06:4811:31:441Page of 206/23/202001:39:15 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/22/202006/22/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene202006120373155 LEONIS BL, VERNON20002VERIZON WIRELESS 1-800-451-524214:02:2506/22/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200985 CA0197300VPDRAMOS,JOSE*40W14:03:14 14:06:5414:54:4714:07:26VPDCAM,PATRICK32E14:35:5014:07:34VPDOURIQUE,CARLOS/SALDANA,CARLOS4114:54:4714:10:48VPDENCINAS,ANTHONYXS14:03:5214:54:4714:04:53* Denotes Primary Unit2Page of 206/23/202001:39:15 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/23/202006/23/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene20200612071E DISTRICT BL // LOMA VISTA AV, VERNONSRMETELSA06:01:3606/23/2020RPTMETDepartmentOCA NumberRMS JurisVPD CR20200986 CA0197300VPDFINO,MARCUS*26E06:03:0508:15:0806:03:57VPDVILLEGAS,RICHARD3106:03:0606:55:4906:10:17VPDMADRIGAL,ALFONSO38W06:04:2006:55:4606:09:0020200612085S INDIANA // BANDINI BL, VERNON917AROGER10:13:1506/23/2020VIDepartmentOCA NumberRMS JurisVPD CR20200987 CA0197300VPDZOZAYA,OSCAR/FLORES,TERESA*40W10:14:5112:19:3510:22:20VPDOURIQUE,CARLOS/SALDANA,CARLOS4112:19:3610:33:52VPDESCOBEDO,ALEXY5D3311:55:3211:30:01VPDMARTINEZ,GABRIELS510:34:1412:19:3611:27:5220200612096S ATLANTIC BL // BANDINI BL, VERNON902TCINDY13:28:3306/23/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200988 CA0197300VPDCAM,PATRICK*32E13:29:48 13:34:3614:23:3713:37:24202006120992501 S SANTA FE AV, VERNONSRMET14:32:2206/23/2020RPTMETDepartmentOCA NumberRMS JurisVPD CR20200989 CA0197300VPDZOZAYA,OSCAR/FLORES,TERESA*40W17:40:1014:32:22VPDCAM,PATRICK32E14:33:0215:44:4114:36:39VPDMARTINEZ,GABRIELS515:46:4614:48:0320200612103E WASHINGTON BL // DOWNEY RD, VERNON901TRSPRINT 866-398-328415:43:0206/23/2020RPTORDepartmentOCA NumberRMS JurisVPD CR20200990 CA0197300VPDOURIQUE,CARLOS/SALDANA,CARLOS*4115:44:06 15:46:4116:43:2316:04:57VPDCAM,PATRICK32E15:44:4116:19:3415:46:20VPDMARTINEZ,GABRIELS516:46:0215:50:481Page of 206/24/202001:22:03 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/23/202006/23/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene202006121042900 S SUNOL DR, VERNON484RBODY COTE15:57:0606/23/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200991 CA0197300VPDCAM,PATRICK*32E16:19:4917:11:3216:29:14202006121062319 E 37TH, VERNON487RMINKY TRADING16:34:4306/23/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200992 CA0197300VPDOURIQUE,CARLOS/SALDANA,CARLOS*4117:36:3617:04:11202006121072266 E 38TH, VERNONASSISTFDC JAM INDUSTRIES17:12:2506/23/2020RPTRPTDepartmentOCA NumberRMS JurisVPD CR20200993 CA0197300VPDCAM,PATRICK*32E17:15:1818:56:3817:16:12VPDZOZAYA,OSCAR/FLORES,TERESA40W18:22:0818:00:45VPDOURIQUE,CARLOS/SALDANA,CARLOS4117:36:4018:32:37 19:41:4518:06:1918:05:58VPDMARTINEZ,GABRIELS517:28:4618:56:3917:30:16202006121182459 E VERNON AV, VERNON459ALA DOLLAR WORLD21:59:3706/23/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200994 CA0197300VPDSWINFORD,PHILLIP*43W22:00:44 22:01:0723:26:3622:04:05VPDGODOY,RAYMOND3822:00:46 22:01:0922:01:57 23:26:3622:17:07VPDCERDA,PAUL,JR40E22:11:1422:34:5922:20:27VPDHERRERA,GUSTAVOS622:01:5223:26:3722:02:26* Denotes Primary Unit2Page of 206/24/202001:22:03 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/24/202006/24/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene202006121274305 S SANTA FE AV, VERNONPEDCK05:00:0606/24/2020RPT1015DepartmentOCA NumberRMS JurisVPD CR20200995 CA0197300VPDPEREZ,NICK*L205:25:2405:00:09VPDGODOY,RAYMOND3806:06:2205:10:24VPDSWINFORD,PHILLIP43W05:00:1106:40:3805:01:26VPDHERRERA,GUSTAVOS606:06:2005:35:32202006121461901 E 55TH, VERNON459RKIMMY VALENTINE12:19:3206/24/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200996 CA0197300VPDFLORES,TERESA*4412:23:1812:53:21VPDRAMOS,JOSE40W12:23:4113:31:4512:27:55VPDENCINAS,ANTHONY4312:53:2313:31:46202006121492288 E 27TH, VERNONRECLASD AIR 1113:08:0006/24/2020VRECDepartmentOCA NumberRMS JurisVPD CR20200998 CA0197300VPDFLORES,TERESA*4413:08:1613:58:2713:26:39VPDVALENZUELA,FERNANDO32E13:10:5913:17:1813:12:01202006121503737 S SOTO, VERNON594RSPRINT 866-398-328413:15:4006/24/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200997 CA0197300VPDVALENZUELA,FERNANDO*32E13:17:2113:38:5413:22:09VPDRAMOS,JOSE40W13:49:1213:31:53VPDSOUSA,ROBERTOC213:43:0113:19:19VPDPEREZ,NICKL213:42:5913:19:02202006121554724 E 26TH, VERNON459VRJC KOOLER13:58:5106/24/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200999 CA0197300VPD CR20201000 CA0197300VPDCERDA,EUGENIO/FLORES,TERESA*3114:20:56 14:21:1514:21:501Page of 206/25/202001:43:08 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/24/202006/24/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene202006121554724 E 26TH, VERNON459VRJC KOOLER13:58:5106/24/2020RPTDepartmentOCA NumberRMS JurisVPD CR20200999 CA0197300VPD CR20201000 CA0197300VPDVALENZUELA,FERNANDO32E14:21:4715:17:4914:26:43202006121574415 BANDINI BL, VERNONGTARGT LIVING FOOD14:24:0806/24/2020RPTDepartmentOCA NumberRMS JurisVPD CR20201001 CA0197300VPDCERDA,EUGENIO/FLORES,TERESA*3114:24:5115:19:3414:57:10202006121582828 S ALAMEDA, VERNON140SOOFER14:25:0706/24/2020SUPVPDCERDA,EUGENIO/FLORES,TERESA*3115:19:4515:48:3215:39:08202006121594037 BANDINI BL, VERNON487RBAKER COMMODITIES14:54:2206/24/2020RPTRPTDepartmentOCA NumberRMS JurisVPD CR20201002 CA0197300VPDVALENZUELA,FERNANDO*32E15:18:49 15:19:0016:23:0415:39:10202006121645610 ALCOA AV, VERNONPATCK17:42:2806/24/20201015RPTDepartmentOCA NumberRMS JurisVPD CR20201003 CA0197300VPDSTEVENSON,KENT,JR/FLORES,TERESA*2218:41:2917:42:28VPDVALENZUELA,FERNANDO32E17:46:0818:37:5317:51:55* Denotes Primary Unit2Page of 206/25/202001:43:08 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/25/202006/25/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene20200612181710 FWY // FLORAL, VERNONLOCATECHP-ELA05:12:2306/25/2020VRECVPDRECORDS BUREAU*RECD05:24:4605:12:59202006121824489 BANDINI BL, VERNON487RBAKERY DEPO05:35:5606/25/2020RPTDepartmentOCA NumberRMS JurisVPD CR20201004 CA0197300VPDSTEVENSON,KENT,JR*22E05:38:39 05:38:4005:44:00 06:26:3805:48:04VPDCERDA,PAUL,JR41W05:38:4906:26:3805:43:58202006121943737 S SOTO, VERNON901TMCDONALD`S09:28:0006/25/2020RPTDepartmentOCA NumberRMS JurisVPD CR20201005 CA0197300VPDCERDA,EUGENIO/ARANA,ANDRE*32W09:30:06 09:30:2510:43:4409:33:3620200612199680 MOULTON ST, LOS ANGELESLOCATE12:27:4806/25/2020VRECVPDDISPATCH*DISP12:45:3312:29:25202006122014420 SEVILLE AV, VERNONGTAREL CAMINO REAL FOODS13:10:5206/25/2020RPTDepartmentOCA NumberRMS JurisVPD CR20201006 CA0197300VPDZOZAYA,OSCAR/FLORES,TERESA*40E13:16:26 13:16:2713:18:1313:16:41VPDCERDA,EUGENIO/ARANA,ANDRE32W14:29:5513:18:12* Denotes Primary Unit1Page of 106/26/202005:31:15 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/26/202006/26/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene202006122232600 E 28TH, VERNONGTARESMERALDA01:14:3906/26/2020RPTDepartmentOCA NumberRMS JurisVPD CR20201007 CA0197300VPDVALENZUELA,FERNANDO*31W01:22:10 01:22:3203:00:2901:29:4120200612224FRUITLAND AV // PACIFIC BL, VERNONVCK01:42:4606/26/2020RPTVSVRECDepartmentOCA NumberRMS JurisVPD CR20201008 CA0197300VPDHERRERA,GUSTAVO*S602:33:0001:42:46VPDLUCAS,JASON22E01:43:1703:00:1801:44:50VPDCERDA,PAUL,JR4103:00:2001:46:52MR C TOWMR C TO02:08:54 02:08:5503:00:2102:19:442020061222910 FRWY // VINCENT, VERNONLOCATECHP BALDWIN PARK04:54:4206/26/2020VRECVPDRECORDS BUREAU*RECD05:04:4605:04:35202006122382602 E 37TH, VERNON594RWEST COAST DIST07:18:5206/26/2020RPTDepartmentOCA NumberRMS JurisVPD CR20201009 CA0197300VPDDOCHERTY,MICHAEL*43W07:23:03 07:23:0307:48:0807:32:4520200612239E 16TH ST // ESPERANZA ST, LOS ANGELESLOCATE08:04:0906/26/2020VRECVPDDISPATCH*DISP08:49:0008:11:14202006122422164 E 25TH, VERNON484RJUCO INC09:09:2306/26/2020RPTDepartmentOCA NumberRMS JurisVPD CR20201010 CA0197300VPDNEWTON,TODD/ARANA,ANDRE*3209:13:04 09:13:0509:53:2709:23:281Page of 306/27/202000:25:04 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/26/202006/26/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene202006122443200 FRUITLAND AV, VERNON459RR PLANT EARTH09:42:2306/26/2020RPTDepartmentOCA NumberRMS JurisVPD CR20201011 CA0197300VPDCERDA,EUGENIO*40E09:44:10 09:44:1510:03:0709:53:40VPDNEWTON,TODD/ARANA,ANDRE3210:03:02 10:58:0009:59:49202006122464697 E 48TH, VERNONGTARUSA10:03:2106/26/2020RPTDepartmentOCA NumberRMS JurisVPD CR20201012 CA0197300VPDCERDA,EUGENIO*40E10:08:15 10:08:1610:43:0610:08:3220200612258BANDINI BL // SOTO, VERNON902TJOSE CRISTINO13:22:1306/26/2020RPTDepartmentOCA NumberRMS JurisVPD CR20201013 CA0197300VPDCERDA,EUGENIO*40E13:23:56 13:23:5714:42:3813:26:05202006122655107 S DISTRICT BL, VERNON459VRUNKNOWN17:34:5306/26/2020RPTDepartmentOCA NumberRMS JurisVPD CR20201014 CA0197300VPDCERDA,EUGENIO*40E17:37:09 17:37:0918:35:3817:37:33202006122662537 E 27TH ST, VERNON20002RRELIANCE STEEL17:56:0506/26/2020RPTDepartmentOCA NumberRMS JurisVPD CR20201015 CA0197300VPDDOCHERTY,MICHAEL*43W18:02:02 18:02:0418:49:1418:02:0520200612267LUGOT ST // S SOTO ST, LOS ANGELESLOCATE18:06:4506/26/2020VRECVPDDISPATCH*DISP18:49:3118:08:31202006122725275 S DISTRICT BL, VERNON484MAKESPACE18:54:1306/26/2020RPTDepartmentOCA NumberRMS JurisVPD CR20201016 CA01973002Page of 306/27/202000:25:04 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/26/202006/26/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene202006122725275 S DISTRICT BL, VERNON484MAKESPACE18:54:1306/26/2020RPTDepartmentOCA NumberRMS JurisVPD CR20201016 CA0197300VPD*2618:56:48 18:56:4919:34:4019:10:03VPD20W18:56:57 18:56:5919:01:34* Denotes Primary Unit3Page of 306/27/202000:25:04 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/27/202006/27/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene20200612297E VERNON AV // HAWTHORNE AV, VERNON20001UNK02:11:1606/27/2020RPTDepartmentOCA NumberRMS JurisVPD CR20201017 CA0197300VPDMANNINO,NICHOLAS*20W02:11:5005:50:2102:12:32VPDLUCAS,JASON2602:11:5504:18:2202:12:43VPDGODOY,RAYMOND38E03:43:0102:14:03VPDHERNANDEZ,EDWARD5D3205:43:4604:28:55VPDVELEZ,MARISSA5D3405:43:4404:28:55VPDESTRADA,IGNACIOS302:14:1205:50:2202:18:0520200612298S SOTO // BANDINI BL, VERNON902TRUSS02:43:5006/27/2020ORVSRPTDepartmentOCA NumberRMS JurisVPD CR20201018 CA0197300VPDLUCAS,JASON*2602:44:39 02:44:4003:45:1002:48:43USTOWUS TOW03:14:03 03:14:0303:45:0603:20:0920200612300E VERNON AV // HAWTHORNE AV, VERNONTRAFFIC STOP03:42:5906/27/20201015VIRPTDepartmentOCA NumberRMS JurisVPD CR20201019 CA0197300VPDGODOY,RAYMOND*38E05:41:4803:43:02VPDLUCAS,JASON2604:18:2205:00:1204:21:52VPDHERNANDEZ,EDWARD5D3205:40:1004:28:58VPDVELEZ,MARISSA5D3405:40:0504:28:55MR C TOWMR C TO03:49:23 03:49:2404:56:3104:03:05202006123162833 LEONIS BL, VERNON S/A 208459RHG USA09:02:2106/27/20201015RPTDepartmentOCA NumberRMS JurisVPD CR20201020 CA0197300VPDREDONA,BRYAN*31E09:03:47 09:03:5311:11:4809:13:25VPDNEWTON,TODD/ARANA,ANDRE3209:05:3812:38:1109:07:28VPDDOCHERTY,MICHAEL43W09:03:49 09:03:5410:20:2109:06:38VPDHERNANDEZ,EDWARD5D3209:58:4811:12:5210:03:371Page of 306/28/202000:13:57 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/27/202006/27/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene202006123162833 LEONIS BL, VERNON S/A 208459RHG USA09:02:2106/27/20201015RPTDepartmentOCA NumberRMS JurisVPD CR20201020 CA0197300VPDVELEZ,MARISSA5D3409:58:5011:12:5410:03:39VPDSANTOS,DANIELS209:12:4811:11:4909:36:48202006123182916 S SANTA FE AV, VERNON594RFARHAN ENTERPRISES09:21:4906/27/2020RPTDepartmentOCA NumberRMS JurisVPD CR20201021 CA0197300VPDDOCHERTY,MICHAEL*43W10:20:22 10:20:2311:22:4110:34:47202006123245005 E SLAUSON AV, VERNON594RBLACKSTEIN INDUSTRIAL ELECTRICAL13:07:2906/27/2020RPTDepartmentOCA NumberRMS JurisVPD CR20201022 CA0197300VPDREDONA,BRYAN*31E13:09:01 13:09:0213:37:1413:16:5120200612331S SANTA FE AV // VERNON AV, VERNON920PRVERNON POLICE DEPT15:16:3606/27/2020RPTDepartmentOCA NumberRMS JurisVPD CR20201023 CA0197300VPDDOCHERTY,MICHAEL*43W15:18:51 15:18:5215:54:3015:26:00202006123324329 BANDINI BL, VERNON273.5PADDED WAGON OF CALIFORNIA THE16:17:3106/27/2020RPTDepartmentOCA NumberRMS JurisVPD CR20201024 CA0197300VPDREDONA,BRYAN*31E16:18:22 16:18:5317:39:1016:25:05VPDNEWTON,TODD/ARANA,ANDRE3216:18:23 16:18:5516:38:3216:32:28VPDDOCHERTY,MICHAEL43W16:18:25 16:18:5618:25:2116:22:57202006123334444 AYERS AV, VERNON459RLA CURACAO16:27:5706/27/2020RPTDepartmentOCA NumberRMS JurisVPD CR20201025 CA0197300VPDNEWTON,TODD/ARANA,ANDRE*3216:40:30 16:40:3217:17:4016:44:16202006123442Page of 306/28/202000:13:57 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/27/202006/27/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene202006123442234 WILMA AVE, COMMERCEDET19:42:4106/27/20201098VRECVPDESCOBEDO,ALEXY*5D3319:42:4622:05:0319:55:53VPDREYNA,JOSE S5D2319:43:1422:05:0319:55:55202006123562601 S SOTO, VERNONPATCK22:30:5706/27/2020RPTDepartmentOCA NumberRMS JurisVPD CR20201026 CA0197300VPDESTRADA,IGNACIO*S322:30:5723:53:1522:34:33VPDMANNINO,NICHOLAS20W22:31:1923:53:1522:32:33VPDMADRIGAL,ALFONSO2622:31:2123:28:5122:41:02VPDGODOY,RAYMOND38E22:31:2222:36:0222:34:30* Denotes Primary Unit3Page of 306/28/202000:13:57 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/28/202006/28/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene20200612362E 46TH // SOTO, VERNONVCK01:07:3506/28/2020VSRPTDepartmentOCA NumberRMS JurisVPD CR20201027 CA0197300VPDMADRIGAL,ALFONSO*2601:39:5901:07:35USTOWUS TOW01:21:12 01:21:1201:40:0001:32:26202006123944305 S SANTA FE AV, VERNONSUICIDAL SUBKYLE23:14:5406/28/2020RPTDepartmentOCA NumberRMS JurisVPD CR20201028 CA0197300VPDVILLEGAS,RICHARD*26W23:16:27 23:18:49VPDMANNINO,NICHOLAS20E23:43:0623:20:32VPDGODOY,RAYMOND3823:16:2923:43:0823:18:50* Denotes Primary Unit1Page of 106/29/202000:23:03 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/29/202006/29/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene202006124082800 E 50TH, VERNON459RAMERICAN INTEGRATED SERVICES05:58:3006/29/2020RPTDepartmentOCA NumberRMS JurisVPD CR20201029 CA0197300VPDVILLEGAS,RICHARD*26W06:01:13 06:01:1306:43:1506:07:20VPDGODOY,RAYMOND3806:43:1606:15:55202006124132265 E 38TH, VERNONGTARBC2 INVIRONMENTAL07:16:1106/29/2020RPTDepartmentOCA NumberRMS JurisVPD CR20201030 CA0197300VPDOURIQUE,CARLOS/SALDANA,CARLOS*32W07:31:16 07:32:1008:01:5307:35:47202006124142229 E 38TH, VERNON459RREBUILT METALIZING07:48:2206/29/2020RPTDepartmentOCA NumberRMS JurisVPD CR20201032 CA0197300VPDOURIQUE,CARLOS/SALDANA,CARLOS*32W08:09:3608:34:2308:13:35202006124152265 E 38TH, VERNON487RBC2 INVIRONMENTAL07:55:2106/29/2020RPTDepartmentOCA NumberRMS JurisVPD CR20201031 CA0197300VPDOURIQUE,CARLOS/SALDANA,CARLOS*32W08:09:3308:02:0020200612416LEONIS BL // BOYLE AV, VERNON902TKIARA08:05:2506/29/2020RPTDepartmentOCA NumberRMS JurisVPD CR20201033 CA0197300VPDCAM,PATRICK*40E08:05:42 08:06:1808:55:3808:09:20202006124194444 AYERS AV, VERNONGTARUNK08:48:2606/29/2020RPTDepartmentOCA NumberRMS JurisVPD CR20201034 CA0197300VPDOURIQUE,CARLOS/SALDANA,CARLOS*32W09:27:5508:49:46202006124282115 E 27TH, VERNONGTARMYSTEREE11:28:0706/29/2020RPTDepartmentOCA NumberRMS JurisVPD CR20201035 CA01973001Page of 206/30/202004:52:16 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/29/202006/29/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene202006124282115 E 27TH, VERNONGTARMYSTEREE11:28:0706/29/2020RPTDepartmentOCA NumberRMS JurisVPD CR20201035 CA0197300VPDOURIQUE,CARLOS/SALDANA,CARLOS*32W12:25:4011:29:4820200612443E 49TH // CORONA AV, VERNON211RLASO19:58:1806/29/2020RPTDepartmentOCA NumberRMS JurisVPD CR20201036 CA0197300VPDVASQUEZ,LUIS*40E20:00:0120:28:1320:03:1520200612445FRUITLAND AV // LOMA VISTA AV, VERNONLOCATECITYWIDE TOW20:56:2306/29/2020VRECVPDRECORDS BUREAU*RECD21:32:1821:02:57* Denotes Primary Unit2Page of 206/30/202004:52:16 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/30/202006/30/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene202006124642150 E 37TH, VERNON487RBENDER CCP07:11:1206/30/2020RPTDepartmentOCA NumberRMS JurisVPD CR20201037 CA0197300VPDRAMOS,JOSE*40W07:13:18 07:13:3007:15:14VPDOURIQUE,CARLOS/SALDANA,CARLOS3207:14:5608:06:5807:16:35202006124661980 E 25TH, VERNON459RJL APPAREL07:45:2006/30/2020RPTDepartmentOCA NumberRMS JurisVPD CR20201038 CA0197300VPDRAMOS,JOSE*40W07:47:54 07:52:0709:18:3407:57:54202006124724505 BANDINI BL, VERNON487RCLASSIC CONCEPTS09:50:4706/30/2020RPTDepartmentOCA NumberRMS JurisVPD CR20201039 CA0197300VPDSTEVENSON,KENT,JR*22E09:52:48 09:52:4909:53:13VPDOURIQUE,CARLOS/SALDANA,CARLOS3209:53:1211:03:3810:01:55202006124732939 S SUNOL DR, VERNON487RGREENLAND FOODS10:00:2706/30/2020RPTDepartmentOCA NumberRMS JurisVPD CR20201040 CA0197300VPDSTEVENSON,KENT,JR*22E10:01:59 10:02:3610:52:5910:10:09202006124832230 E 38TH, VERNONREPOHANNIBAL13:18:2606/30/2020REPODepartmentOCA NumberRMS JurisVPD CR20201041 CA0197300VPDRECORDS BUREAU*RECD14:35:0313:20:24202006124842335 E 27TH, VERNONFOUNDJP IMPORT13:22:3506/30/2020RPTDepartmentOCA NumberRMS JurisVPD CR20201042 CA0197300VPDRAMOS,JOSE*40W13:27:37 13:27:4914:06:2513:44:58202006124851Page of 207/01/202000:28:08 VERNON POLICE DEPARTMENTCall Log Report Type All Unit Times and Location with OCA'sJurisdiction:First Date:Last Date:06/30/202006/30/2020Call Number DispTenCodeCaller AddressOfficerUnitDepUnit Time DispatchEnrouteDepartArriveRemoveCompVERNONReceivedComplaint OnScene202006124854560 LOMA VISTA AV, VERNON487RPARAMOUNT EXPORT13:31:3906/30/2020RPT32DepartmentOCA NumberRMS JurisVPD CR20201043 CA0197300VPDOURIQUE,CARLOS/SALDANA,CARLOS*3213:35:5715:50:2714:30:04202006124954200 S ALAMEDA, VERNON2000218:32:2506/30/20201015RPTORDepartmentOCA NumberRMS JurisVPD CR20201044 CA0197300VPDOURIQUE,CARLOS/SALDANA,CARLOS*3219:17:5918:32:25VPDSTEVENSON,KENT,JR22E18:32:32 18:33:1219:32:1218:46:23VPDVASQUEZ,LUIS31W18:33:2419:32:1218:35:28VPD40E19:23:0918:42:02VPD4118:38:51 19:32:1218:35:51VPDONOPA,DANIELS719:30:4218:36:33202006124962570 E 25TH, VERNON484RPROFESSIONAL PRODUCE18:37:4406/30/2020RPTDepartmentOCA NumberRMS JurisVPD CR20201045 CA0197300VPDSWINFORD,PHILLIP*4119:37:29 19:37:3020:13:2219:39:31VPDVASQUEZ,LUIS31W20:13:2019:46:57* Denotes Primary Unit2Page of 207/01/202000:28:08 City Council Agenda Item Report Agenda Item No. COV-311-2020 Submitted by: Cynthia Cano Submitting Department: Public Works Meeting Date: September 1, 2020 SUBJECT Public Works Monthly Building Report Recommendation: Receive and file the July 2020 Building Report. Background: The attached building report consists of total issued permits, major projects, demolition permits, new building permits and certificate of occupancy status reports for the month of July 2020. The value of permitted construction in Vernon for the period from January through July 2020 was 69% lower than for the same period in 2019. On a positive note, this is a monthly first period over period increase in the trend since January. The reduction in construction is likely due to the the economic uncertainty caused by the erosion of international trade and by the decrease in economic activity caused by the response to the COVID-19 pandemic. Staff will continue to monitor activity level as as the economy reopens. Fiscal Impact: The decrease in the value of permitted construction directly impacts the fee revenues received by the Department. The decreased revenues for FY 2019-2020 were offset by other general fund revenue sources that were collected at or slightly above expectations. In anticipation of the reduced activity and COVID-19 implications, revenue adjustments were made to the FY 2020-2021 budget. Attachments: 1. Public Works Department July 2020 Building Report Construction Value Number of Permits Year to Date Value Year to Date Permits Construction Value Number of Permits Year to Date Value Year to Date Permits Permit Difference Valuation Difference January 6,968,160$ 49 6,968,160$ 49 8,046,145$ 43 8,046,145$ 43 -12%15% February 4,923,135$ 63 11,891,295$ 112 2,979,923$ 48 11,026,068$ 91 -19%-7% March 10,949,664$ 47 22,840,960$ 159 2,808,127$ 16 13,834,195$ 107 -33%-39% April 13,285,075$ 56 36,126,035$ 215 1,100,252$ 10 14,934,447$ 117 -46%-59% May 21,264,283$ 43 57,390,317$ 258 1,134,292$ 14 16,068,739$ 121 -53%-72% June 12,186,470$ 67 69,576,787$ 325 3,485,709$ 55 19,554,448$ 186 -43%-72% July 3,301,660$ 53 72,878,447$ 378 3,305,183$ 29 22,859,631$ 215 -43%-69% August September October November December 2019 2020 Year to Date Monthly Report Summary City of Vernon Building Division 0 10 20 30 40 50 60 70 80 $- $5,000,000 $10,000,000 $15,000,000 $20,000,000 $25,000,000 Monthly 2019 Construction Value 2020 Construction Value 2019 Number of Permits 2020 Number of Permits 0 50 100 150 200 250 300 350 400 $- $10,000,000 $20,000,000 $30,000,000 $40,000,000 $50,000,000 $60,000,000 $70,000,000 $80,000,000 Year to Date 2019 Year to Date Value 2020 Year to Date Value 2019 Year to Date Permits 2020 Year to Date Permits City of Vernon Building Department Monthly Report from 7l'112020 lo 713112020 Type Value # of Permits Electrical lndustrial - Addition lndustrial - Remodel Mechanical Miscellaneous Plumbing $1 ,152,141 .00 $37,500.00 $1 ,076,319.00 $802,223.00 $228,000.00 $9,000 00 15 1 2 4 5 2 July 2020 TOTALS PER[/lTS: PREVIOUS MONTHS TOTAL YEAR TO OATE TOTAL July 2019 TOTALS PERMITS: PREVIOUS IVIONTHS TOTAL PRIOR YEAR TO DATE TOTAL $22,859,631.00 $3,301,660.00 $69,576,787.38 $3,305,183.00 $19,554,448.00 29 186 215 53 325 $72,878,447.38 378 City of Vernon Building Department New Buildings Report - July 2020 None City of Vernon Building Department Demolition Report - July 2020 None City of Vernon Building Department Maior Proiects from 7l1l2O2O to 7l31l2O2O Valuations > 20,000 Permit No Project Address Tenant Description Job Value Electrical 8-2020 4097 4623 MAYWOOD AVE APN 6304027015 4820 APN sOTH ST 6304011006 4328 ALCOA AVE APN 6303010038 2914 LEONIS BLVD APN 6303024017 2O5O 49TH ST APN 63080'15077 29,14 LEONIS BLVD APN 6303024017 6180 ALCOA AVE APN 6310027036 B-2020-3976 B-2020-4049 B-2020-4111 8-2020-4158 e-2020-4110 8-2020-3927 Sunny Cutwright Feezer cooler - Electrical Sushi Nozawa Electrical - install of (N) interior li9htin9, outlets, forklift charges and dock levelers replacement of incomang service to site, which was damaged in a fire. net utility service will match previous service. new overhead service drop by utility and new switchgear will be installed new insulated freezer and blast lreezer Demolition of existing metal anopy, connect existing warehouse buildings with new metal building breezeway enclosure. 950 Sf replace cracked glulam beam, pulins and sub-purlins in a '1400 s.f area 200000 400000 56742 62000 23919 7 Record(s) lndustrial - Addition 8-2020-4046 4309 FRUITLAND AVE APN 6304023010 1 Record(s) lndustrial - Remodel B 2020-4148 2660 37TH St APN 6302020039 8-2020-3926 6,1E0 ALCOA AVE APN 63'10027036 $1,092,661.00 37500General Mills $37,500.00 76319 1000000New insulated freezer and blast lrcezet 2 Mechanical B-2020-3925 8-2020-4172 Record(s) 51OO BOYLE AVE APN 63030280't 4 $1,076,319.00 695000 48223 6180 ALCOA AVE APN 6310027036 4580 PACIFIC BLVD APN 6308005007 B-2019-3723 BHJ USA l\4echanical - cooler box refrigeration equipment 39000 New photo voltaic solar system to be installed on the roof of an industrial building. 200 KW AC renovations of existing shell structure that was damaged in a fire. Power and lighting provisions will be installed to support office and warehouse spaces. 2050 - 2100 49th st: install exterior light llxtures Refrigeration equipment and installation for new insuated freezer and blast freezer Replace (2) HVAC units like for like same location 50000 300000 3 Miscellaneous B-2020-4120 Record(s) 2730 37TH ST APN 6302020057 Record(s) FA/V B-20'19-3692 Cut new wall opening and install structural reinforcing in concrete wall Storage racks structural gantry crain system $782,223.0O 4 5000 '120000 40000 3055 BANDINI BLVD APN 6303002014 4820 sOTH ST APN 630401 1006 B-2019-3865 B-2020-4'150 3 $205,000.00 16 Permit(s)Total $3,193,703.00 2 City of Vernon Building Department Status of Certificates of Occupancy Requests Month of July 2020 Request for lnspection Approved Pending Temporary Occupancies 9 ,| 389 13 City of Vernon Certificate of Occupancy Applications Date From 7/1/2020 to 7/31/2020 Permit No. Project Address Description Tenant Square Feet Fees Paid Issued C-2020-1512 4625 49TH ST Emuna 10920 Warehousing and distribution of PPE supplies 1,770.00 6304018023 APN C-2020-1513 3688 SOTO ST HOPE Program 4800 Outpatient Mental Health Clinic 385.00 6303004039 APN C-2020-1514 3305 VERNON AVE DONGSUH INC 1066 Office use and wholesale food 385.00 6303006071 APN C-2020-1515 2424 28TH ST Red Flag Products 30930 Distribution of agriculture supplies and equipment 885.00 6302005007 APN C-2020-1516 2525 27TH ST Flamingo Fashion, Inc. 17600 Cutting and garment wholesale 885.00 6302003021 APN C-2020-1517 2646 DOWNEY RD Spicyman, Inc. 5000 Warehouse & wholesale of produce 385.00 5192025008 APN C-2020-1518 2425 38TH ST FEC Studios LLC 30800 Production studio 385.00 6302019022 APN C-2020-1519 2380 57TH ST Flow Cold Storage 55000 Warehousing packaged foods 1,046.00 6308019017 APN C-2020-1511 3015 LEONIS BLVD Yi Bao Produce Group, Inc 42360 Wholesale Produce & Cold Storage 0.00 6303021007 APN 198,476.00 Total for Certificate of Occupancy: 6,126.00 Total Fees Paid 6,126.00 Permits(s) 9 1 City of Vernon Certificate of Occupancy Issued Date From 7/1/2020 to 7/31/2020 Permit No. Project Address Description Tenant Square Feet Fees Paid Issued C-2020-1511 3015 LEONIS BLVD Yi Bao Produce Group, Inc 42360 Wholesale Produce & Cold Storage 0.00 7/2/2020 6303021007 APN 42,360.00 Total for Certificate of Occupancy: 0.00 Total Fees Paid 0.00 Permits(s) 1 1 City Council Agenda Item Report Agenda Item No. COV-295-2020 Submitted by: Diana Figueroa Submitting Department: City Administration Meeting Date: September 1, 2020 SUBJECT Fiscal Year 2019/2020 Vernon CommUNITY Fund Grant Committee Activity Report Recommendation: Receive and file the report, as it is being provided for informational purposes only. Background: As one of the key elements of the City’s good governance reforms, the City Council created the Vernon CommUNITY Fund (VCF) to provide grants to charitable and governmental entities for projects and programs that benefit those residing and working in Vernon. Given the exclusively industrial nature of Vernon, the City Council determined that the VCF was in the best interest of the City and its residents, businesses, and workers. On February 4, 2014, the City Council adopted Ordinance No. 1218, as amended by Ordinance Nos. 1238, 1257, and 1265 to establish the Vernon CommUNITY Fund Grant Committee (Grant Committee) and provide the basic guidelines and operational procedures for said Committee and its officers, including those related to the allocation of funds and the processes for reviewing and ranking applications and awarding grants. Fiscal Year 2019/2020 Funding Pursuant to Vernon Municipal Code Section 2.164, the City Council may appropriate funds to the VCF. Through the normal budgetary process, City Council authorized an amount of $500,000 to the VCF for fiscal year (FY) 2019/2020. Prior to the modifications set forth in Ordinance No. 1265, the Grant Committee was required to allocate funds for FY 2019/2020 in accordance with the following formula: 1) Administrative Costs shall be determined for the fiscal year and the amount shall be allocated for payment from funds appropriated to the VCF. 2) After Administrative Costs, no less than 25% of funds available in any fiscal year shall be awarded to proposals to expend funds on capital projects with a projected useful life of 10 years or more (capital project grants were eliminated by Ordinance No. 1265 and shall no longer be available for FY 2020/2021, or in subsequent years). 3) The remainder of available funds in any fiscal year may be awarded to proposals to expend funds on direct services and/or scholarship grants. No single grant of this type shall be in an amount more than $250,000. Service Grant Awards The Grant Committee held three grant award meetings during the 2019/2020 Fiscal Year. There were three separate grant dockets, with a combined total of eight (8) Service Grant Awards approved for FY 2019/2020. All grantees and their awarded amounts are listed in the attached table. The total amount awarded for Direct Service Grants was $224,125. Capital Grant Awards The Committee adopted a Capital Grants Program on May 18, 2016 which defined, among other things, the parameters of the capital award process and procedures for applicants, and criteria and timeline for awards. For FY 2019/2020, the City’s VCF capital project allocation of 25% equated to $81,375 which was expended in FY 2019/2020 to benefit three (3) separate capital grant projects in the Vernon Area. Moving forward, the VCF will no longer grant funds for capital projects, as it was determined that the administration of such grants was cumbersome and costly, and is not aligned with the goals of the Grant Committee to streamline expenses for administrative management. Scholarship Grant Awards At its November 8, 2017 meeting, the VCF Grant Committee agreed to proceed with a VCF Pilot Scholarship Program for FY 2018/2019. In response to its successful inaugural year as a pilot program, the Grant Committee approved an allocation in the amount of $20,000 toward the VCF Scholarship Program in FY 2019/2020 as well. As such, the Grant Committee awarded $20,000 in scholarship grants to a total of eight (8) high school seniors from the Vernon Area at its May 20, 2020 Grant Committee meeting. Related Administrative Expenditures In June of 2020, the City issued a Request for Proposals (RFP) for Administrative Management of Vernon CommUNITY Fund Grant Activities. After a thorough evaluation of respondents’ proposals, Jemmott Rollins Group, Inc. (JRG) was awarded a three (3) year contract with the City to provide administrative management for the VCF with an effective date of August 1, 2020. JRG has extensive experience in non-profit grant-making and grants management and specialized knowledge of ethics and principles governing the grant-making process. During FY 2019/2020, JRG was instrumental in the City’s ability to accept applications, evaluate submissions and, ultimately, award 19 grants with a grand total value of $325,500. The total budgeted cost for their services in FY 2019/2020 was $174,500. For FY 2020/2021, administrative management services for Vernon CommUNITY Fund Grant Committee activities have been reduced to $106,675 (a yearly reduction of $67,825) and will continue to be paid from the Vernon CommUNITY Fund monetary allocation. A $500,000 VCF allocation was approved by City Council during the adoption of a Citywide budget for FY 2020/2021. VCF Direct Service Grants amounting to approximately $373,325 will be awarded at the November 2020 Grant Committee meeting and VCF Scholarship Grants totaling $20,000 will be awarded in May of 2021. The number of grantees and amounts awarded will depend upon the pool of applicants, their proposed projects, and/or funds available. Fiscal Impact: There is no fiscal impact associated with this report. Attachments: 1. FY 2019/2020 Grantee Awards List Vernon CommUNITY Fund Grant Awardees for FY 2019/2020 Grantee Docket # Amount Awarded Direct Service Grants Jovenes, Inc. I $25,000 Neighborhood Music School Association I $25,000 Southeast Community Foundation I $25,000 Boyle Heights Youth Football II $14,400 Libros Schmibros II $15,000 LA Family Housing II $45,000 Inclusive Action for the City III $34,725 YMCA of Metropolitan Los Angeles (Rio Vista) III $40,000 Subtotal Direct Service Grants ALL $224,125 Capital Grants Los Angeles Music and Art School III $31,600 Southeast Community Foundation III $25,000 Mark Taper Foundation Shelter III $24,775 Subtotal Capital Grants ALL $81,375 Scholarship Grants Applicant #6 Mariela Barrales III $2,000 Applicant #8 Angelica Garcia III $2,000 Applicant #2 Daniel Gonzalez III $3,000 Applicant #4 Britney Juarez III $2,000 Applicant #3 Sara Lopez III $3,000 Applicant #1 Arely Ordonez III $3,000 Applicant #7 Samantha Tamayo III $2,000 Applicant #5 Citlaly Zazueta III $3,000 Subtotal Scholarship Grants ALL $20,000 GRAND TOTAL GRANT AWARDS 19 IN ALL CATEGORIES $325,500 City Council Agenda Item Report Agenda Item No. COV-293-2020 Submitted by: Brandon Gray Submitting Department: Police Department Meeting Date: September 1, 2020 SUBJECT Office of Traffic Safety Selective Traffic Enforcement Program (STEP) Grant Agreement Recommendation: Approve and authorize the City Administrator, Police Chief, and Police Sergeant to execute an agreement between the City of Vernon and the Office of Traffic Safety, in substantially the same form as submitted for a one (1) year term, for participation in the Selective Traffic Enforcement Program (STEP) with an effective date of October 1, 2020. Background: The Vernon Police Department (VPD) has been granted a grant through the Office of Traffic Safety to participate in a Selective Traffic Enforcement Program (STEP). The goals of the program include the following: reduce the number of persons killed and/or injured in traffic collisions; reduce the number of persons killed and/or injured in DUI related collisions; and raise public awareness about DUI enforcement activities in the Los Angeles County region. In order to accomplish the goals of the program, participating agencies will be required to take part in various enforcement activities which include saturation patrol details, motorcycle safety enforcement, distracted driving enforcement, pedestrian and bicycle enforcement, and DUI checkpoints. VPD staff will coordinate enforcement activities as required on an overtime basis. The VPD will receive reimbursement for a majority of the overtime related costs (benefits calculated at 1.45%). The VPD has participated in this program for a number of years and has been successful attaining the goals specified. To participate in the program, law enforcement agencies are required to sign an agreement to receive reimbursement for personnel overtime costs. Reimbursements will be made within 90 days of receipt of an invoice, activity log, and quarterly traffic collision reports. The term of this agreement shall remain in effect until September 30, 2021. The City Attorney's Office has reviewed and approved the proposed agreement as to form. Fiscal Impact: There are sufficient overtime funds in the FY2020-2021 VPD budget for participation in STEP. The projected overtime reimbursement for VPD's annual participation is approximately $110,000. Attachments: 1. Office of Traffic Safety STEP Grant Agreement State of California - Oftice of Traffic Safety GRANT AGREEMENT GRANT NUMBER PT2',t073 1.GRANT TITLE Selective Traffic Enforcement Program (STEP) 2. NAME OF AGENCY Vernon 3. Grant Period From: 1Ol0'112020 To: O9130120214.AGENcY UNIT To ADMINISTER GRANT Vernon Police Department 5. GRANT DESCRIPTIoN Best practice strategies will be conducted to reduce the number of persons killed and injured in crashes involving alcohol and other primary crash factors. The funded strategies may include impaired driving enforcement, enforcement operations focusing on primary crash factors, distracted driving, night{ime seat belt enforcement, special enforcement operations encouraging motorcycle safety, enforcement and public awareness in areas with a high number of bicycle and pedestrian crashes, and educational programs. These strateqies are desiqned to earn media attention thus enhancinq the overall deterrent effect. 6. Federal Funds Allocated UnderThis Agreement Shall Not Exceed: $110,000.00 7. TERMS AND CONDITIONS: The parties agree to comply with the terms and conditions of the following which are by this reference made a part of the Agreement:. Schedule A - Problem Statement, Goals and Objectives and Method of Procedure. Schedule B - Detailed Budget Estimate and Sub-Budget Estimate (if applicable). Schedule B-1 - Budget Narrative and Sub-Budget Narrative (if applicable). Exhibit A - Certifications and Assurances. Exhibit B' - OTS Grant Program Manual. Exhibit C - Grant Electronic Management System (GEMS) Access "ltems shown with an asterisk (*), are hereby incorporated by reference and made a part of this agreement as if attached hereto. These documents can be vlewed at the OTS home web page under Grants: !44ry.p199e.9.9y. We, the officials named below, hereby swear under penalty of perjury under the laws of the State of California that we are duly authorized to legally bind the Grant recipient to the above described Grant terms and conditions. lN WITNESS WHEREOF, this Agreement has been executed by the parties hereto. 8. Approval Siqnatures A. GRANT DIRECToR NAME; Gustavo Herrera TITLE: Sergeant EMA|L: gherrera@covpd.org PHoNE: (323)587-5'17'l ADDRESS: 4305 Santa Fe Ave Vernon, CA 90058 (Signature) C. FrscAL oFFrcrAL ADDRESS: AnthonyMiranda Chief of Police amiranda@covpd.org (323) 583-8811 ext 114 4305 Santa Fe Ave Vemon. CA 90058 (Date) (Signature)(Date) B. AurHoRrzrNGoFFrcrAL ADDRESS: CarlosFandino City Administrator cfandino@ci.vemon.ca.us (323) 583-8811 4305 S. Santa Fe Avenue Vernon, CA 90058-1714 (Signature)(Date) D. AurHoRrzrNG OFFTCTAL oF oFFrcE oF TRAFFTc SAFETY ADDRESS: BarbaraRooney Direclor barbara.rooney@ots.ca.gov (916) 509-3030 2208 Kausen Drive Suite 300 Elk Grove, CA 95758 (Signature)(Date) 7l21l2O2O 1 1 :1 3:46 AM Page I of 17 E. AccouNTrNG OF OFFICE OF TRAFFIC SAFETY 9. DUNS INFORUATIoN DUNS#: 060883022 REGISTERED ADDRESS: 4305 S. Santa Fe Avenue CrrY: Vemon ZtP+4: 90058-1714 NAME: Carolyn Vu AooRESS: 2208 Kausen Drive. Suite 300 Elk Grove, CA 95758 10. PROJECTED EXPENDITURES FUND CFDA ITEM/APPROPRIATION F.Y.CHAPTER STATUTE PROJECTED EXPENDITURES '164 AL-21 20.608 0521-0890-101 2020 2020 BN20 $90,000 00 402PT-21 20.600 0521-0890-101 2020 2020 BNzO $20,000.00 AGREEMENT TOTAL $110,000.00 AMOUNT ENCUMBERED BY THIS DOCUMENT $110,000.00I CERTIFY upon my own personal knowledge that the budgeted funds for the cunent budget year are available for the period and purpose of the expenditure stated above. PRIOR AMOUNT ENCUMBERED FOR THIS AGREEMENT $ 0.00 OTS ACCOUNTING OFFICER'S SIGNATURE DATE SIGNED TOTAL AMOUNT ENCUMBERED TO DATE $110,000.00 7l21l2O2O 11:13:46 AM Page 2 of 17 State of California - Office of Traffic Safety GRANT AGREEMENT Schedule A GMNT NUMBER PT21073 1. PROBLEM STATEIUIENT The City of Vernon will use grant funds for enforcement efforts to target DUI drivers, as well as those who commit other violations (speed, distracted driving, turning/yielding violations, etc.) that may contribute to traffic collisions. Our mission would continue to be simple in concept: continue to educate the public about the dangers and consequences of DUI divers, and reduce traffic collisions and in doing so, reduce injuries and deaths associated to such collisions. The City of Vernon Public Works Traffic Engineering Division conducted afaffic Collision Review Report in 2014. lncluded in the report are the most frequent locations of traffic collisions and a list of the top primary collision factors. Current statistics (refer to Traffic Data Summary below) from 2017 -2019 indicate the top primary collision factors have remained the same. ln examining the OTS Collision Rankings for 2017, we have also identified the below problem areas that we recognize and need to be addressed. As a part of the Group G, the City of Vernon had the following rankings: Total Fatal and lnjury: 1112 Alcohol lnvolved: 1112 Had Been Drinking Driver < 21: 1112 Had Been Drinking Driver 21-34: 1112Motorcycles: 1112Pedestrians: 2112Bicyclists: 1112Composite. '1112 Speed Related: 1112 Nighttime (9pm-2:59am): 1112 Hit and Run: 1112 With the assistance and activities a STEP grant offers our department, we will strive to reduce traffic collisions, therefore reducing injunes and deaths associated with traffic collisions. Our target population is not just limited to "infraction violators" andior "DUl suspects." The Vernon Police Department sincerely wants our entire community to know that traffic safety is a major priority to us- That is one of the reasons why the Press Release during the cycle of a grant is so important, because it communicates to the public that there is an emphasis and priority on traffic safety in our city. We intend to continue to drive home this message, through educational handouts at checkpoints and/or during routine public contacts. The following is a traffic data summary, including 2019 statistics: - 4 fatal collision with 1 victim (1 more than 2017,3 more than 2018 ). - 186 injury collisions with 260 victims (24 morc collisions lhan 2017, and 2 more than 2018). - 6 alcohol involved collisions with injuries (1 less than 2017, and 2 less than 2018), with 1 fatality. - 10 pedestrians were injured in collisions (3 more than 2017, and 5 more than 2018), with no fatalities. - 11 were injured in collisions (5 less than 2017, and 1 more than 2018), with 1 PERFORMANCE MEASURES A. Goals: 1 . Reduce the number of persons killed in traffic crashes. 2. Reduce the number of persons injured in traffic crashes. 3. Reduce the number of pedestrians killed in traffic crashes. 4. Reduce the number of pedestrians inlured in traffic crashes. 5. Reduce the number of bicyclists killed in traffic crashes. 6. Reduce the number of bicyclists injured in traffic crashes. 7. Reduce the number of persons killed in alcohol-involved crashes. 712112020 11:13:46 AM Page 3 of 17 8. Reduce the number of persons injured in alcohol-involved crashes. 9. Reduce the number of persons killed in drug-involved crashes. 10. Reduce the number of persons injured in drug-involved crashes. 11. Reduce the number of persons killed in alcohol/drug combo-involved crashes. 12. Reduce the number of persons injured in alcohol/drug combo-involved crashes. 1 3. Reduce the number of motorcyclists killed in traffic crashes. 14. Reduce the number of motorcyclists injured in traffic crashes. 15. Reduce hit & run fatal crashes. 16. Reduce hit & run injury crashes. 17. Reduce nighttime (2100 - 0259 hours) fatal crashes. 18. Reduce niqhttime (21OO - 0259 hours) iniurv crashes. B. 1. Objectives: lssue a press release announcing the kick-off of the grant by November 15. The kick-off press releases and media advisories, alerts, and materials must be emailed to the OTS Public lnformation Officer at pio@ots.ca.gov, and copied to your OTS Coordinator, for approval 14 days prior to the issuance date of the release. Target Number 1 Participate and report data (as required) in the following campaigns, National Walk to School Day, National Teen Driver Safety Week, NHTSA Winter Mobilization, National Distracted Driving Awareness Month, National Motorcycle Safety Month, National Bicycle Safety Month, National Click it or Ticket Mobilization, NHTSA Summer Mobilization, National Child Passenger Safety Week, and California's Pedestrian Safetv Month. 2.10 Develop (by December 31) and/or maintain a "HOT Sheet" program to notify patrol and traffic officers to be on the lookout for identified repeat DUI offenders with a suspended or revoked license as a result of DUI convictions. Updated HOT sheets should be distributed to patrol and traffic officers monthly. J,12 4. Send law enforcement personnel to the NHTSA Standardized Field Sobriety Testinq (SFST) (minimum 16 hours) PosT-certified training. 2 5. Send law enforcement personnel to the NHTSAAdvanced Roadside lmpaired Drivinq Enforcement (ARIDE) 16 hour POST-certified traininq. 2 6. Send law enforcement personnel to SFST lnstructor training.1 Conduct DUI/DL Checkpoints. A minimum of 1 checkpoint should be conducted during the NHTSA Winter Mobilization and 1 during the Summer Mobilization. To enhance the overall deterrent effect and promote high visibility, it is recommended the grantee issue an advance press release and conduct social media activity for each checkpoint. For combination DUI/DL checkpornts, departments should issue press releases that mention DL's will be checked at the DUUDL checkpoint. Signs for DUI/DL checkpoints should read "DUliDriver's License Checkpoint Ahead." OTS does not fund or support independent DL checkpoints. Only on an exception basis and with OTS pre-approval will OTS fund checkpoints that begin prior to 1800 hours. When possible, DUI/DL Checkpoint screeners should be DRE- or ARIDE-trained. 7. 8. Conduct DUI Saturation Patrol operation(s).6 9. Conduct Traffic Enforcement operation(s), including but not limited to, primary crash factor violations. 10 10. Conduct highly publicized Distracted Driving enforcement operation(s) targeting drivers usinq hand held cell phones and textinq. 3 11. Conduct highly publicized Motorcycle Safety enforcement operation(s) in areas or during events with a high number of motorcycle incidents or crashes resulting from unsafe speed, DUl, following too closely, unsafe lane changes, improper turning, and other primary crash factor violations by motorcyclists and other drivers. 2 12. Conduct highly publicized pedestrian and/or bicycle enforcement operation(s) in areas or during events with a high number of pedestrian and/or bicycle crashes resultinq from violations made by pedestrians, bicvclists, and drivers. 4 13. Conduct hiohly visible collaborative DUI Enforcement operations 2 14. Conduct highly visible collaborative Traffic Enforcement operations 2 712112020 11:13:46 AM Page 4 ol 17 3. METHoD oF PRoCEDURE A. Phase I - Proqram Preparation (1st Quarter of Grant Year). The Vemon Police Department will develop operational plans to implement the "best practice" strategies outlined in the objectives section.. All training needed to implement the program should be conducted this quarter.. All grant related purchases needed to implement the program should be made this quarter.. ln order to develop/maintain the "Hot Sheets," research will be conducted to identify the "worst of the worst" repeat DUI offenders with a suspended or revoked license as a result of DUI convictions. The Hot Sheets may include the driver's name, last known address, DOB, description, cunent license status, and the number of times suspended or revoked for DUl. Hot Sheets should be updated and distributed to traffic and patrol officers at least monthly.. lmplementation of the STEP grant activities will be accomplished by deploying personnel at high crash locations,Media Requirementso lssue a press release announcing the kick-off of the grant by November 15, but no earlierthan October'1. lf unable to meet the November 15 date, communicate reasons to your OTS Coordinator. The kick-off press releases and any related media advisories, alerts, and materials must be emailed for approval to the OTS Public lnformation Officer at pio@ots.ca.qov, and to vour OTS Coordinator. '14 davs orior to the issuance date of the release. Phase 2 - Prooram Ooerations (Throughout Grant Year)o The Vernon Police Department will work to create media opportunities throughout the grant period to call attention to the innovative program strategies and outcomes.Media Requirements. Send all granlrelated activity press releases, media advisories, alerts and general public materials to the OTS Public lnformation Officer (PlO) at pio@ots.ca.qov, with a copy to your OTS Coordinator. The following requirements are for grant-related activities and are different from those regarding any grant kick-off release or announcement.. lf an OTS-supplied, template-based press release is used, there is no need for pre-approval, however, the OTS PIO and Coordinator should be copied when at the same time as the release is distributed to the press.. lf an OTS-supplied template is not used, or is substantially changed, a draft press release shall be sent to the OTS PIO for approval. Optimum lead-time would be 10 days prior to the release distribution date, but should be no less than 5 working days priorto the release distribution date.. Press releases reporting the immediate and time-valued results of grant activities such as enforcement operations are exempt from the recommended advance approval process, but still should be copied to the OTS PIO and Coordinator when the release is distributed to the press.. Activities such as warrant or probation sweeps and court stings that could be compromised by advanced publicity are exempt from pre-publicity, but are encouraged to offer embargoed media coverage and to report the results.. Use the following standard language in all press, media, and printed materials: Funding for this program was provided by a grant from the California Office of Traffic Safety, through the National Highway Traffic Safety Administration.. Email the OTS PIO at oio@ots.ca.qov and copy your OTS Coordinator at least 30 days in advance, a short description of any significant granlrelated traffic safety event or program so OTS has sufficient notice to anange for attendance and/or participation in the event.. Submit a draft or rough-cut of all printed or recorded material (brochures, posters, scripts, artwork, trailer graphics, etc.) to the OTS PIO at pio@ots.ca.qov and copy your OTS Coordinator for approval 14 days prior to the production or duplication.. Space permitting, include the OTS logo, on grantfunded print materials; consult your OTS Coordinator for specifics and format-appropriate logos.. Contact the OTS PIO or your OTS Coordinator, sufficiently far enough in advance of need, for consultation when deviation from anv of the above reouirements miqht be B. C. Phase 3 - Data Collection & Reportinq (Throughout Grant Year) l. Prepare and submit invoice claims (due January 30, April 30, July 30, and October 30) 2. Prepare and submit Quarterly Performance Reports (QPR) (due January 30, April 30, July 30, and October 30). Collect and report quarterly, appropriate data that supports the proqress of qoals and obiectives. 712112020 11:13:46 AM Page 5 of 17 . Provide a brief list of activity conducted, procurement of grant-funded items, and significant media activities. lnclude status of grant-funded personnel, status of contracts, challenges, or special accomplishments.o Provide a brief summary of quarterly accomplishments and explanations for objectives not completed or plans for upcoming activities. and report statistical data relatinq to the qrant ooals and 4. METHoD oF EVALUATIoN Using the data compiled during the grant, the Grant Director will complete the "Final Evaluation" section in the fourthlfinal Quarterly Performance Report (QPR). The Final Evaluation should provide a brief summary of the grant's accomplishments, challenges and significant activities. This narrative should also include whether goals and objectives were met, exceeded, or an explanation of were not 5. ADMINISTRATIVESUPPoRT This program has full administrative support, and every effort will be made to continue the grant activities after grant conclusion. 7l21l2O2O 11:13:46 AM Page 6 of 17 State of California - Office of Traffic Safety GRANT AGREEMENT Schedule B GRANT NUMBER PT21073 FUND NUMBER CATALoG NUMBER (CFDA) FUND DEScRIPTIoN TOTAL Ai'OUNT 1644L-21 20 608 Minimum Penalties for Repeat Offenders for Driving While lntoxicated $90,000.00 402Pr-21 20 600 State and Community Highway Safety $20,000 00 CosT CATEGoRT'FI,'II D NUMBER UNrr CosT oR ITATE UNITs ToTAL CosT To GRANT A. PERSON\EL CoSTS Positions and Salaries Straisht Time $0.00 Overtime DUI/DL Checkpoints t 64AL-2t $7.800.00 )$39.000.00 DUI Saturation Patrols 161AL-2t $ l .400.00 6 $8.400.00 Col laborative DUI Enforcernent t64AL-21 $ | .450.00 )$2.900.00 Benefits OT @ I .45 %l64AL-2 I $50.300.00 I s729.00 Traffic Enforcement 402PT-21 $700.00 t0 $7.000.00 Distracted Driving 402PT-2t s700.00 s2. 100.00 Motorcycle Safety 402PT-2 I $700.00 )$ | .400.00 Pedestrian and Bicycle Enforcement l0lPT-21 $700.00 .l $2.800.00 Collaborative Traffic Enforcement .l02PT-21 s1.450.00 1 $2.900.00 Benefits OT la I .45oln 402PT -21 $ r 6.200.00 I $235.00 Category Sub-Total $67.464.00 B. TR-,{\,EL ExPENSf,S ln State Travel .l02PT-2 r $3.s65.00 I $3.565.00 $0.00 Category Sub-Total s3.565.00 C. CONTR{CTUAL SERVICES $0.00 Category Sub-Total $0.00 D. EQt IPU E\T DUI Trailer I 6,+,4L-2 I $3 5.000.00 I $35.000.00 Category Sub-Total $35.000.00 E. OTHER DIRECT COSTS DUI Checkpoint Supplies l6.1AL-2 I $3.97 r .00 I $3.97 r.00 Category Sub-Total s3.971.00 F. I\DTRECT CosTs $0.00 Category Sub-Total $0.00 GRANT TOTAL sl10,000.00 712112020 11:'13:46 AM Page 7 of 17 State of California - Office of Traffic Safety GRANT AGREEMENT Schedule B-'l GRANT NUMBER PT21073 BUDGET NARRATIVE PERSONNEL COSTS DUI/DL Checkpoints - Overtime for grant funded law enforcement operations conducted by appropriate department personnel. DUI Saturation Patrols - Overtime for grant funded law enforcement operations conducted by appropriate department personnel. Collaborative DUI Enforcement - Overtime for grant funded Collaborative DUI Enforcement operations conducted by appropriate department personnel Benefits OT @1.45 % - Benefits-Overtime @ 1.45% Traffic Enforcement - Overtime for grant funded law enforcement operations conducted by appropriate department personnel. Distracted Driving - Overtime for grant funded law enforcement operations conducted by appropriate department personnel. Motorcycle Safety - Overtime for grant funded law enforcement operalions conducted by appropriate department personnel. Pedestrian and Bicycle Enforcement - Overtime for grant funded law enforcement operations conducted by appropriate department personnel. Collaborative Traffic Enforcement - Overtime for grant funded Collaborative Traffic Enforcement operations conducted by appropriate department personnel Benefits OT @ 1.45Yo - Benefits-Overtime @ 1.45o/o TRAVEL EXPENSES ln State Travel - Costs are included for appropriate staff to attend conferences and training events supporting the grant goals and objectives and/or traffic safety. Local mileage for grant activities and meetings is included. Anticipated travel may include Lifesavers conference. All conferences, seminars or training not specifically identified in the Budget Narrative must be approved by OTS. All travel claimed must be at the agency approved rale. Per Diem may not be claimed for meals provided at conferences when registration fees are paid with OTS grant funds. CoNTRACTUAL SERVIcES EoUIPMENT DUI Trailer - Fully equipped trailer to transport DUI checkpoint supplies and to serve as a communication and command post during OTS operations. Costs may include the trailer, sales tax, delivery, installation costs, and other modifications and accessories or other items necessary to make the trailer usable for grant purposes, such as a generator, lighting, radio equipment, paint and graphics. The trailer cannot include any furniture or fixtures not affixed to the trailer. OTHER DIRECT CosTs DUI Checkpoint Supplies - On-scene supplies needed to conduct sobriety checkpoints. Costs may include 2S" traffic cones, MUTCD compliant traffic signs, MUTCD compliant high visibility vests (maximum of 10), traffic counters (maximum of 2), generator, gas for generators, lighting, reflective banners, electronic flares, PAS device supplies, heater, propane for heaters, fan, anti-fatigue mats, and canopies. Additional items may be purchased if approved by OTS. The cost of food and beveraqes will not be reimbursed. 712112020 11:13:46 AM Page 8 of 17 lNDtREcr Cosrs STATEMENTS/DISCLAIMERS Program lncome default statement: There will be no program income generated from this grant. Enforcement Grant Quota Disclaimer: Nothing in this "agreement" shall be interpreted as a requirement, formal or informal, that a particular law enforcement officer issue a specified or predetermined number of citations in pursuance of the goals and here under. 712112020 11:'13:46 AM Page 9 of 17 State of Califomia - Office of Traffic Safety GRANr Nu BER GRANT AGREEMENT Exhibir A PT21o73 CERTrFrcATroNs AND AssuRANcEs HIGHWAY SAFETY GRANTS 23 U.S.C. CHAPTER 4 AND SEc. I906. PUB. L. 109-59. AS AMENoED Failure to comply with applicable Federal statutes. regulations. and directives may subject Grantee Agency officials to civil or criminal penalties and/or place State in a high-risk grantee status in accordance with 49 CFR I 8.1 2. The Officials named on the grant agreement signature page. that the Grantee Agency complies with all applicable Federal statutes, regulations. and directives and State rules, guidelines. policies and laws in effect with respect to the periods for which it receives grant funding. Applicable provisions include but are not limited to the follou,ing: GENERAL REQUIREMENTS. 23 U.S.C. Chapter 4 - Highway Safety Act of '1966, as amended ' 2 CFR part 200 - Uniform Administrative Requirements, Cost Principles. and Audit Requirements for Federal Awards. 49 CFR Part 18- Uniform Administrative Requirements for Grants and Cooperative Agreements to State and Local Governments.. 23 CFR part 1300 - Uniform Procedures for State Highway Safety Grant Programs NONDISCRIMINATION (applies to subrecipients as well as States) The State highway safety agency will comply with all Federal statutes and implementing regulations relating to nondiscrimination ("Federal Nondiscrimination Authorities"). These include but are not limited to: ' Title VI of the Civil Rights Act of 1964 (42 U.S.C. 2000d et seq.. 78 stat. 252), (prohibits discrimination on the basis ofrace. color. national origin) and 49 CFR part 2t: ' The Uniform Relocation Assistance and Real Properfy- Acquisition Policies Act of 1970. (42 U.S.C. 4601). (prohibits unfair treatment ofpersons displaced or whose property has been acquired because ofFederal or Federal-aid programs and projects): ' Federal-Aid Highway Act of 1973. (23 U.S.C. 324 er seq.). and Title IX of the Education Amendments of 1972, as amended (20 U. S.C. I 681 - 1683 and 'l 685- 1686) (prohibit discrimination on the basis of sex)i ' Section 504 of the Rehabilitation Act of 1973. (29 U.S.C. 794 et seq.). as amended. (prohibits discrimination on the basis ofdisability) and 49 CFR part 27: . The Age Discrimination Act of 1975. as amended. (42 U.S.C. 610l er seq.1, (prohibits discrimination on the basis of age); . The Civil Rights Restoration Act of 1987. (Pub. L. 100-209), (broadens scope. coverage and applicability of Title VI of the Civil Rights Act o11964. The Age Discrimination Act of 1975 and Section 504 of the Rehabilitation Act of 1973, by expanding the definition ofthe terms "programs or activities" to include all ofthe programs or activities ofthe Federal aid recipients. subrecipients and contractors. u-hether such programs or activities are Federally-funded or not): . Titles II and III of the Americans with Disabilities Act (42 U.S.C. 12131-12189) (prohibits discrimination on the basis ofdisability in the operation ofpublic entities, public and private transportation systems. places of public accommodation, and certain testing) and 49 CFR pa(s 37 and 38; . Executive Order 12898, Federal Actions to Address Environmental Justice in Minority Populations and Low-Income Populations (prevents discrimination against minority populations by discouraging programs. policies, and activities with disproportionately high and adverse human health or environmental eflects on minority and low-income populations): and . Executive Order 13166, lmproving Access to Services for Persons with Limited English Proficiency (guards against Title Vl national origin discrimination/discrimination because of limited English proficiency (LEP) by ensuring that funding recipients take reasonable steps to ensure that LEP persons have meaningful access to programs (70 FR74087-741OO). 7l21l2O2O 11:13:46 AM Page 10 of 17 The State highway safety agency- 'Will take all measures necessary to ensure that no person in the United States shall, on the grounds of race, color, national origin, disability, sex, age, limited English proficiency, or membership in any other class protected by Federal Nondiscrimination Authorities, be excluded from participation in, be denied the benefits of, or be otherwise subjected to discrimination under any of its programs or activities, so long as any portion of the program is Federally-assisted; ' Will administer the program in a manner that reasonably ensures that any of its subrecipients, contractors, subcontractors, and consultants receiving Federal financial assistance under this program will comply with all requirements of the Non-Discrimination Authorities identified in this Assurance; 'Agrees to comply (and require its subrecipients, contractors, subcontractors, and consultants to comply) with all applicable provisions of law or regulation governing US DOT's or NHTSA's access to records, accounts, documents, information, facilities, and staff, and to cooperate and comply with any program or compliance reviews, and/or complaint investigations conducted by US DOT or NHTSA under any Federal Nondiscdmination Authority; ' Acknowledges that the United Slates has a right to seek judicial enforcement with regard to any matter arising under these Non-Discrimination Authorities and this Assurance; 'Agrees to insert in all contracts and funding agreements with other State or private entities the following clause: "During the performance of this contracUfunding agreement, the contractor/funding recipient agrees- a. To comply with all Federal nondiscrimination laws and regulations, as may be amended from time to time, b. Not to participate directly or indirectly in the discrimination prohibited by any Federal non-discrimination law or regulation, as set forth in appendix B of 49 CFR part 2l and herein; c. To permit access lo its books, records, accounts, other sources of information, and its facilities as required by the State highway safety office, US DOT or NHTSA; d. That, in event a contractor/funding recipient fails to comply with any nondiscrimination provisions in this contracvfunding agreement, the State highway safety agency will have the right to impose such contracuagreement sanctions as it or NHTSA determine are appropriate, including but not lamited to withholding payments to the contractor/funding recipient under the contracuagreement until the contractor/funding recipient complies; and/or cancelling, terminating, or suspending a contrac{ or funding agreement, in whole or in part; and e. To insert this clause, including paragraphs (a) through (e), in every subcontract and subagreement and in every solicitation for a subcontract or sub-agreement, that receives Federal funds under this program. POLITICAL ACTIVITY (HATCH ACT) (applies to subrecipients as well as States) The state will comply with provisions of the Hatch Act (5 U.S.C. 1501-1508), which limits the potitical activities of employees whose principal employment activities are funded in whole or in part w'ith Federal funds. CERTIFICATION REGARDING FEDERAL LOBBYING (applies to subrecipients as well as States) Certification for Contracts, Grants, Loans, and Cooperative Agreements The undersigned certafies, to the best of his or her knowledge and belief, that: 712112020 11:13:46 AM Page 11 ol 17 1. No Federal appropriated funds have been paid or will be paid, by or on behalf of the undersigned, to any person for influencing or attempting to influence an officer or employee of any agency, a Member of Congress, an officer or employee of Congress, or an employee of a Member of Congress in connection with the awarding of any Federal contract, the making of any Federal grant, the making of any Federal loan, the entering into of any cooperative agreement, and the extension, continuation, renewal, amendment, or modification of any Federal contract, grant, loan, or cooperative agreement; 2. lf any funds other than Federal appropriated funds have been paid or will be paid to any person for influencing or attempting to influence an officer or employee of any agency, a Member of Congress, an officer or employee of Congress, or an employee of a Member of Congress in connection with this Federal contract, grant, loan, or cooperative agreement, the undersigned shall complete and submit Standard Form-LLL, "Disclosure Form to Report Lobbying," in accordance with its instructions; 3. The undersigned shall require that the language of this certification be included in the award documents for all sub-award at all tiers (including subcontracts, subgrants, and contracts under grant, loans, and cooperative agreements) and that all subrecipients shall certify and disclose accordingly. This certification is a material representation of fact upon which reliance was placed when this transaction was made or entered into. Submission of this certification is a prerequisite for making or entering inlo this transaction imposed by section 1352, title 31, U.S. Code. Any person who fails to file the required certification shall be subject to a civil penalty of not less than $10,000 and not more than $100,000 for each such failure. RESTRICTION ON STATE LOBBYING (applies to subrecipients as well as States) None of the funds under this program will be used for any activity specifically designed to urge or influence a State or local legislator to favor or oppose the adoption of any specific legislative proposal pending before any State or local legislative body. Such activities include both direct and indirect (e.9., "grassroots") lobbying activities, with one exception. This does not preclude a State official whose salary is supported with NHTSA funds from engaging in direct communications with State or local legislative officials, in accordance with customary State practice, even if such communications urge legislative officials to favor or oppose the adoption of a specific pending legislative proposal. CERTIFICATION REGARDING DEBARMENT AND SUSPENSION (applies to subrecipients as well as States) lnstructions for Primary Tier Participant Certification (States) 1. By signing and submitting this proposal, the prospective primary tier participant is providing the certification set out below and agrees to comply with the requirements of 2 CFR parts t80 and 1200. 2. The inability of a person to provide the certification required below will not necessarily result in denial of participation in this covered transaction. The prospective primary tier participant shall submit an explanation of why it cannot provide the certification set out below. The certification or explanation will be considered in connection with the department or agency's determination whether to enter into this transaciion. However, failure of the prospective primary tier participant to furnish a certification or an explanation shall disqualify such person from participation in this transaction. 3. The certification in this clause is a material representation of fact upon which reliance was placed when the department or agency determined to enter into this lransaction. lf it is later determined that the prospective primary tier participant knowingly rendered an erroneous certification, in addition to other remedies available to the Federal Government, the department or agency may terminate this transaction for cause or default or may pursue suspension or debarment. 4. The prospective primary tier participant shall provide immediate written notice to the department or agency to which this proposal is submitted if at any time the prospective primary tier participant learns its certification was erroneous when submifted or has become erroneous by reason of changed circumstances. 5. The terms covered transaction, civil judgment, debarment, suspenslon, ineligible, pafticipant, person, principal, and voluntaily excluded, as used in this clause, are defined in 2 CFR parts 180 and 1200. You may contact the department or agency to which this proposal is being submitted for assistance in obtaining a copy of those regulations. 712112O2O11:13:45AM Page 12 ol 17 6. The prospective primary tier participant agrees by submitting this proposal that, should the proposed covered transaction be entered into, it shall not knowingly enter into any lower tier covered transaction with a person who is proposed for debarment under 48 CFR part g, subpart 9.4, debarred, suspended, declared ineligible, or voluntarily excluded from participation in this covered transaclion, unless authorized by the department or agency entering into this transaction. 7. The prospective primary tier participant further agrees by submitting this proposal that it will include the clause titled "lnstructions for Lower Tier Participant Certification" including the "Certification Regarding Debarment, Suspension, lneligibility and Voluntary Exclusion-Lower Tier Covered Transaction," provided by the department or agency entering into this covered transaction, without modification, in all lower tier covered transactions and in all solicitations for lower tier covered transactions and will require lower tier participants to comply with 2 CFR parts 180 and 1200. 8. A participant in a covered transaction may rely upon a certification of a prospective participant in a lower tier covered transaction that it is not proposed for debarment under 48 CFR part 9, subpart 9.4, debarred, suspended, ineligible, or voluntarily excluded from the covered transaclion, unless it knows that the certification is erroneous. A participant is responsible for ensuring that its principals are not suspended, debarred, or otherwise ineligible to participate in covered transactions. To verify the eligibility of its principals, as well as the eligibility of any prospective lower tier participants, each participant may, but is not required to, check the System for Award Management Exclusions website (https.//www. sam. gov/). 9. Nothing contained in the foregoing shall be construed to require establishment of a system of records in order to render in good faith the certification required by this clause. The knowledge and information of a participant is not required to exceed that which is normally possessed by a prudent person in the ordinary course of business dealings. 10. Except for transactions authorized under paragraph 6 of these instructions, if a participant in a covered transaction knowingly enters into a lower tier covered transaction with a person who is proposed for debarment under 48 CFR part 9, subpart 9.4, suspended, debarred, ineligible, or voluntarily excluded from participation in this transaction, in addition to other remedies available to the Federal government, the department or agency may terminate the transaction for cause or default. Ceftification Regarding Debarment, Suspension, and Other Responsibility Matters-Primary Tier Covered Transactions (1) The prospective primary tier participant certifies to the best of its knowledge and belief, that it and its principals: (a) Are not presently debarred, suspended, proposed for debarment, declared ineligible, or voluntarily excluded from participating in covered transactions by any Federal department or agency; (b) Have not within a three-year period preceding this proposal been convicted of or had a civiljudgment rendered against them for commission of fraud or a criminal offense in connection with obtaining, attempting to obtain, or performing a public (Federal, State or local) transaction or contract under a public transaction; violation of Federal or State antitrust statutes or commission of embezzlement, theft, forgery, bribery, falsification or destruction of records, making false statements, or receiving stolen property, (c) Are not presently indicted for or otheMise criminally or civilly charged by a governmental entity (Federal, State or Local) with commission of any of the offenses enumerated in paragraph (1Xb) of this certification; and (d) Have not within a three-year period preceding this application/proposal had one or more public transactions (Federal, State, or local) terminated for cause or default. (2) Where the prospective primary tier participant is unable to certify to any of the Statements in this certification, such prospective participant shall attach an explanation to this proposal. lnstructions for Lower Tier Participant Certification 7/2112020 'l 1:13:46 AM Page l3 of 17 1. By signing and submitting this proposal, the prospective lower tier participant is providing the certification set out below and agrees to comply with the requirements of 2 CFR parts 180 and '1200. 2. The certification in this clause is a material representation of fact upon which reliance was placed when this transac{ion was entered into. lf it is later determined that the prospective lower tier participant knowingly rendered an erroneous certification, in addition to other remedies available to the Federal government, the department or agency with which this transaction originated may pursue available remedies, including suspension or debarment. 3. The prospective lower tier participant shall provide immediate written notice to the person to which this proposal is submitted af at any time the prospective lower tier participant learns that its certification was erroneous when submitted or has become erroneous by reason of changed circumstances. 4. The terms covered transaction, civil judgment, debarment, suspension, ineligible, pafticipant, person, pincipal, and voluntaily excluded, as used in this clause, are defined in 2 CFR parts 180 and 1200. You may contact the person to whom this proposal is submitted for assistance in obtaining a copy of those regulations. 5. The prospective lower tier participant agrees by submitting this proposal that, should the proposed covered transaction be entered into, it shall not knowingly enter into any lower tier covered transaction with a person who is proposed for debarment under 48 CFR part 9, subpart 9.4, debarred, suspended, declared ineligible, or voluntarily excluded from participation in this covered transaction, unless authorized by the department or agency with which this transaction originated. 6. The prospective lower tier participant further agrees by submitting this proposal that it will include the clause titled "lnstructions for Lower Taer Participant Certification' including the "Certification Regarding Debarment, Suspension, lneligibility and Voluntary Exclusion - Lower Tier Covered Transaction," without modification, in all lower tier covered transactions and in all solicitations for lower tier covered transactions and will require lower tier participants to comply with 2 CFR pa(s '180 and 1200. 7. A participant in a covered transaction may rely upon a certification of a prospective participant in a lower tier covered transaction that it is not proposed for debarment under 48 CFR part 9, subpart 9.4, debarred, suspended, ineligible, or voluntarily excluded from the covered transaction, unless it knows that the certification is enoneous. A participant is responsible for ensuring that its principals are not suspended, debarred, or otherwise ineligible to participate in covered transactions. To verify the eligibility of its principals, as well as the eligibility of any prospective lower tier participants, each participant may, but is not required to, check the System for Award Management Exclusions website (https://www.sam.gov/). 8. Nothing contained in the foregoing shall be construed to require establishment of a system of records in order to render in good faith the certification required by this clause. The knowledge and information of a participant is not required to exceed that which is normally possessed by a prudent person in the ordinary course of business dealings. 9. Except for transaclions authorized under paragraph 5 of these instructions, if a participant in a covered transaction knowingly enters into a lower tier covered transaction with a person who is proposed for debarment under 48 CFR part 9, subpart 9.4, suspended, debarred, ineligible, or voluntarily excluded from participation in this transaclion, in addition to other remedies available to the Federal govemment, the department or agency with which this transaction originated may pursue available remedies, including suspension or debarment. Ceftification Regarding Debarmenf, Suspension, lneligibilry and Voluntary Exclusion - Lower Tier Covered Transactions: 1 . The prospective lower tier participant certifies, by submission of this proposal, that neither it nor its principals is presently debarred, suspended, proposed for debarment, declared ineligible, or voluntarily excluded from participating in covered transactions by any Federal department or agency. 2. Where the prospective lower tier participant is unable to certify to any of the statements in this certification, such prospective participant shall attach an explanation to this proposal. 712112020 11:13:46 AM Page 14 of 17 BUY AMERICA ACT (applies to subrecipients as well as States) The State and each subrecipient will comply with the Buy America requirement (23 U.S.C. 313) when purchasing items using Federal funds. Buy America requires a State, or subrecipient, to purchase with Federal funds only steel, iron and manufactured products produced in the United States, unless the Secretary of Transportation determines that such domestically produced items would be inconsistent with the public interest, that such materials are not reasonably available and of a satisfactory quality, or that inclusion of domestic materials will increase the cost of the overall project contract by more than 25 percent. ln order to use Federal funds to purchase foreign produced items, the State must submit a waiver request that provides an adequate basis and justification for approval by the Secretary of Transportation. PROHIBITION ON USING GRANT FUNDS TO CHECK FOR HELMET USAGE (applies to subrecipients as well as States) The State and each subrecipient will not use 23 U.S.C. Chapter 4 grant funds for programs to check helmet usage or to create checkpoints that specifically target motorcyclists. POLICY ON SEAT BELT USE ln accordance with Executive Order 13043, lncreasing Seat Belt Use in the United States, dated April 16, 1997, the Grantee is encouraged to adopt and enforce on{he-job seat belt use policies and programs for ils employees when operating company-owned, rented, or personally-owned vehicles. The National Highway Traffic Safety Administration (NHTSA) is responsible for providing leadership and guidance an support of this Presidential initiative. For information and resources on traffic safety programs and policies for employers, please contact the Network of Employers for Traffic Safety (NETS), a public-private partnership dedicated to improving the traffic safety practices of employers and employees. You can download information on seat belt programs, costs of motor vehicle crashes to employers, and other traffic safety initiatives at www.trafficsafety.org. The NHTSA website (www.nhtsa.gov) also provides information on statistics, campaigns, and program evaluations and references. POLICY ON BANNING TEXT MESSAGING WHILE DRIVING ln accordance with Executive Order 13513, Federal Leadership On Reducing Text Messaging While Driving, and DOT Order 3902.10, Text Messaging While Driving, States are encouraged to adopt and enforce workplace safety policies to decrease crashes caused by distracted driving, including policaes to ban telit messaging while driving company-owned or rented vehicles, Government-owned, leased or rented vehicles, or privately-owned vehicles when on official Government business or when performing any work on or behalf of the Government. States are also encouraged to conduct workplace safety initiatives in a manner commensurate with the size of the business, such as establishment of new rules and programs or re-evaluation of existing programs to prohibit text messaging while driving, and education, awareness, and other outreach to employees about the safety risks associated with texting while driving. 7l21l2O2O 11:13:46 AM Page {5 of 17 State of California - Office of Traffic Safety GMNT NutrBER OTS-55 Grant Electronic Management System (GEMS) Access pr21o7t Exhibit C INSTRUCTIONS FOR ADDING OR UPDATING GEMS USERS l. Each agency is allowed a total of FIVE (5) GEMS Users. 2. GEMS Users listed on this form will be authorized to login to GEMS to complete and submit Quarterly Performance Reports (QPRs) and reimbursement claims. 3. Complete the form if adding, removing or editing a GEMS use(s). 4. The Grant Director must sign this form and return it with the Grant Agreement. GRANT DETAILS Number: P121073 Agency Name: Vemon Police Department Grant Title: Selective Traffic Enforcement Program (STEP) Agreement Total: $1 10,000.00 AuthorizingOfficial. CarlosFandino Fiscal Official: Anthony Miranda Grant Director: Gustavo Henera CURRENT GEMS UsER(s) L Gustavo Herrera Title: Sergeant Phone: (323) 587-517'l Email: gherrera@covpd.org Media Contact: Yes 2. Nicholas Perez Title: Lieutenant Phone: 323-587-5171 Email. nperez@covpd.org Media Contact. Yes 712112020 11:13:46AM Page 16 of 17 Complete the below information if adding, removing or editing a GEMS use(s) GEMS User 1 Add/Change !Remove Access !Add as a media contact? Yes !Nfl Name Job Title Email address Phone number GEMS User 2 Add/Change !Remove Access ! Add as a media contact? Yes ! No E Name Job Title Email address Phone number GEMS User 3 Add/Change !Remove Access !Add as a media contact? Yes ! No E Name Job Title Email address Phone number GEMS User 4 Add/Change !Remove Access !Add as a media contact? Yes ! No E Name Job Title Email address Phone number GEMS User 5 Add/Change f]Remove Access ! Add as a media contact? Yes ! No E Name Job Title Email address Form completed by: Phone number Date: As a signatory I hereby authorize the listed individual(s) to represent and have GEMS user access. Signature Name Grant Director Date Title 712112020 11.13:46 AM Page 17 oi 17 City Council Agenda Item Report Agenda Item No. COV-304-2020 Submitted by: Alexis Hwang Submitting Department: City Administration Meeting Date: September 1, 2020 SUBJECT Managed Print Services Agreement with MRC Smart Technology Solutions and Xerox Recommendation: A. Approve and authorize the City Administrator to execute a Services Agreement with MRC Smart Technology Solutions, in substantially the same form as submitted, for a three-year term in an amount not-to-exceed $206,360 ($68,786.82 per year) for Managed Print Services (MPS) with an effective date of September 20, 2020; and B. Approve and authorize the City Administrator to execute a related Lease Agreement with Xerox, in substantially the same form as submitted, for a three-year term in an amount not-to-exceed $83,640 ($27,879.84 per year) for MPS with an effective date of September 20, 2020. Background: The Information Technology Division (IT) is requesting approval to award a Services Agreement to MRC Smart Technology Solutions (MRC) for an MPS solution that will maximize efficiency and reduce overall printing costs. In addition to the Service Agreement with MRC, IT is requesting approval of a related Lease Agreement with Xerox for 12 Xerox copiers. MRC is a subsidiary of Xerox and, as a standard practice, the company requires the execution of separate agreements for its services and leased copiers. The primary objectives for acquiring the expertise of a vendor to manage print services are as follows: *Reduce total cost to the City *Reduce print volume *Reduce burden rates (staff time consumed for managing print supplies & repairs) *Optimize device utilization *Streamline equipment maintenance and repair *Maintain high levels of user satisfaction Continuing with a managed print services model will allow the City to maintain its control and oversight of print usage, thus resulting in reduced operating costs associated with print output while still meeting business needs. In order to select an appropriate firm to provide the aforementioned services, a Request for Proposals (RFP) was issued on July 6, 2020 via the City website and posted on the PlanetBids website. Responses were required by July 20, 2020. The City received fourteen (14) proposals, but one proposal was disqualified due to not being responsive to the RFP. A review panel comprised of staff from the IT Division evaluated the thirteen (13) proposals received from qualified respondents in order to determine the vendor best suited to provide the services requested. A comprehensive, fair, and impartial evaluation of proposals was conducted in accordance with the specifications set forth within the RFP document. Established criteria were used in reviewing and comparing the proposals to determine the most suitable firm. At the conclusion of the assessment, it was determined that MRC was the most compatible choice for the award of the services agreement for Managed Print Services. MRC was the top ranked respondent due to their years of experience in the industry, exceptional qualifications, and their ability to offer quality technology and service at a competitive price. It is, therefore, recommended that City Council approve and authorize the City Administrator to execute a services agreement with MRC and the related lease agreement with Xerox. The proposed agreements have been reviewed and approved by the City Attorney' s Office. Fiscal Impact: The total combined not-to-exceed value of the agreements with MRC Smart Technology Solutions and Xerox is $96,666.66 per year for a three-year term, equating to a combined total contract value of $290,000. The annual expense for the proposed services agreement with MRC Smart Technology Solutions and Xerox has been included in the Information Technology budget for FY 2020/2021, and shall be budgeted accordingly for each subsequent year. Attachments: 1. Services Agreement with MRC Smart Technology Solutions 2. Lease Agreement with Xerox 1 SERVICES AGREEMENT BETWEEN THE CITY OF VERNON AND MRC SMART TECHNOLOGY SOLUTIONS FOR MANAGED PRINT SERVICES COVER PAGE Contractor: MRC Smart Technology Solutions Responsible Principal of Contractor: Kirstin Maloney, Strategic Account Executive Notice Information - Contractor: MRC Smart Technology Solutions 5700 Warland Drive Cypress, CA 90630 Attention: Kirstin Maloney, Strategic Account Executive Phone: (949) 610-6793 Email: Kirstin.Maloney@xerox.com Notice Information - City: City of Vernon 4305 Santa Fe Avenue Vernon, CA 90058 Attention: Carlos R. Fandino Jr., City Administrator Telephone: (323) 583-8811 ext. 228 Email: cfandino@ci.vernon.ca.us Commencement Date: September 19, 2020 Termination Date: September 18, 2023 Consideration: Total not to exceed $290,000.00 (includes all applicable sales tax); and more particularly described in Exhibit C Records Retention Period Three (3) years, pursuant to Section 11.20 2 SERVICES AGREEMENT BETWEEN THE CITY OF VERNON AND MRC SMART TECHNOLOGY SOLUTIONS FOR MANAGED PRINT SERVICES This Contract is made between the City of Vernon ("City"), a California charter City and California municipal corporation (“City”), and MRC Smart Technology Solutions, a subsidiary of Xerox Corporation, a New York corporation (“Contractor”). The City and Contractor agree as follows: 1.0 EMPLOYMENT OF CONTRACTOR. City agrees to engage Contractor to perform the services as hereinafter set forth as authorized by the City Council on September 1, 2020. 2.0 SCOPE OF SERVICES. 2.1 Contractor shall perform all work necessary to complete the services set forth in the City’s Request for Proposals issued on or about July 6, 2020, and titled Managed Print Services, and Contractor's proposal to the City ("Proposal") dated July 20, 2020, Exhibit “B”, a copy which is attached to and incorporated into this Contract by reference. 2.2 All services shall be performed to the satisfaction of City. 2.3 All services shall be performed in a competent, professional, and satisfactory manner in accordance with the prevailing industry standards for such services. 3.0 PERSONNEL. 3.1 Contractor represents that it employs, or will employ, at its own expense, all personnel required to perform the services under this Contract. 3.2 Contractor shall not subcontract any services to be performed by it under this Contract without prior written approval of City. 3.3 All of the services required hereunder will be performed by Contractor or by City-approved subcontractors. Contractor, and all personnel engaged in the work, shall be fully qualified and authorized or permitted under State and local law to perform such services and shall be subject to approval by the City. 3 4.0 TERM. The term of this Contract shall commence on September 19, 2020 and it shall continue until September 18, 2023, unless terminated at an earlier date pursuant to the provisions thereof. 5.0 COMPENSATION AND FEES. 5.1 Contractor has established rates for the City of Vernon which are comparable to and do not exceed the best rates offered to other governmental entities in and around Los Angeles County for the same services. For satisfactory and timely performance of the services, the City will pay Contractor in accordance with the payment schedule set forth in Exhibit “C” attached hereto and incorporated herein by reference. 5.2 Contractor's grand total compensation for the entire term of this Contract, shall not exceed $290,000.00 without the prior authorization of the City, as appropriate, and written amendment of this Contract. 5.3 Contractor shall, at its sole cost and expense, furnish all necessary and incidental labor, material, supplies, facilities, equipment, and transportation which may be required for furnishing services pursuant to this Contract. Materials shall be of the highest quality. The above Contract fee shall include all staff time and all clerical, administrative, overhead, insurance, reproduction, telephone, air travel, auto rental, subsistence, and all related costs and expenses. 5.4 City shall reimburse Contractor only for those costs or expenses specifically approved in this Agreement, or specifically approved in writing in advance by City. Unless otherwise approved, such costs shall be limited and include nothing more than the following costs incurred by Contractor: 5.4.1 The actual costs of subcontractors for performance of any of the services that Contractor agrees to render pursuant to this Agreement, which have been approved in advance by City and awarded in accordance with this Agreement. 5.4.2 Approved reproduction charges. 4 5.4.3 Actual costs and/or other costs and/or payments specifically authorized in advance in writing and incurred by Contractor in the performance of this Agreement. 5.5 Contractor shall not receive any compensation for extra work performed without the prior written authorization of City. As used herein, “extra work” means any work that is determined by City to be necessary for the proper completion of the Project, but which is not included within the Scope of Services and which the parties did not reasonably anticipate would be necessary at the time of execution of this Agreement. Compensation for any authorized extra work shall be paid in accordance with the payment schedule as set forth in Exhibit “C,” if the extra work has been approved by the City. 5.6 Licenses, Permits, Fees, and Assessments. Contractor shall obtain, at Contractor’s sole cost and expense, such licenses, permits, and approvals as may be required by law for the performance of the services required by this Agreement. Contractor shall have the sole obligation to pay for any fees, assessments, and taxes, plus applicable penalties and interest, which may be imposed by law and which arise from or are necessary for the performance of the Services by this Agreement. 6.0 PAYMENT. 6.1 As scheduled services are completed, Contractor shall submit to the City an invoice for the services completed, authorized expenses, and authorized extra work actually performed or incurred according to said schedule. 6.2 Each such invoice shall state the basis for the amount invoiced, including a detailed description of the services completed, the number of hours spent, reimbursable expenses incurred and any extra work performed. 6.3 Contractor shall also submit a progress report with each invoice that describes in reasonable detail the services and the extra work, if any, performed in the immediately preceding calendar month. 5 6.4 Contractor understands and agrees that invoices which lack sufficient detail to measure performance will be returned and not processed for payment. 6.5 City will pay Contractor the amount invoiced within thirty (30) days after the City approves the invoice. 6.6 Payment of such invoices shall be payment in full for all services, authorized costs, and authorized extra work covered by that invoice. 7.0 CITY'S RESPONSIBILITY. City shall cooperate with Contractor as may be reasonably necessary for Contractor to perform its services; and will give any required decisions as promptly as practicable so as to avoid unreasonable delay in the progress of Contractor's services. 8.0 COORDINATION OF SERVICES. Contractor agrees to work closely with City staff in the performance of Services and shall be available to City’s staff, consultants, and other staff at all reasonable times. 9.0 INDEMNITY. Contractor agrees to indemnify City, its officers, elected officials, employees and agents against, and will hold and save each of them harmless from, any and all actions, suits, claims, damages to persons or property, losses, costs, penalties, obligations, errors, omissions or liabilities (herein “claims or liabilities”), including but not limited to professional negligence, that may be asserted or claimed by any person, firm or entity arising out of or in connection with the work, operations or activities of Contractor, its agents, employees, subcontractors, or invitees, provided for herein, or arising from the acts or omissions of Contractor hereunder, or arising from Contractor’s performance of or failure to perform any term, provision, covenant or condition of this Agreement, except to the extent such claims or liabilities arise from the gross negligence or willful misconduct of City, its officers, elected officials, agents or employees. 10.0 INSURANCE. Contractor shall, at its own expense, procure and maintain policies of insurance of the types and in the amounts set forth below, for the duration of the Contract, including any extensions thereto. The policies shall state that they afford primary 6 coverage. i. Automobile Liability with minimum limits of at least $1,000,000 combined single limit, including owned, hired, and non-owned liability coverage. ii. Contractor agrees to subrogate automobile liability resulting from performance under this agreement by agreeing to defend, indemnify and hold harmless, the City, and its respective employees, agents, and City Council from and against all claims, liabilities, suits, losses, damages, injuries and expenses, including all costs and reasonable attorney’s fees (“Claims”), which are attributable to any act or omission by the City under the performance of the services. iii. General Liability with minimum limits of at least $1,000,000 per occurrence and $2,000,000 aggregate written on an Insurance Services Office (ISO) Comprehensive General Liability "occurrence" form or its equivalent for coverage on an occurrence basis. Premises/Operations and Personal Injury coverage is required. The City of Vernon, its directors, commissioners, officers, employees, agents, and volunteers must be endorsed on the policy as additional insureds as respects liability arising out of the Contractor's performance of this Contract. (1) If Contractor employs other contractors as part of the services rendered, Contractor's Protective Coverage is required. Contractor may include all subcontractors as insureds under its own policy or shall furnish separate insurance for each subcontractor, meeting the requirements set forth herein. (2) Contractor agrees to subrogate General Liability resulting from performance under this agreement by agreeing to defend, indemnify and hold harmless, the City, and its respective employees, agents, and City Council from and against all claims, liabilities, suits, losses, damages, injuries and expenses, including all costs and reasonable attorney’s fees (“Claims”), which are attributable to any act or omission by the City under 7 the performance of the services. iv. Technology Professional Liability Errors and Omissions coverage in a sum of at least $1,000,000 per claim/occurrence and $2,000,000 policy aggregate. Coverage shall be sufficiently broad to respond to duties and obligation as is undertaken by Contractor in this agreement and shall include but not be limited to, claims involving infringement of intellectual property, including but not limited to infringement of copyright, trademark, trade dress, invasion of privacy violations, information theft, damage to or destruction of electronic information, release of private information, alteration of electronic information, extortion and network security. The policy shall provide coverage for breach response costs as well as regulatory fines, penalties and credit monitoring expenses with limits sufficient to respond to these obligations. v. Contractor shall comply with the applicable sections of the California Labor Code concerning workers' compensation for injuries on the job. In addition, Contractor shall require each subcontractor to similarly maintain workers’ compensation insurance in accordance with the laws for California for all of the subcontractor’s employees. Compliance is accomplished in one of the following manners: (1) Provide copy of permissive self-insurance certificate approved by the State of California; or (2) Secure and maintain in force a policy of workers' compensation insurance with statutory limits and Employer's Liability Insurance with a minimal limit of $1,000,000 per accident. The policy shall be endorsed to waive all rights of subrogation against City, its directors, commissioners, officers, employees, and volunteers for losses arising from performance of this Contract; or (3) Provide a "waiver" form certifying that no employees subject to the Labor Code's Workers' Compensation provision will be used in performance of this Contract. 8 vi. Each insurance policy included in this clause shall be endorsed to state that coverage shall not be cancelled except after thirty (30) days' prior written notice to City. vii. Insurance shall be placed with insurers with a Best's rating of no less than A-VIII. viii. Prior to commencement of performance, Contractor shall furnish City with a certificate of insurance for each policy. Each certificate is to be signed by a person authorized by that insurer to bind coverage on its behalf. The certificate(s) must be in a form approved by City. City may require complete, certified copies of any or all policies at any time. ix. Failure to maintain required insurance at all times shall constitute a default and material breach. In such event, Contractor shall immediately notify City and cease all performance under this Contract until further directed by the City. In the absence of satisfactory insurance coverage, City may, at its option: (a) procure insurance with collection rights for premiums, attorney's fees and costs against Contractor by way of set-off or recoupment from sums due to Contractor, at City's option; (b) immediately terminate this Contract and seek damages from the Contract resulting from said breach; or (c) self-insure the risk, with all damages and costs incurred, by judgment, settlement or otherwise, including attorney's fees and costs, being collectible from Contractor, by way of set-off or recoupment from any sums due to Contractor. 11.0 GENERAL TERMS AND CONDITIONS. 11.1 INDEPENDENT CONTRACTOR. 11.1.1 It is understood that in the performance of the services herein provided for, Contractor shall be, and is, an independent contractor, and is not an agent, officer or employee of City and shall furnish such services in its own manner and method except as required by this Contract, or any applicable statute, rule, or regulation. Further, Contractor has and shall retain the right to exercise full control over the employment, direction, compensation and discharge of all persons employed by Contractor in the performance of the services hereunder. City assumes no liability for Contractor’s actions and performance, nor assumes responsibility for taxes, bonds, payments, or other commitments, implied or explicit, by or for 9 Contractor. Contractor shall be solely responsible for, and shall indemnify, defend and save City harmless from all matters relating to the payment of its employees, subcontractors and independent contractors, including compliance with social security, withholding and all other wages, salaries, benefits, taxes, exactions, and regulations of any nature whatsoever. 11.1.2 Contractor acknowledges that Contractor and any subcontractors, agents or employees employed by Contractor shall not, under any circumstances, be considered employees of the City, and that they shall not be entitled to any of the benefits or rights afforded employees of City, including, but not limited to, sick leave, vacation leave, holiday pay, Public Employees Retirement System benefits, or health, life, dental, long-term disability or workers' compensation insurance benefits. 11.2 CONTRACTOR NOT AGENT. Except as the City may authorize in writing, Contractor and its subcontractors shall have no authority, express or implied, to act on behalf of or bind the City in any capacity whatsoever as agents or otherwise. 11.3 OWNERSHIP OF WORK. All documents and materials furnished by the City to Contractor shall remain the property of the City and shall be returned to the City upon termination of this Agreement. All reports, drawings, plans, specifications, computer tapes, floppy disks and printouts, studies, memoranda, computation sheets, and other documents prepared by Contractor in furtherance of the work shall be the sole property of City and shall be delivered to City whenever requested at no additional cost to the City. Contractor shall keep such documents and materials on file and available for audit by the City for at least three (3) years after completion or earlier termination of this Contract. Contractor may make duplicate copies of such materials and documents for its own files or for such other purposes as may be authorized in writing by the City. 11.4 CORRECTION OF WORK. Contractor shall promptly correct any defective, inaccurate or incomplete tasks, deliverables, goods, services and other work, without additional cost to the City. The performance or acceptance of services furnished by Contractor 10 shall not relieve the Contractor from the obligation to correct subsequently discovered defects, inaccuracy, or incompleteness. 11.5 RESPONSIBILITY FOR ERRORS. Contractor shall be responsible for its work and results under this Agreement. Contractor, when requested, shall furnish clarification and/or explanation as may be required by the City, regarding any services rendered under this Agreement at no additional cost to City. In the event that an error or omission attributable to Contractor occurs, then Contractor shall, at no cost to City, provide all necessary design drawings, estimates and other Contractor professional services necessary to rectify and correct the matter to the sole satisfaction of City and to participate in any meeting required with regard to the correction. 11.6 WAIVER. The City's waiver of any term, condition, breach, or default of this Contract shall not be considered to be a waiver of any other term, condition, default or breach, nor of a subsequent breach of the one waived. The delay or failure of either party at any time to require performance or compliance by the other of any of its obligations or agreements shall in no way be deemed a waiver of those rights to require such performance or compliance. No waiver of any provision of this Agreement shall be effective unless in writing and signed by a duly authorized representative of the party against whom enforcement of a waiver is sought. 11.7 SUCCESSORS. This Contract shall inure to the benefit of, and shall be binding upon, the parties hereto and their respective heirs, successors, and/or assigns. 11.8 NO ASSIGNMENT. Contractor shall not assign or transfer this Contract or any rights hereunder without the prior written consent of the City and approval by the City Attorney, which may be withheld in the City's sole discretion. Any unauthorized assignment or transfer shall be null and void and shall constitute a material breach by the Contractor of its obligations under this Contract. No assignment shall release the original parties from their obligations or otherwise constitute a novation. 11.9 COMPLIANCE WITH LAWS. Contractor shall comply with all Federal, 11 State, County and City laws, ordinances, rules and regulations, which are, as amended from time to time, incorporated herein and applicable to the performance hereof, including but without limitation, the Vernon Living Wage Ordinance. Violation of any law material to performance of this Contract shall entitle the City to terminate the Contract and otherwise pursue its remedies. Further, if the Contractor performs any work knowing it to be contrary to such laws, rules, and regulations Contractor shall be solely responsible for all costs arising therefrom. 11.10 ATTORNEY'S FEES. If any action at law or in equity is brought to enforce or interpret the terms of this Contract, the prevailing party shall be entitled to reasonable attorney's fees, costs, and necessary disbursements in addition to any other relief to which such party may be entitled. 11.11 INTERPRETATION. 11.11.1 Applicable Law. This Contract shall be deemed a contract and shall be governed by and construed in accordance with the laws of the State of California. Contractor agrees that the State and Federal courts which sit in the State of California shall have exclusive jurisdiction over all controversies and disputes arising hereunder, and submits to the jurisdiction thereof. 11.11.2 Entire Agreement. This Contract, including any exhibits attached hereto, constitutes the entire agreement and understanding between the parties regarding its subject matter and supersedes all prior or contemporaneous negotiations, representations, understandings, correspondence, documentation, and agreements (written or oral). 11.11.3 Written Amendment. This Contract may only be changed by written amendment signed by Contractor and the City Administrator or other authorized representative of the City, subject to any requisite authorization by the City Council. Any oral representations or modifications concerning this Contract shall be of no force or effect. 11.11.4 Severability. If any provision in this Contract is held by any court of competent jurisdiction to be invalid, illegal, void, or unenforceable, such portion shall be 12 deemed severed from this Contract, and the remaining provisions shall nevertheless continue in full force and effect as fully as though such invalid, illegal, or unenforceable portion had never been part of this Contract. 11.11.5 Order of Precedence. In case of conflict between the terms of this Contract and the terms contained in any document attached as an Exhibit or otherwise incorporated by reference, the terms of this Contract shall strictly prevail. The terms of the City’s Request for Proposals shall control over the Contractor’s Proposal. 11.11.6 Duplicate Originals. There shall be two (2) fully signed copies of this Contract, each of which shall be deemed an original. 11.11.7 Construction. In the event an ambiguity or question of intent or interpretation arises with respect to this Agreement, this Agreement shall be construed as if drafted jointly by the parties and in accordance with its fair meaning. There shall be no presumption or burden of proof favoring or disfavoring any party by virtue of the authorship of any of the provisions of this Agreement. 11.12 TIME OF ESSENCE. Time is strictly of the essence of this contract and each and every covenant, term, and provision hereof. 11.13 AUTHORITY OF CONTRACTOR. The Contractor hereby represents and warrants to the City that the Contractor has the right, power, legal capacity, and authority to enter into and perform its obligations under this Contract, and its execution of this Contract has been duly authorized. 11.14 ARBITRATION OF DISPUTES. Any dispute for under $25,000 arising out of or relating to the negotiation, construction, performance, non-performance, breach, or any other aspect of this Contract, shall be settled by binding arbitration in accordance with the Commercial Rules of the American Arbitration Association at Los Angeles, California and judgment upon the award rendered by the Arbitrators may be entered in any court having 13 jurisdiction thereof. The City does not waive its right to object to the timeliness or sufficiency of any claim filed or required to be filed against the City and reserves the right to conduct full discovery. 11.15 NOTICES. Any notice or demand to be given by one party to the other must be given in writing and by personal delivery or prepaid first-class, registered or certified mail, addressed as follows. Notice simply to the City of Vernon or any other City department is not adequate notice. If to the City: City of Vernon Attention: Ernesto Smith, Information Technology Manager 4305 Santa Fe Avenue Vernon, CA 90058 If to the Contractor: MRC Smart Technology Solutions Attention: Kirstin Maloney, Strategic Account Executive 5700 Warland Drive Cypress, CA 90630 Any such notice shall be deemed to have been given upon delivery, if personally delivered, or, if mailed, upon receipt, or upon expiration of three (3) business days from the date of posting, whichever is earlier. Either party may change the address at which it desires to receive notice upon giving written notice of such request to the other party. 11.16 NO THIRD PARTY RIGHTS. This Agreement is entered into for the sole benefit of City and Contractor and no other parties are intended to be direct or incidental beneficiaries of this Agreement and no third party shall have any right or remedy in, under, or to this Agreement. 11.17 TERMINATION FOR CONVENIENCE (Without Cause). City may terminate this Contract in whole or in part at any time, for any cause or without cause, upon fifteen (15) calendar days' written notice to Contractor. If the Contract is thus terminated by City for reasons other than Contractor's failure to perform its obligations, City shall pay Contractor a 14 prorated amount based on the services satisfactorily completed and accepted prior to the effective date of termination. Such payment shall be Contractor's exclusive remedy for termination without cause. 11.18 DEFAULT. In the event either party materially defaults in its obligations hereunder, the other party may declare a default and terminate this Contract by written notice to the defaulting party. The notice shall specify the basis for the default. The Contract shall terminate unless such default is cured before the effective date of termination stated in such notice, which date shall be no sooner than ten (10) days after the date of the notice. In case of default by Contractor, the City reserves the right to procure the goods or services from other sources and to hold the Contractor responsible for any excess costs occasioned to the City thereby. Contractor shall not be held accountable for additional costs incurred due to delay or default as a result of Force Majeure. Contractor must notify the City immediately upon knowing that non-performance or delay will apply to this Contract as a result of Force Majeure. At that time Contractor is to submit in writing a Recovery Plan for this Contract. If the Recovery Plan is not acceptable to the City or not received within 10 days of the necessary notification of Force Majeure default, then the city may cancel this order in its entirety at no cost to the City, owing only for goods and services completed to that point. 11.19 TERMINATION FOR CAUSE. Termination for cause shall relieve the terminating party of further liability or responsibility under this Contract, including the payment of money, except for payment for services satisfactorily and timely performed prior to the service of the notice of termination, and except for reimbursement of (1) any payments made by the City for service not subsequently performed in a timely and satisfactory manner, and (2) costs incurred by the City in obtaining substitute performance. If this Agreement is terminated as provided herein, City may require, at no additional cost to City, that Contractor provide all finished or unfinished documents, data, and other information of any kind prepared by Contractor in connection with the performance of Services under this Agreement. Contractor 15 shall be required to provide such document and other information within fifteen (15) days of the request. 11.19.1 Additional Services. In the event this Agreement is terminated in whole or in part as provided herein, City may procure, upon such terms and in such manner as it may determine appropriate, services similar to those terminated. 11.20 MAINTENANCE AND INSPECTION OF RECORDS. The City, or its authorized auditors or representatives, shall have access to and the right to audit and reproduce any of the Contractor's records to the extent the City deems necessary to insure it is receiving all money to which it is entitled under the Contract and/or is paying only the amounts to which Contractor is properly entitled under the Contract or for other purposes relating to the Contract. The Contractor shall maintain and preserve all such records for a period of at least three (3) years after termination of the Contract. The Contractor shall maintain all such records in the City of Vernon. If not, the Contractor shall, upon request, promptly deliver the records to the City of Vernon or reimburse the City for all reasonable and extra costs incurred in conducting the audit at a location other than the City of Vernon, including, but not limited to, such additional (out of the City) expenses for personnel, salaries, private auditors, travel, lodging, meals, and overhead. 11.21 CONFLICT. Contractor hereby represents, warrants, and certifies that no member, officer, or employee of the Contractor is a director, officer, or employee of the City of Vernon, or a member of any of its boards, commissions, or committees, except to the extent permitted by law. 11.22 HEADINGS. Paragraphs and subparagraph headings contained in this Agreement are included solely for convenience and are not intended to modify, explain or to be a full or accurate description of the content thereof and shall not in any way affect the meaning or interpretation of this Agreement. 16 11.23 ENFORCEMENT OF WAGE AND HOUR LAWS. Eight hours labor constitutes a legal day's work. The Contractor, or subcontractor, if any, shall forfeit twenty-five dollars ($25) for each worker employed in the execution of this Agreement by the respective Contractor or subcontractor for each calendar day during which the worker is required or permitted to work more than 8 hours in any one calendar day and 40 hours in any one calendar week in violation of the provisions of Sections 1810 through 1815 of the California Labor Code as a penalty paid to the City; provided, however, work performed by employees of contractors in excess of 8 hours per day, and 40 hours during any one week, shall be permitted upon compensation for all hours worked in excess of 8 hours per day at not less than 1½ times the basic rate of pay. 11.24 Contractor, and any Subcontractor(s), shall comply with the City’s Living Wage Ordinance. The current Living Wage Standards are set forth in Exhibit “D”. Upon the City’s request, certified payroll records shall promptly be provided to the City. 11.25 EQUAL EMPLOYMENT OPPORTUNITY PRACTICES. Contractor certifies and represents that, during the performance of this Contract, it and any other parties with whom it may subcontract shall adhere to equal employment opportunity practices to assure that applicants, employees and recipients of service are treated equally and are not discriminated against because of their race, religion, color, national origin, ancestry, disability, sex, age, medical condition, sexual orientation or marital status. Contractor further certifies that it will not maintain any segregated facilities. Contractor further agrees to comply with The Equal Employment Opportunity Practices provisions as set forth in Exhibit “E”. [Signatures Begin on Next Page]. 17 IN WITNESS WHEREOF, the Parties have signed this Agreement as of the Commencement Date stated on the cover page. City of Vernon, a California charter City and California municipal corporation By: ____________________________ Carlos R. Fandino, Jr., City Administrator MRC Smart Technology Solutions, a subsidiary of Xerox, a New York corporation By: Name: Title: ATTEST: _______________________________ Lisa Pope, City Clerk By: Name: Title: APPROVED AS TO FORM: _______________________________ Arnold M. Alvarez-Glasman, Interim City Attorney 18 EXHIBIT A MRC SMART TECHNOLOGY SOLUTIONS SERVICE AGREEMENT 19 EXHIBIT B CONTRACT’S PROPOSAL RESPONSE TO: City of Vernon Name of Proposer: MRC Smart Technology Solutions Bid Number: Managed Print Services Date & Time Proposal is Due: Monday, July 20, 2020 by 5:00 p.m. Contact Information: Kirstin Maloney Strategic Account Executive 949-610-6793 Kirstin.Maloney@xerox.com Thank you for the opportunity to participate in City of Vernon’s bid for Managed Print Services. Our goal is to provide the most efficient and cost-effective recommendations that align with your new operational strategy. As per the terms in this request, the City of Vernon will be provided with the best quality of technology and service at a competitive cost. MRC Smart Technology Solutions is able and willing to enter into a contract to supply the necessary equipment and perform required services for the City. MRC Smart Technology Solutions (MRC) is a wholly owned subsidiary of Xerox Corporation, an $11 billion American company that invented the photocopier and pioneered this industry. With 113 years of experience, 26 years locally, providing technologies and services to numerous businesses, school districts and cities, there is a solid understanding of the challenges that businesses face regarding budgeting, security and technology. These experiences give us both the credibility of a worldwide corporation and the reliability of local accountability. The combination of local autonomy and experienced leadership enables MRC offices to be a single- source solution for every facet of document imaging. Overall, the goal is to bring solutions tailored to the company’s needs that help reduce costs and increase efficiency. Your MRC team will be led by Kirstin Maloney. Her dedication to customer satisfaction, combined with her years of experience, guarantees that she will work closely with your City to ensure a smooth transition during implementation and provide continued support for the duration of the contract. Kirstin can be reached by phone 949-610-6793 or email Kirstin.Maloney@xerox.com. We have read, understand and agree to an all-inclusive agreement with a firm offer valid for a 90-day period. MRC acknowledges receipt of all addenda. We understand that the period of performance for this solicitation shall be 36 months. MRC does not have any interest, ownership, or remuneration of any type that has been received or is anticipated from the Project. On behalf of the entire MRC team, we appreciate your time and consideration of this proposal. We look forward to your comments. Matthew Whalen Tara Hubsch Chief Financial Officer Vice President of Sales July 14, 2020 Information Technology Division 4305 Santa Fe Avenue Vernon, CA 90058 714-718-8507 Tara.Hubsch@xerox.com 5700 Warland Drive Cypress, CA 90630 Table of Contents Introduction ................................................................................................... 1 Scope of Work ................................................................................................ 2 Work Plan ....................................................................................................... 3 Implementation Roadmap .................................................................................. 6 360/FM Audit Application ................................................................................... 8 Quarterly Business Review .................................................................................. 9 Fees and Costs .............................................................................................. 10 Price Includes .................................................................................................... 10 Service Includes ................................................................................................. 10 Ability of Proposer to Perform ...................................................................... 13 Why MRC Smart Technologies? ........................................................................ 15 Implementation’s Team Bios ............................................................................ 17 Affidavit of Non-Collusion ............................................................................. 20 City of Vernon RFP No. Managed Print Services Version 1.0 1 Confidential Response between MRC Smart Technology Solutions & City of Vernon due July 20, 2020 Introduction MRC, Xerox, is California’s largest and most respected consulting firm that specializes in workflow assessments and optimization. We are a member of the Global Imaging Division of Xerox. Our business is uniquely positioned to organizations and local government to understand true cost breakdown, asset deployment, usage patterns and volumes along with the development of sustainable working practices and continuous improvement initiatives. We have successfully led various size cities and public sectors accounts to help streamline their technology, achieve better financial results, while improving their operational efficiency. MRC is a Xerox owned company. As a Xerox owned company, we not only have the autonomy to serve our customers at a local level but have the full support of a $22 Billion Global Corporation and their support resources as well. MRC has been a Xerox partner selling and servicing copiers since 1994. MRC, Xerox also has a long-term history of expertly managing customer’s desktop printers through proven assessments, detailed analytics, device management software tools, and mapping of departments for the past 15 years. MRC, Xerox has the proven track record of improving efficiencies while lowering the client’s overall operational cost. MRC, Xerox provides a closed loop process in our quarterly review meetings to help adjust for changes within the departmental usages. As a partner, our objectives are to reduce IT staff time through our web - based software and remote desktop support on copiers and printers. MRC 360 apps will allow for the automation of print supplies deliveries & repair), optimize device utilization, streamline equipment maintenance and repair, and maintain high levels of user satisfaction. MRC’s goal is to be a consultative partner to the City of Vernon and to provide continuous feedback on how the City can continue to be productive while maintaining the most reliable technology and excellent service. With prioritized economic development values of giving back to the communities, City of Vernon is set for better sales and service, faster growth, increased profitability, and higher returns on capital. As MRC Smart Technology Solutions (MRC), a wholly owned subsidiary of Xerox Corporation, we want to assist you in quickly and efficiently reaching higher. Since 1906, Xerox has always helped customers find better ways to work by inventing the best technologies of each era. Today, customers find themselves at the intersection of physical and digital worlds. To them, it’s a digital divide; to us, it’s a bridge. We leverage our expertise in areas like digital imaging and secure, automated solutions to help our customers improve productivity. We are not just a print vendor, but a partner in streamlining and automating workflows securely. Security is critical to every business, and we take it seriously at Xerox. We equip printers and multifunction printers (MFPs) with several secure print features to protect your organization’s most sensitive data. Our software and apps ens ure digital data is safeguarded as you share it via the cloud and mobile devices. City of Vernon RFP No. Managed Print Services Version 1.0 2 Confidential Response between MRC Smart Technology Solutions & City of Vernon due July 20, 2020 We turn innovation investments into products and services that help our customers be more productive, profitable and sustainable. Our thought process is always about how we can simplify work, deliver more personalized experiences, and improve productivity through new technologies. We strive to connect the physical and digital worlds without adversely affecting the environment, human health and safety. With goals to reduce en vironmental impacts across our value chain, we invest in innovative solutions that can conserve resources and lower the energy intensity of our, and your, operations. Scope of Work MRC, Xerox provides a proven methodology of assessment and analytics that utilizes the deployment of our 360 software apps to monitor client’s network devices to manage their printer/copier usage. We also conduct a site walk to pull local devices and gather invoices to understand your existing expenditure. We partner up with key departments like IT, Finance, and Operations to gather sufficient data in order to provide appropriate recommendations that are tailored and designed to the organization’s need. We work with end users to better understand their workflow and uncover their pain points. As a partner in the solution, we provide the feedback to our partner with real value add data. Our analytics help our clients to uncover the true cost of ownership of their operations with regards to printing cost, technology cost, and labor cost. We can also help to track Department Usage and Billing. MRC will also provide the following: • Maintain a readily available, accurate and up to date detailed list of all printing devices and their respective locations throughout the City’s departments/facilities • Provide quarterly usage reports for auditing (who is printing what and how much did it cost) • Provide a Citywide year end cost analysis that details total cost, costs by department, and includes a performance review along with recommendations to improve operations and reduce costs further • Control, monitor, manage, and reduce overall print costs for the City • Provide the ability to monitor print volumes by device and create incentives for staff to reduce print volumes City of Vernon RFP No. Managed Print Services Version 1.0 3 Confidential Response between MRC Smart Technology Solutions & City of Vernon due July 20, 2020 • Ability to expand or contract the overall size of document output fleet as needs change without penalties or refinancing of hardware and software (if applicable) • Service equipment on-site at the facility where equipment is located • Qualified technicians to handle multiple brands of desktop printers like HP, Brother and Lexmark • Perform all preventative maintenance services on all devices at the manufacturer’s suggested intervals • Provide full-service support for all printers during normal business hours (Monday– Thursday, 8 a.m.–5 p.m.) within the pricing proposed • Guarantee a loaner machine anytime equipment is down for more than 3 business days. The loaner will remain on site until the original unit is repaired or replaced. In the unlikely event that a loaner is not available, a new unit will be provided. • Provide a four-hour service response, 1-hour call-back, and 4 hours on-site. The 4-hour requirement is calculated from the time the first phone call is made for support to the vendor until the appropriately trained technician is on site. • Replace troubled units with a like unit until the device is repaired correctly without cost to City of Vernon whenever any device has four repeat service calls • Provide proactive vendor managed supplies alerts with help desk integration to initiate proper action • Provide proactive Vendor managed Break/Fix alerts with Help Desk integration Work Plan MRC strives to provide a well-planned and executed Implementation process for all Major Accounts. MRC has completed numerous large implementations within the State of California. It is crucial that once MRC is selected by the City of Vernon approval committee, MRC will complete a thorough physical walkthrough of the sites before the implementation. During the physical walkthrough, the assessment team validates location, department, contact information, space, electrical, network access and overall strength of the recommendation. Our assessment team will be led by the following individuals: Tara Hubsch (VP), Kirstin Maloney (Strategic Account Executive), and additional supporting individuals due to the scope of the project. MRC/ Xerox team of individuals will lead the implementation, to include a Major Account Sales Manager, Customer Care Manager, Logistics coordinator, Lead Analyst, and Lead Service Technicians and Company Certified Trainers. Coordination and timeframe of the delivery and implementation process is discussed thoroughly with the City of Vernon’s Administration team and agreed upon. MRC proactive service approach allows for a quick resolution with our 1-4-24 service response creed and remote desktop support. Our Service Call center is also trained to resolve customer issues remotely. Currently, 25% of incoming service calls are solved over the phone. This is done through remote software and superior training for our call center employees. By having the City of Vernon RFP No. Managed Print Services Version 1.0 4 Confidential Response between MRC Smart Technology Solutions & City of Vernon due July 20, 2020 opportunity to eliminate the need for a service call, MRC can maximize a company’s service uptime. Should a service call be required, the customer will receive a call back within 1 hour with an estimated time of arrival. The average response time will be within 4 hours. Resolution should occur at the time the call is placed. Most parts required are available within the technician’s car inventory. If a part needs to be ordered, resolution is still within 24 hours. Our copier technology also allows for a proactive service approach. Through our Smart Kits (CRU’s), the majority of the copiers’ key components (fuser cartridges, ink cartridges, print cartridges) can allow a customer to resolve issues within a few minutes and eliminate a service call all together. MRC also installs a software application we call the “360 app”. This application monitors all of the networked printers’ supply levels. When a networked device reaches the 20% threshold the customer will receive an automatic shipment of supplies. In addition, the 360 app will au tomate meter reads for billing/accounting. Also, each device will be tagged with a sticker which provides the equipment with an asset ID# and service/supply phone number. End Users can simply pick up the phone and place a service call when there is an issue and refer their asset ID#. Or calls can be placed centralized with your IT department. MRC will tailor a plan to meet their needs for placing service calls or ordering toner. Another key differentiator is that we meet with our clients every 90 days or at shorter intervals based on the needs of the City. A dedicated non -sales resource, Account Manager will prepare a Quarterly Business Review that provides quarterly volume trends, billing, service history, and reports. This meeting allows the client to verify the accuracy of the volumes. For supplemental information regarding our proposed device, certificate of insurance, and services and maintenance please see “Attachment 2 – MRC Supplemental Documentation”. City of Vernon RFP No. Managed Print Services Version 1.0 5 Confidential Response between MRC Smart Technology Solutions & City of Vernon due July 20, 2020 SAMPLE IMPLEMENTATION Tasks to be Completed Owner Date Planning / Implementation Contract Award Client 8/03/20 Process Lease Agreement Provider 8/04/20 - 8/10/20 First Planning Meeting – Establish Timeline Provider/Client 8/04/20 Install FM Audit/Xerox 360° App Client IT 8/10/20 Finalize Configurations / Assessments Provider 8/04/20 - 8/07/20 Identify Principal Department POCs Provider 8/04/20 Pre-testing of copiers prior to installation – on site DEMO Provider 8/11/20 Second Meeting (Assess and Review) Provider/Client 8/12/20 Final Space, Electrical and Data Drop Check Provider 8/17/20 Preconfigure Equipment Provider/Client Upon receipt of information Installation – Schedule Provider/Client 8/18/20 Installation Provider/Client TBD Remove Existing Equipment Provider/Client TBD Training Identify Special Training Requirements Provider/Client 8/04/20 Publish Training Schedule Provider/Client 8/17/20 Initial Training – Installation Quick Start Provider/Client TBD Follow up on Training Provider As Needed Annual Refresher Provider TBD Service and Supplies Place Initial Supply Order Provider TBD Monitoring Software Loaded Checked Provider TBD Business Process Finalize Billing and Reporting Requirements Provider 8/18/20 Gather Initial Meter Reads Provider TBD Account Management Strategy Provider/Client TBD Develop Quarterly Review Schedule Provider/Client TBD City of Vernon RFP No. Managed Print Services Version 1.0 6 Confidential Response between MRC Smart Technology Solutions & City of Vernon due July 20, 2020 Implementation Roadmap We have been deploying large, multi-unit installations for local government, school districts, hospitals and law firms for over 20 years. You will have a dedicated support team that focuses on government agencies across Southern California. For a smooth transition, we work with our clients to provide an installation schedule that meets if not exceeds their expectations. Whether the preference is for all devices to be delivered, installed, trained and old devices removed in a week or spread out over several weeks or months, we adjust to meet the cl ient’s expectations and needs. Contract Award Process all agreements and finalize paperwork for the contract. Plan – Develop Communication and Implementation Plan Executives and key Implementation team members meet with the client. We begin to verify s ite location(s) in order to: confirm electrical and space requirements, determine training needs, review responsibility matrix, and develop an implementation schedule. Order Devices Coordinate delivery of devices to warehouse(s) closest to client locatio n(s) and confirm quantities of devices in warehouse inventory. Configuration and Pre -Testing of Copiers Build device(s) to customer specifications, configure test device(s) to customer specification, deliver and test on-site demo unit, and finalize configuration of devices to customer specification. City of Vernon RFP No. Managed Print Services Version 1.0 7 Confidential Response between MRC Smart Technology Solutions & City of Vernon due July 20, 2020 Installation and Remove Existing Equipment Schedule and confirm delivery, deliver and install device(s), remove old device(s) and install software solutions*. Train Device and software training include, quick start training for MFDs, Print Shop training for production devices, and IT training. Additionally, training, follow-up training and refresher training is available. Supplies Establish on-site supply storage for MFD and Print Shop (including drums) as well as place initial supply order. Verify and Finalize Installation Verify Schedule “A” accuracy, authenticate FMAudit/360 application is reporting for all devices, confirm all devices and check all software solutions are operating according to manufacturer and customer agreed expectations. Billing Requirements or Contract Billing Review and finalize invoice requirements. Determine invoice structure (by location, department, device, etc.), verify billing frequency (monthly, quarterly, etc.) and confirm billing location (corporate, location, etc.). Troubleshoot On-site supply distribution location efficiency means fine tuning schedule “A” names to ensure accurate delivery of supplies. User training efficiency check to ensure end-users, Print Shop staff, and IT team are competent and confident in their skills with the devices and software. Review device efficiency of location and volumes. Lease Returns The completed ERF (Equipment Return Form) requires a client signature and lease return information. Once our Lease Return Coordinator is provided the paperwork, coordination of device pickup, will be facilitated. Our Lease Return Coordinator will also provide proof of Hard Drive wipe or destruction based on the written agreement with the client. QBRs – Quarterly Business Reviews Schedule Account Executive or Manager to set up QBR schedule with the client. QBR schedules include information such as hardware break/fix, service response analysis, managed print analysis , recommendations for cost controls, and IMACD (installation, move, add, change, decommission). City of Vernon RFP No. Managed Print Services Version 1.0 8 Confidential Response between MRC Smart Technology Solutions & City of Vernon due July 20, 2020 360/FM Audit Application Our 360 App° is designed to help customers with tracking meter reads and suppl ies. We will install, set up, and train your team on our 360 App°. Once the app is configured, all meter reads for network attached devices (printers and MFPs) are automatically gathered and su bmitted to us monthly for billing purposes. In addition to meter collection, the 360 App° monitors toner levels in the Xerox MFPs. The benefits of the 360 App° are: • Automated meter reads - No more calling in or emailing your meter reads every month/quarter! We can gather and track your meter reads through the 360 App °. • Automated supplies replenishment - No more calling in or emailing for more toner! We will be notified when your device is running low. • Remote service diagnostics - No more waiting for a Field Service Technician to come to your location! Customer Care can troubleshoot your device over the phone. • Client dashboard - No Xerox equipment, no problem! The 360 App° can connect to both Xerox and non-Xerox equipment to check the status of your device’s usage. Volume Usage (Meter Reads) Ordering Supplies (Consumables) City of Vernon RFP No. Managed Print Services Version 1.0 9 Confidential Response between MRC Smart Technology Solutions & City of Vernon due July 20, 2020 Quarterly Business Review MRC Smart Technology Solutions bases its technical service delivery system on using data to evaluate performance. From this method, we can create and build a mutually beneficial business relationship. As part of our continuing engagement process, MRC offers account review meetings on a regular quarterly basis, or as requested, focusing on quality management and reviewing the process for continuous improvement. The main objective of these account reviews is to discuss operational and technical issues and performance against standards. Topics discussed may include open issues and progress toward resolution, proposed/impending changes, status of special projects, optimization/future state review, any City support requirements, City management support and City communication needs. Our QBRs include categories such as Current Fleet Analysis, Volume Analysis, Service History, Items to Review, Scorecard to assess Xerox Services, and any questions that you or MRC may have. The QBRs can also be personalized to only show categories that are deemed important to your City. The screenshots below are examples that were pulled from our recent QBR meetings. MRC standard reviews include data on current-month performance as well as trends that accurately show our extended performance. Our ability to capture and display data in this format allows us to quickly identify and capitalize on any existing performance improvement opportunities. Examples of the data tracking we offer include: • Color and black-and-white volume history (monthly and year-to-date) • Multifunction device activity (copy, print, fax, scan volumes) • Equipment uptime and on-site response time • Equipment service and service trending • Summary and detailed service reports Metrics that we closely monitor include: • Response time to acknowledged service requirements • Cycle time to complete equipment repairs • Percentage of equipment uptime • Number of unscheduled service calls Our goal is to report metrics that reinforce our commitment to quality by delivering on service level agreements. This allows the City to remain focused on its core objectives. City of Vernon RFP No. Managed Print Services Version 1.0 10 Confidential Response between MRC Smart Technology Solutions & City of Vernon due July 20, 2020 Fees and Costs See attached Pricing Exhibit, “Attachment 1 – MRC Pricing”. Lease price for equipment will be guaranteed for the 36-month term. Price is protected and will not increase. Maintenance on lease is also locked for the term of the agreement and will not increase. All services, parts and supplies are included (excludes staples and paper). Price Includes • Customization of new machines to customer’s specifications, delivery of said machines and installation • Training • Pickup old machines • Maintenance of fleet • Proactive quarterly business reviews Service Includes • Maintenance includes unlimited service calls and all supplies required for machine (except paper and staples) • Genuine OEM parts and supplies to maximize reliability for all proposed multi-function copiers ✓ Remanufactured supplies for existing desktop printer fleet ✓ Providing multi-brand device service and support for existing desktop printer fleet ✓ All consumables (parts & toner) delivery within 72 hours of order ✓ Provide a four-hour service response, one-hour call-back, and four-hour onsite response time • Financially backed performance guarantee ✓ Performing all preventative maintenance services on all devices at manufacturer’s suggested intervals ✓ Service Loaner Guarantee: Replacing troubled units with a like unit until the device is repaired • Auto toner replenishment and automatic meter reads (360 App°) • Nation-wide call center provides exceptional customer service via our dedicated Support ✓ Unlimited remote help-desk support • Local billing to customize invoices, answer questions and resolve issues to provide a better customer experience • Local warehouse for inventory and parts for technicians City of Vernon RFP No. Managed Print Services Version 1.0 11 Confidential Response between MRC Smart Technology Solutions & City of Vernon due July 20, 2020 Regarding invoice billing format and options, MRC can customize invoices to meet your needs. Our Contract Billing team is located at out Cypress, CA branch. Our customers can work with their contract biller to create the invoice that best meets their needs. Below are two examples. City of Vernon RFP No. Managed Print Services Version 1.0 12 Confidential Response between MRC Smart Technology Solutions & City of Vernon due July 20, 2020 City of Vernon: Xerox® AltaLink® C8155 Environmental Requirements Temperature: 50°- 82° Humidity: 15% - 85% Total width: 48 in Total height: 45 in Total depth: 28 in Dimensions shown are approximate. Please refer to the Installation Guide for exact dimensions. AltaLink® C8155 The Xerox® AltaLink® C8155 is designed with a powerful mix of features that help you get more work done at a speed of 55ppm color and black and white. Prints up to 1200 x 2400 dpi Single Pass Duplex Automatic Document Feeder: 130 sheets, speed 141 ipm (duplex); Sizes: 5.5 x 8.5 in. to 11 x 17 in. / A5 to A3. Bypass Tray: 100 sheets; Custom sizes: 3.5 x 3.9 in. to 12.6 x 19 in. Tray 1: 520 sheets; Custom sizes: 5.5 x 7.5 in. to 11.7 x 17 in. Tray 2: 520 sheets; Custom sizes: 5.5 x 7.5 in. to 12 x 18 in. High Capacity Tandem Tray: 2,000 sheets; Size 8.5 x 11 in. / A4 Total paper capacity 3140 sheets 250 sheet Dual Offset Catch Tray and 100 sheet Face up Tray Equipped with Smart Proximity Sensor Office Finisher LX 2,000 sheet stacker, 50 sheet 2 position stapling Hole Punch for Office Finisher 2/3 Hole Punch PostScript Kit Adds Adobe PostScript 3, Adobe PDF version 1.7, PCL® 6 Manufacture Date January 2020 City of Vernon RFP No. Managed Print Services Version 1.0 13 Confidential Response between MRC Smart Technology Solutions & City of Vernon due July 20, 2020 Ability of Proposer to Perform MRC/Xerox is known for having a strong management team that focuses on “taking care of the customer” and being involved in the community. MRC now has direct access to Xerox products, infrastructure and support, which translate to more offerings for customers. MRC has maintained a consistent No. 1 rating in customer satisfaction. As the top provider of document management solutions and managed print services, MRC will continue to provide the same familiar talent to serve our customers. MRC has completed numerous large and mid -size implementations within the local Government in the State of California. We have delivered, installed, trained and managed various Managed Print Services programs to help cities gain greater accountability, productivity, and cost reduction in their technology fleet. As a division within Xerox, we have significant resources at our disposal to meet our customer’s needs and deliver customized solutions. Most of our larger customers have developed partnerships with MRC to provide a mix of services, in addition to providing MFP’s. Our retention rate with our major account customers exceeds 90% due to our approach and experience. Some of the unique management tools we use for our important customers (and potential customers, like CITY OF VERNON) include: Service call escalation: Our largest accounts are also “tagged” within our systems to push their calls to the front of the que. CITY OF VERNON would also be aligned with a Service Manager for any elevation requirements. In addition to the Public Sector references we outline below, we want to highlight some of our largest Managed Print Customers to demonstrate our expertise in the area of Managed Print Services. These examples are on a larger scale and show MRC’s ability to perform: eBay Managed Print Services: MRC has been managing eBay and PayPal for 8 years. Currently, MRC manages over 1,000 devices across 40+ facilities in the US and South America. Some of eBay’s remote sites are relatively small; in some areas less than 40 employees. MRC manages a fleet of HP printers, Xerox/ HP copiers, the FollowYou Printing software solution as well as an onsite print center. MRC has 8 employees onsite at the eBay/ PayPal headquarters in San Jose, California. Alere Managed Print Services: MRC has been managing Alere since 2018. After completing 20+ assessments of some of Alere’s key sites across the globe, Alere chose MRC as their sole technology provider for printing solutions. Currently MRC manages over 250 pieces of equipment at multiple locations throughout the US. Through our quarterly review process, we continue to strategize and plan the rollout of MRC’s services to their top priority sites. Biovia Managed Print Services: MRC has been managing Biovia for over 20 years. Currently, MRC manages 8 US locations. Biovia has roughly 50 devices throughout the country with proactive management on all City of Vernon RFP No. Managed Print Services Version 1.0 14 Confidential Response between MRC Smart Technology Solutions & City of Vernon due July 20, 2020 devices. MRC provides a quarterly review every 90 days to collaborate on optimization, goals, improvements, and transparency into budgetary expenses. Other projects that MRC has implemented and managed for Biovia include digital order processing workflow, electronic signature utilizing DocuSign, and integration with ERP AND CRM applications. We automated forms and contract generation utilizing Conga, SalesForce, and Docu Sign. Prindle Law Managed Print Services: MRC has been managing Prindle for over 14 years. Currently, MRC manages locations in Los Angeles and San Francisco. Prindle has over 100 desktop print devices under management. MRC provides a quarterly review with Prindle that has included customized billing and customized supply delivery solutions. For more references and list of completed projects similar in size & scope, all of whom are new or refreshed contracts from 2015, please contact the following: ACCOUNT City of Garden Grove Contact Keith Winston Title Sr. IT Analyst Phone Number 714-741-5050 ACCOUNT City of Glendale Contact Walter Calles Title Purchaser Phone Number 818-551-4668 ACCOUNT City of Laguna Beach Contact Ed Beracoechea Title IT Director Phone Number 949-464-6654 ACCOUNT City of La Mirada Contact Leticia Revilla Title Deputy City Clerk Phone Number 562-943-0131 ACCOUNT City of South Pasadena Contact Lucy Demirjian Title Title Phone Number 626-403-7213 City of Vernon RFP No. Managed Print Services Version 1.0 15 Confidential Response between MRC Smart Technology Solutions & City of Vernon due July 20, 2020 Why MRC Smart Technologies? There has never been a better time to consider us for your document solutions. We are a wholly owned subsidiary of Xerox Corporation, an $11 billion -dollar American company that invented the photocopier and pioneered this industry. As a leader in providing innovative document management solutions we are a technology partner with a long-term strategy to ensure you get the most out of your investment. Our local autonomy and leadership enable us to be a single-source solution for every facet of document imaging. This combination provides your business with both the credibility of a worldwide corporation and the reliability of a locally owned company. We currently provide service to over forty local municipalities. Experience: We have been in the document output technology business since 1994, and we have been a leader in developing and staying current with new hardware and software trends for over 30 years. Mid-volume multi-function devices are our longest standing core competency and area of expertise. While we have organically grown to provide other products and services (Software Solutions, Production Color, Wide Format, Printing and Scanning), multi-function devices make up 85+% of our business. To give you an example of our ability to manage large customers, our largest current customer is Southern California Edison (SCE). SCE has been an MRC customer since 2000. We have currently implemented over 1,500 MFPs in their environment. More importantly, we have successfully managed this account through th ree product refreshes (every 5 years). This should provide reassurance that your RFP requirements are indeed our area of expertise. Further details on our extensive experience are as follows: o We provide services to over 5,100 customers. o We have contracts with 13,000 customers in Southern California. o We have over 600 total employees and over 245 dedicated Service Technicians. o Our Service Technicians average 8 years of experience. Nationwide Resources: We provide unsurpassed first-party nationwide service. We centrally manage fleet reporting, escalation procedures, coverage, and guaranteed rates. Local Inventory: We have a warehouse and parts department dedicated to delivering equipment and parts in a reliable and professional manner. Our Cypress warehouse alone carries over $3 million worth of new output technology and $4 million worth of service parts that are readily accessible to our Field Service Technicians so that they can provide exemplary customer service. Local Billing: We provide local billing that can customize invoices, answer questions, and resolve issues to provide a better customer experience. City of Vernon RFP No. Managed Print Services Version 1.0 16 Confidential Response between MRC Smart Technology Solutions & City of Vernon due July 20, 2020 Consistency: We treat our customers as long-term business partners. For the last 16 years we have been delivering Quarterly Business Review meetings to keep us in touch with our clients and ensure that we are performing at the highest possible level of support. These reviews document fleet performance, adherence to the Service Level Agreement, recommendations for improvement, and a review of new technology. Community involvement: Giving back is one of our core values. Each year our employees participate and volunteer in community events that are important to them. Green Program: This program is essential to customers whose parts become inoperable and need a replacement the same or next day. Our Green Program also makes sure that any used and inoperable machines are disposed of environmentally safely through our EPEAT program. The EPEAT Program takes all our machines that are inoperable, strips them of their useable parts, and disposes of them through a Xerox approved recycler. Industry Awards: In addition to the other awards pictured below, we have twice been presented with BBB’s Torch Award for Ethics. This award annually recognizes organizations who are committed to the highest standard of leadership, character, ethics, and ethical enterprising. City of Vernon RFP No. Managed Print Services Version 1.0 17 Confidential Response between MRC Smart Technology Solutions & City of Vernon due July 20, 2020 Xerox Corporation has over 27,000 total employees, of which over 600 employees and 245 dedicated Service Technicians are in SoCal. Our Xerox Corporation headquarters is located at 201 Merritt 7 Norwalk, CT 06851. The MRC Smart Technology office is located at 5657 Copley Drive, San Diego CA 92111 and our other local branch office is at 5700 Warland Drive, Cypress CA 90630. Both offices may be reached at 800-769-2679. We understand that developing and adhering to sustainability practices is a key requirement for government agencies. We will be happy to share the successes of our long and deep-rooted commitment. Your primary MRC team will be comprised of, at a minimum, seven individuals. Some of these potential individuals’ roles, qualifications and experiences are noted on our “Implementation’s Team Bios” section. Implementation’s Team Bios Tony Barba Customer Care Manager Tony has 33 years in the copier service industry, with 6 years in the US Navy as Aviation Electronics Technician and is Net+ certified. He also has certifications on Kodak, Canon, Konica, Sharp and Xerox copiers. Tony is responsible for maintaining excellent customer service to all clients. He ensures integration of your helpdesk with Xerox Office Customer Care team and initiates remote support for end-users through defined escalation procedures. He works with Xerox Office on print server consolidation, software installation and co-authoring SOWs. Phone: 562-342-7300 x3248 Email: Tony.Barba@xerox.com Tara Hubsch Vice President of Sales Tara has been with SoCal Office Technologies for 13 years. From those years, three were in Sales and nine in a Management role. She specializes in Managed Print Services, focusing on Major accounts. She is responsible for proposing new plans and strategies to benefit the company, as well as the customer. Tara is also managing Phone: 714-718-8507 Email: Tara.Hubsch@xerox.com City of Vernon RFP No. Managed Print Services Version 1.0 18 Confidential Response between MRC Smart Technology Solutions & City of Vernon due July 20, 2020 the development of sales team that can deliver optimal results for key clients. Reynaldo Macalinao Helpdesk Analyst II Reynaldo has over 20 years of combined industry experience with hardware, networking and support; half of those years has been with Xerox for over 10 years. His charge is setting up device configuration on new devices prior to delivery and working with IT department to configure devices remotely and troubleshoot hardware and software issues. Additionally, he provides end-users with remote support for troubleshooting hardware and software issues. Reynaldo possesses extensive background with Xerox, Sharp, Konica, Ricoh, Brother and HP hardware and is Lead Analyst on Scope of Work for implementations of new equipment and software for the Education and Government sector. Phone: 562-342-7300 x3210 Email: Reynaldo.Macalinao@xerox.com Kirstin Maloney Strategic Technology Advisor Kirstin is a Strategic Account Executive, working specifically with larger companies of 250+ employees, both local and nationwide with Xerox Business Solutions for over 8 years. Also, has 4 years of direct experience in working with various cities and government agencies. Critical responsibilities range from initial assessment of facilities, through implementation of the solution, and continues with quarterly reviews to assure complete alignment with her customers’ needs. Actively involved in all daily needs of accounts including but not limited to billing request, services, supply and staff/end-user interfacing. Not to mention, she has a great track record for going above and beyond to meet her clients’ needs to ensure ultimate customer satisfaction! Phone: 949-610-6793 Email: Kirstin.Maloney@Xerox.com Ron Nakasone Field Service Manager Ron maintains an excellent relationship with his team and develops new strategies to exceed the client’s expectations. Ron’s goal is to ensure that his technicians provide above and beyond customer service and that all service inquiries directed to him are resolved immediately. He is responsible for overseeing the Field Service Phone: 562-342-7300 x3233 Email: Ron.Nakasone@xerox.com City of Vernon RFP No. Managed Print Services Version 1.0 19 Confidential Response between MRC Smart Technology Solutions & City of Vernon due July 20, 2020 Technicians involved in the delivery, installation, and maintenance of your Multi- function devices. Furthermore, he is responsible for resolving all service-related issues during the terms of your contract. Sandra Oden Contract Billing Manager Sandra has been with Xerox Business Solutions for 5 years and has 6 years of industry experience. She is responsible for overseeing the Contract Billing department to confirm that all policies and procedures are met. Sandra is also responsible for maintaining all contractual records and documents and changes that may occur throughout the contract. She handles all major accounts such as: Live Nation, Southern California Edison, Prospect Mortgage, and Dunn Edwards. In 2012 Sandra won the Medallion Award and successfully completed LDP training in 2013. Phone: 562-342-7300 x2561 Email: SOCContractBilling@xerox.com City of Vernon RFP No. Managed Print Services Version 1.0 20 Confidential Response between MRC Smart Technology Solutions & City of Vernon due July 20, 2020 Affidavit of Non-Collusion - INTENTIONALLY LEFT BLANK, SEE NEXT PAGE FOR COMPLETED AND SIGNED FORM – City of Vernon Managed Print Services (MPS) Request for Proposals AFFIDAVIT OF NON-COLLUSION BY CONTRACTOR STATE OF CALIFORNIA ) ) ss COUNTY OF LOS ANGELES ) _______________________________________________________ , being first duly sworn deposes and says that he/she is ______________________________________________________________ (Insert "Sole Owner", "Partner", "President, "Secretary", or other proper title) of _______________________________________________ (Insert name of bidder) who submits herewith to the City of Vernon a bid/proposal; That all statements of fact in such bid/proposal are true; That such bid/proposal was not made in the interest of or on behalf of any undisclosed person, partnership, company, association, organization or corporation; That such bid/proposal is genuine and not collusive or sham; That said bidder has not, directly or indirectly by agreement, communication or conference with anyone attempted to induce action prejudicial to the interest of the City of Vernon, or of any othe r bidder or anyone else interested in the proposed contract; and further That prior to the public opening and reading of bids/proposals, said bidder: a. Did not directly or indirectly, induce or solicit anyone else to submit a false or sham bid/proposal; b. Did not directly or indirectly, collude, conspire, connive or agree with anyone else that said bidder or anyone else would submit a false or sham bid/proposal, or that anyone should refrain from bidding or withdraw his/her bid/proposal; c. Did not, in any manner, directly or indirectly seek by agreement, communication or conference with anyone to raise or fix the bid/proposal price of said bidder or of anyone else, or to raise or fix any overhead, profit or cost element of his/her bid/proposal price, or of that of anyone else; d. Did not, directly or indirectly, submit his/her bid/proposal price or any breakdown thereof, or the contents thereof, or divulge information or data relative thereto, to any corporation, partnership, company, association, organization, bid depository, or to any member or agent thereof, or to any individual or group of individuals, except the City of Vernon, or to any person or persons who have a partnership or other financial interest with said bidder in his/her business. I certify under penalty of perjury that the above information is correct By: ______________________________________ Title: ______ Date: Page 11 of 35 June 2020 Matthew Whalen MRC Smart Technology Solutions Chief Financial Officer Chief Financial Officer 20 EXHIBIT C SCHEDULE Quantity Item Xerox AltaLink C8155 Product Description Copier Service Rates Xerox C8155 MFP COLOR COPIER (55PPM BW/55PPM Color MFP)$0.0050 BW and $0.045 Color (*Service Rates Fixed for Term) Print, Copy, Scan, Staple, 2/3 Hole-Punch, 4 Paper Trays Maintenace Agreement based upon Cost Per Copy 12 C8155H2 XEROX ALTALINK C8155H2 MFP COLOR COPIER Service Rates are Fixed for 36 Month Lease Term without Escalation 12 497K20600 2/3 HOLE PUNCH FOR OFFICE FINISHER Lease Term: 36 months 12 097S05019 OFFICE FINISHER C8155 Quantity Devices Covered Under Manged Print Services Managed Print Service Rates 1 Brother MFC-8710 $0.0099 BW and $0.069 Color (*Service Rates Fixed for Term) 1 Canon MF820 Maintenace Agreement based upon Print Per Image 1 HP Color Laserjet 4700 Service Rates are Fixed for 36 Month Maintenance Agreement without Escalation 1 HP Color Laserjet CM 2320 Includes Service, Parts, & Supplies 1 HP Color Laserjet CP2025 1 HP Color Laserjet CP3525 16 HP Color Laserjet M452 1 HP Color Laserjet M750 9 HP Color Laserjet MFP M476 19 HP Color Laserjet MFP M477 1 HP Laserjet 300 M375 11 HP Laserjet 400 M451 3 HP Laserjet 400 M401 2 HP Laserjet 4240 4 HP Laserjet 4250 4 HP Laserjet 500 Color M551 1 HP Laserjet 600 M602 1 HP Laserjet M426 1 HP Laserjet P3010 2 HP Laserjest P4015 11 HP Laserjest M451 6 HP Laserjet M401 2 HP Laserjet 2015 2 HP Laserjet P4015 3 Lexmark MS312 $2,116.32 Pricing for the City of Vernon Total Monthly Equipment Payment: 21 EXHIBIT D LIVING WAGE PROVISIONS Minimum Living Wages: A requirement that Employers pay qualifying employees a wage of no less than $10.30 per hour with health benefits, or $11.55 per hour without health benefits. Paid and Unpaid Days Off: Employers provide qualifying employees at least twelve compensated days off per year for sick leave, vacation, or personal necessity, and an additional ten days a year of uncompensated time for sick leave. No Retaliation: A prohibition on employer retaliation against employees complaining to the City with regard to the employer’s compliance with the living wage ordinance. Employees may bring an action in Superior Court against an employer for back pay, treble damages for willful violations, and attorney’s fees, or to compel City officials to terminate the service contract of violating employers. 22 EXHIBIT E EQUAL EMPLOYMENT OPPORTUNITY PRACTICES PROVISIONS A. Contractor certifies and represents that, during the performance of this Agreement, the contractor and each subcontractor shall adhere to equal opportunity employment practices to assure that applicants and employees are treated equally and are not discriminated against because of their race, religious creed, color, national origin, ancestry, handicap, sex, or age. Contractor further certifies that it will not maintain any segregated facilities. B. Contractor agrees that it shall, in all solicitations or advertisements for applicants for employment placed by or on behalf of Contractor, state that it is an "Equal Opportunity Employer" or that all qualified applicants will receive consideration for employment without regard to their race, religious creed, color, national origin, ancestry, handicap, sex or age. C. Contractor agrees that it shall, if requested to do so by the City, certify that it has not, in the performance of this Agreement, discriminated against applicants or employees because of their membership in a protected class. D. Contractor agrees to provide the City with access to, and, if requested to do so by City, through its awarding authority, provide copies of all of its records pertaining or relating to its employment practices, except to the extent such records or portions of such records are confidential or privileged under state or federal law. E. Nothing contained in this Agreement shall be construed in any manner as to require or permit any act which is prohibited by law. City Council Agenda Item Report Agenda Item No. COV-310-2020 Submitted by: Veronica Petrosyan Submitting Department: Health and Environmental Control Department Meeting Date: September 1, 2020 SUBJECT Memorandum of Understanding with the University of Southern California (USC) for Corona Virus-19 (COVID-19) Vaccine Trial Recommendation: Approve the Memorandum of Understanding between the City of Vernon and USC, in substantially the same form as submitted, for COVID-19 vaccine trial. Background: On March 14, 2020, the City of Vernon declared a local and public health emergency in response to the increased spread of the coronavirus-2019 (COVID-19) across the country. As part of the U.S. government response, Keck School of Medicine of USC (USC) is enrolling volunteers in a multi-center clinical trial to determine if an experimental vaccine known as AZD1222 provides protection against COVID-19. The trial will also test if the study vaccine can reduce the severity of COVID-19 illness in those who become infected. One of the goals for USC is to enroll participants at the greatest risk of contracting COVID-19, such as those from the Latino and Black communities, those older than 65, and factory workers. Due to its high concentrations of factories and warehouses and large number of essential workers, USC identified the City of Vernon as a prime location to enroll participants by setting up a satellite location for the vaccine trial. As a satellite location, the City of Vernon will provide space and utility services for USC to set up two (2) stationary trailers to conduct the vaccine study. The City’s involvement with the COVID-19 vaccine trial would be a monumental effort that would be of great significance not only in the United States, but for the entire world. Staff recommends that the City Council approve the Memorandum of Understanding with USC to support the COVID-19 vaccine trial. The proposed Memorandum of Understanding has been reviewed and approved as to form by the Office of the City Attorney. Fiscal Impact: The satellite location for the COVID-19 vaccine trial will not pose a financial impact to the City of Vernon. Attachments: 1. MOU with USC CITY OF VERNON MEMORANDUM OF UNDERSTANDING BETWEEN CITY OF VERNON AND UNIVERSITY OF SOUTHERN CALIFORNIA PREFACE This Memorandum of Understanding (“MOU”) is entered into this September 1, 2020, by and between the City of Vernon and the University of Southern California (hereafter referred to as “Provider”). BACKGROUND On March 14, 2020, the City of Vernon declared a local and public health emergency in response to the increased spread of the coronavirus-2019 (COVID-19) across the country. As part of the U.S. government response to the COVID-19 pandemic, the Provider who is part of a nationwide network called the CoVPN is helping NIH study vaccines for COVID-19. One of the Provider goals is to enroll populations at high risk of acquiring or having complications of COVID-19 in specific industries such as healthcare and the meatpacking industry. The study entails a Phase III Randomized, Double-blind, Placebo-controlled Multicenter Study in Adults to Determine the Safety, Efficacy, and Immunogenicity of AZD1222, a Non-replicating ChAdOx1 Vector Vaccine, for the Prevention of COVID-19. To support the study, the City of Vernon is collaborating with the Provider by providing space and utilities for two (2) stationary trailers that will use for the study. The study sponsor will supply the trailers via the Logistics Civil Augmentation Program (LOGCAP https://www.kbr.com/en/experience/logistics-civil-augmentation-program-logcap). All internal supplies to include personal protective equipment (PPE) will be provided by the study team. I.TERM OF MOU This MOU will be effective upon the date written above and shall continue through September 1, 2023, unless sooner terminated according to Section III, “Termination”. II.DISPUTE Any disputes between City of Vernon and Provider regarding the performance of services reflected in this MOU will be brought to the attention of the City Administrator of the City of Vernon. Any such dispute(s) shall be resolved by and final binding arbitration in California. MOU with University of Southern California Page 2 of 5 III.TERMINATION Either party may terminate this MOU at any time, with or without cause, upon giving at least thirty (30) calendar days’ advance written notice to the other party. Any written notice of termination shall state the future date that termination shall become effective. IV.INDEMNIFICATION Provider agrees to defend, indemnify, and hold harmless the City of Vernon, its officials (elected and appointed), agents, and employees from any and all third- party claims, lawsuits, or liability arising out of, in connection with, or incident to any loss, damage or injury to persons or property, including death, in proportion to and to the extent arising from the negligence or willful misconduct of Provider, its agents, volunteers, employees, subcontractors or invitees while engaging in the activities pursuant to this MOU, except for the wrongful or negligent acts of the City of Vernon. V.DESCRIPTION OF SERVICES A. PROVIDER RESPONSIBILITIES Provider shall perform all of the following duties as part of its obligation under this MOU with City of Vernon: Provide 2 fully equipped trailers to conduct study visits related to COVID-19 Vaccine Study Protocol: D8110C00001: A Phase III Randomized, Double- blind, Placebo-controlled Multicenter Study in Adults to Determine the Safety, Efficacy, and Immunogenicity of AZD1222, a Non-replicating ChAdOx1 Vector Vaccine, for the Prevention of COVID-19 and to be installed by City of Vernon at city’s designated location. Study visits to be performed by USC research personnel. B. CITY OF VERNON RESPONSIBILITIES The City of Vernon, shall perform all of the following duties as part of its obligation under this MOU with Provider: Provide designated spaces for the two trailers Provide electrical, water, and sewer connections/hookups for the trailers Provide storage space for auxiliary support materials, if needed Assist with the recruitment of businesses in the City of Vernon for participation of the COVID-19 vaccine trial By entering into this MOU, the City is not guaranteeing securing business or individual employee participation in the COVID-19 trial. MOU with University of Southern California Page 3 of 5 VI.AMENDMENTS It is mutually agreed that this MOU may be modified or amended by mutual consent, and such modification shall be in writing and effective upon the execution of a written amendment of this MOU by both parties hereto. VII.COST No reimbursement or compensation will be made by either party to the other for the responsibilities described herein. VIII.MISCELLANEOUS Neither party shall be deemed in default of this MOU to the extent that performance of its obligations or attempts to cure any breach are delayed, restricted or prevented by reason of any acts of God, medical epidemic or pandemic, government-imposed quarantine, fire, natural disaster, an act of government, strikes or labor disputes, inability to provide materials, power or supplies, or any other act or condition beyond the reasonable control of any of the parties. EXCEPT AS EXPRESSLY SET FORTH IN THIS MOU, PROVIDER DISCLAIMS ANY AND ALL EXPRESS WARRANTIES, WARRANTIES OF FITNESS FOR A PARTICULAR PURPOSE AND IMPLIED WARRANTIES OF MERCHANTABILITY, OR OTHER EXPRESS OR IMPLIED WARRANTIES OF ANY KIND. NOTWITHSTANDING ANYTHING TO THE CONTRARY CONTAINED HEREIN, TO THE MAXIMUM EXTENT PERMITTED BY LAW, IN NO EVENT WILL EITHER PARTY BE RESPONSIBLE FOR ANY INCIDENTAL, CONSEQUENTIAL, INDIRECT, SPECIAL, PUNITIVE, OR EXEMPLARY DAMAGES OF ANY KIND, INCLUDING DAMAGES FOR LOST GOODWILL, LOST PROFITS, LOST BUSINESS OR OTHER INDIRECT ECONOMIC DAMAGES, WHETHER SUCH CLAIM IS BASED ON CONTRACT, NEGLIGENCE, TORT (INCLUDING STRICT LIABILITY) OR OTHER LEGAL THEORY, AS A RESULT OF A BREACH OF ANY WARRANTY OR ANY OTHER TERM OF THIS MOU, AND REGARDLESS OF WHETHER A PARTY WAS ADVISED OR HAD REASON TO KNOW OF THE POSSIBILITY OF SUCH DAMAGES IN ADVANCE. MOU with University of Southern California Page 4 of 5 IX.DESIGNATION OF RESPONSIBLE PARTIES The following persons, identified by position and title, have been designated as the responsible parties for all communications, including required notices, related of this MOU: City of Vernon Contacts: Name:Freddie Agyin, MA, REHS Title:Director of Health and Environmental Control Address:4305 South Santa Fe Avenue, Vernon, CA 90058 Phone:(323) 826-1448 E-mail:fagyin@ci.vernon.ca.us University of Southern California Contact: Name:Luis M. Mendez Title:Study Coordinator Address:University of Southern California CRS 1201 1300 N. Mission Rd., Room 349 Los Angeles, CA 90033 Phone:(323) 409-8283 E-mail:lmendez@usc.edu IN WITNESS HEREOF, THE PARTIES HERETO HAVE CAUSED THIS MOU TO BE DULY EXECUTED ON THE DAY MONTH, AND YEAR INDICATED ON PAGE 1. CITY OF VERNON ___________________________________________ CARLOS R. FANDINO, JR., DATE City Administrator ATTEST:APPROVED AS TO FORM: ____________________________________________________ LISA POPE, City Clerk ARNOLD M. ALVAREZ-GLASMAN, Interim City Attorney MOU with University of Southern California Page 5 of 5 Attachment A Scope of Work The University of Southern California Clinical Research Site 1201 will provide 2 fully equipped trailers to conduct study visits related to COVID-19 Vaccine Study Protocol: D8110C00001: A Phase III Randomized, Double-blind, Placebo-controlled Multicenter Study in Adults to Determine the Safety, Efficacy, and Immunogenicity of AZD1222, a Non-replicating ChAdOx1 Vector Vaccine, for the Prevention of COVID-19 and to be installed by City of Vernon at city’s designated location. Study visits to be performed by USC research personnel under the oversight of Michael P. Dube, MD, Principal Investigator. City Council Agenda Item Report Agenda Item No. COV-317-2020 Submitted by: Daniel Wall Submitting Department: Public Works Meeting Date: September 1, 2020 SUBJECT Contract for Fire Station Remodeling Required for Transition to the Consolidated Fire Protection District of Los Angeles County (LA County Fire) Recommendation: A. Find that approval of the proposed action is categorically exempt from California Environmental Quality Act (CEQA) review, in accordance with CEQA Guidelines Sections 15301 - 15332 for Class 1: Existing Facilities; B. Accept the bid from Fasone Construction, Inc.; C. Approve and authorize the City Administrator to execute a contract with Fasone, Construction Inc. in substantially the same form as submitted, in an amount not to exceed $547,034.72 for the required remodeling of Fire Station 76; and D. Authorize a contingency amount of $25,000 in the event of an unexpected changed condition in the project and grant authority to the City Administrator to issue Change Orders for an amount up to the contingency amount, if necessary. Background: On May 19, 2020, the Vernon City Council adopted Resolution 2020-12 authorizing the transfer of the City’s Fire Department to the Consolidated Fire Protection District of Los Angeles County (LA County Fire) for fire protection, paramedic and incidental services within the City. As part of the Agreement for Services By and Between the Consolidated Fire Protection District of Los Angeles County and the City of Vernon (Agreement), the parties agreed that any non-routine repairs in excess of $100,000 are major repairs and are the responsibility of the City. The City is obligated to make such repairs as identified by LA County Fire and agreed upon by the City Administrator. The provisions of the Agreement impose upon the City the obligation to conduct the repairs requested by LA County Fire in a manner acceptable and under the standards established by LA County Fire. LA County Fire has identified one-time conversion costs or repairs. City staff has reviewed the proposed repairs and will continue to work with LA County Fire to facilitate the necessary renovations required for each of the Fire Stations that will be occupied by LA County Fire personnel. Specifically, at Fire Station 76, there are five interior construction conversion items with a combined LA County Fire estimated cost of $666,250. These items are: *Privacy and Access Modifications *Turnout Room improvements *Kitchen Remodel *Bathroom reconstruction *Electrical Upgrades LA County Fire has identified Fasone Construction, a construction company that they have utilized in the past, to perform the repairs noted above since this vendor is familiar with the standards and specifications of LA County Fire. Fasone Construction provided a bid to the City of $547,034.72 to do this work; this is a savings of $119,215.28 from LA County Fire's estimate. As previously stated, Fasone Construction has performed work for LA County Fire in the past, is a county approved vendor, and has been regarded as a trusted partner in equivalent projects. The work proposed to be completed by Fasone Construction at Fire Station 76 in Vernon has been approved by LA County Fire's project management team, as plans meet the stringent project specifications set forth by the agency to provide standardized live/work environments for Fire personnel. Due to the highly specialized construction/rehabilitation requirements of LA County Fire and their endorsement of the firm, the selection of Fasone Construction is exempt from the City’s competitive bidding pursuant to Section 2.17.12(A)(2) which states that services are available from only one vendor for unique services. Staff consulted with the Interim City Attorney who confirmed that a direct award of this contract is permitted based upon the terms and conditions of the Agreement between the City and LA County Fire and other allowed exceptions under Vernon’s Municipal Code and Purchasing Policies. It is, therefore, recommended by staff that the City Council approve the contract with Fasone Construction in order to recognize the savings noted above and to fulfill the specific needs and requirements of LA County Fire. With the impending LA County Fire transition scheduled to occur in late October 2020, there is a limited window of time in which the City may establish a contract with a vendor directly, independent of LA County Fire. After November 1st, if such a contract is not yet in effect, LA County Fire will lead the effort in the construction/renovation project and all costs (including related administrative fees) will be passed on to the City. If the City opts to allow LA County Fire to coordinate the execution of the required construction, the City's opportunity to capitalize on any savings will be forfeited, and the project will be completed at a higher overall cost. The proposed contract has been reviewed and approved as to form by the City Attorney's Office. Fiscal Impact: An amount of $1,150,000 was budgeted in account 011.1049 for Fiscal Year 2020-2021 under "Misc Fire Station Upgrades for Transfer". The cost of the contract with Fasone Construction is $547,034.72, a savings of over $119,000 compared to LA County Fire's estimate for this work. Therefore, sufficient funds are available to cover the cost of this project. Attachments: 1. CS-1266 - Fire Station 76 Dormitory, Kitchen & Bathroom Improvements 2. LA County Fire Conversion Cost Estimates 1 June 2020 LABOR AND MATERIALS CONTRACT BETWEEN THE CITY OF VERNON AND FASONE CONSTRUCTION FOR CONTRACT NO. CS-1266 – DORMITORY, KITCHEN AND BATHROOM IMPROVEMENTS AT VERNON FIRE STATION NO. 76 COVER PAGE Contractor: Fasone Construction Responsible Principal of Contractor: Leonardo Vargas, Vice-president of Construction and Development Notice Information - Contractor: Fasone Construction 9124 Norwalk Boulevard Santa Fe Springs, CA 90670 Attention: Leonardo Vargas, Vice-president Of Construction and Development Phone: (562) 948-3349 Facsimile: (562) 948-4509 Notice Information - City: City of Vernon 4305 Santa Fe Avenue Vernon, CA 90058 Attention: Daniel S. Wall Director of Public W orks Telephone: (323) 583-8811 ext. 305 Facsimile: (323) 826-1435 Commencement Date: September 14, 2020 Termination Date: December 13, 2020 Consideration: Total not to exceed $547,034.72 (includes all applicable sales tax); and more particularly described in Exhibit C Records Retention Period Three (3) years, pursuant to Section 8.3 2 June 2020 LABOR AND MATERIALS CONTRACT BETWEEN THE CITY OF VERNON AND FASONE CONSTRUCTION FOR CONTRACT NO. CS-1266 – DORMITORY, KITCHEN AND BATHROOM IMPROVEMENTS AT VERNON FIRE STATION NO. 76 This Contract is made between the CITY OF VERNON ("City"), a California charter City and California municipal corporation, and Fasone Construction, a California corporation, with headquarters located at 9124 Norwalk Boulevard, Santa Fe Springs, CA 90670 (“Contractor”). The City and Contractor agree as follows: 1.0 Contractor shall furnish all necessary and incidental labor, material, equipment, transportation and services as described in, and strictly in accordance with, and subject to all terms and conditions set forth in Specifications for CONTRACT NO. CS-1266 – DORMITORY, KITCHEN AND BATHROOM IMPROVEMENTS AT VERNON FIRE STATION NO. 76, as more fully set forth in the Specifications, attached hereto and incorporated herein by reference as Exhibit “A”, and set forth in the Special Provisions attached hereto and incorporated herein by reference as Exhibit “B.” 2.0 All work shall be done in a manner satisfactory to the City’s Director of Public Works (the “Director”), or the Director’s designee, in writing, and shall be of highest quality with respect to the contract specifications. In the event Contractor fails to perform satisfactorily the City shall advise Contractor in writing, and Contractor shall have thirty (30) days to cure such failure to satisfactorily perform. If Contractor fails to so cure its performance within said 30 days, the City may, at its option, terminate this Contract for default without further liability, other than payment to Contractor for work performed satisfactorily prior to the date of termination. 3.0 Contractor shall commence work upon the signing of this contract and shall perform work requested in writing by Director. 4.0 In consideration of satisfactory and timely Performance of requested work pursuant to the Schedule set forth in Exhibit “C,” which is attached hereto and incorporated herein by reference, the City shall pay Contractor as follows: The bid amounts, according to the requested and accepted price set forth in the Contractor’s bid proposal, attached hereto and incorporated herein by reference as Exhibit “C”. The total amount to be paid to the Contractor during the term of this contract shall not exceed Five Hundred and Forty Seven Thousand, Thirty Four Dollars, and Seventy Two Cents ($547,034.72) without the prior approval of the City Administrator and without a written amendment of this contract. 5.0 Concurrently with the execution of this Contract, Contractor shall furnish bonds of a surety satisfactory to the City, as provided in the specifications. The cost of the bonds shall be paid by Contractor. 3 June 2020 6.0 GENERAL TERMS AND CONDITIONS. 6.1 INDEPENDENT CONTRACTOR. 6.1.1 It is understood that in the performance of the services herein provided for, Contractor shall be, and is, an independent contractor, and is not an agent or employee of City and shall furnish such services in its own manner and method except as required by this Contract. Further, Contractor has and shall retain the right to exercise full control over the employment, direction, compensation and discharge of all persons employed by Contractor in the performance of the services hereunder. Contractor shall be solely responsible for, and shall indemnify, defend and save City harmless from all matters relating to the payment of its employees, including compliance with social security, withholding and all other wages, salaries, benefits, taxes, exactions, and regulations of any nature whatsoever. 6.1.2 Contractor acknowledges that Contractor and any subcontractors, agents or employees employed by Contractor shall not, under any circumstances, be considered employees of the City, and that they shall not be entitled to any of the benefits or rights afforded employees of City, including, but not limited to, sick leave, vacation leave, holiday pay, Public Employees Retirement System benefits, or health, life, dental, long-term disability or workers' compensation insurance benefits. 6.2 CONTRACTOR NOT AGENT. Except as the City may authorize in writing, Contractor and its subcontractors, if any, shall have no authority, express or implied, to act on behalf of or bind the City in any capacity whatsoever as agents or otherwise. 6.3 OWNERSHIP OF WORK. All reports, drawings, plans, specifications, computer tapes, floppy disks and printouts, studies, memoranda, computation sheets and other documents prepared by Contractor in furtherance of the work shall be the sole property of City and shall be delivered to City whenever requested. Contractor shall keep such documents and materials on file and available for audit by the City for at least three (3) years after completion or earlier termination of this Contract. Contractor may make duplicate copies of such materials and documents for its own files or for such other purposes as may be authorized in writing by the City. 6.4 CORRECTION OF WORK. Contractor shall promptly correct any defective, inaccurate or incomplete tasks, deliverables, goods, services and other work, without additional cost to the City. The performance or acceptance of services furnished by Contractor shall not relieve the Contractor from the obligation to correct subsequently discovered defects, inaccuracy or incompleteness. 6.5 WAIVER. The City's waiver of any term, condition, breach or default of this Contract shall not be considered to be a waiver of any other term, condition, default or breach, nor of a subsequent breach of the one waived. 6.6 SUCCESSORS. This Contract shall inure to the benefit of, and shall be binding upon, the parties hereto and their respective heirs, successors and/or assigns. 6.7 NO ASSIGNMENT. Contractor shall not assign or transfer this Contract or any rights hereunder without the prior written consent of the City and approval by the City Attorney, which may be withheld in the City's sole discretion. Any unauthorized assignment or transfer shall be null and void and shall constitute a material breach by the Contractor of its 4 June 2020 obligations under this Contract. No assignment shall release the original parties or otherwise constitute a novation. 6.8 COMPLIANCE WITH LAWS. Contractor shall comply with all Federal, State, County and City laws, ordinances, resolutions, rules and regulations, which are, as amended from time to time, incorporated herein and applicable to the performance hereof. 6.9 ATTORNEY'S FEES. If any action at law or in equity is brought to enforce or interpret the terms of this Contract, the prevailing party shall be entitled to reasonable attorney's fees, costs and necessary disbursements in addition to any other relief to which such party may be entitled. 7.0 INTERPRETATION. 7.1 APPLICABLE LAW. This Contract, and the rights and duties of the parties hereunder (both procedural and substantive), shall be governed by and construed according to the laws of the State of California, without regards to its conflict of laws rules. 7.2 ENTIRE AGREEMENT. This Contract, including any Exhibits attached hereto, constitutes the entire agreement and understanding between the parties regarding its subject matter and supersedes all prior or contemporaneous negotiations, representations, understandings, correspondence, documentation and agreements (written or oral). 7.3 WRITTEN AMENDMENT. This Contract may only be changed by written amendment signed by Contractor and the City Administrator or other authorized representative of the City, subject to any requisite authorization by the City Council. Any oral representations or modifications concerning this Contract shall be of no force or effect. 7.4 SEVERABILITY. If any provision in this Contract is held by any court of competent jurisdiction to be invalid, illegal, void, or unenforceable, such portion shall be deemed severed from this Contract, and the remaining provisions shall nevertheless continue in full force and effect as fully as though such invalid, illegal, or unenforceable portion had never been part of this Contract. 7.5 ORDER OF PRECEDENCE. In case of conflict between the terms of this Contract and the terms contained in any document attached as an Exhibit or otherwise incorporated by reference, the terms of this Contract shall strictly prevail. The terms of the City's Specifications shall control over the Contractor's bid. 7.6 CHOICE OF FORUM. The parties hereby agree that this Contract is to be enforced in accordance with the laws of the State of California, is entered into in the City of Vernon and that all claims or controversies arising out of or related to performance under this Contract shall be submitted to and resolved in a forum within the County of Los Angeles at a place to be determined by the rules of the forum. 7.7 DUPLICATE ORIGINALS. There shall be two (2) fully signed copies of this Contract, each of which shall be deemed an original. 7.8 TIME OF ESSENCE. Time is strictly of the essence of this Contract and each and every covenant, term and provision hereof. 5 June 2020 7.9 AUTHORITY OF CONTRACTOR. The Contractor hereby represents and warrants to the City that the Contractor has the right, power, legal capacity and authority to enter into and perform its obligations under this Contract, and its execution of this Contract has been duly authorized. 7.10 ARBITRATION OF DISPUTES. Any dispute for under $25,000 arising out of or relating to the negotiation, construction, performance, non-performance, breach or any other aspect of this Contract, shall be settled by binding arbitration in accordance with the Commercial Rules of the American Arbitration Association at Los Angeles, California and judgment upon the award rendered by the Arbitrators may be entered in any court having jurisdiction thereof. This clause shall not preclude the Parties from seeking provisional remedies in aid of arbitration from a court of appropriate jurisdiction. The City does not waive its right to object to the timeliness or sufficiency of any claim filed or required to be filed against the City and reserves the right to conduct full discovery. 7.11 INDEMNITY. 7.11.1 Contractor agrees to indemnify, hold harmless and defend (even if the allegations are false, fraudulent or groundless), to the maximum extent permitted by law, the City, its City Council and each member thereof, and its officers, employees, commission members and representatives, from any and all liability, loss, suits, claims, damages, costs, judgments and expenses (including attorney's fees and costs of litigation) which in whole or in part result from, or arise out of, or are claimed to result from or to arise out of: A. any activity on or use of City's premises or facilities or any performance under this Contract; or B. any acts, errors or omissions (including, without limitation, professional negligence) of Contractor, its employees, representatives, subcontractors, or agents in connection with the performance of this Contract. 7.11.2 This agreement to indemnify includes, but is not limited to, personal injury (including death at any time) and property or other damage (including, but without limitation, contract or tort or patent, copyright, trade secret or trademark infringement) sustained by any person or persons (including, but not limited to, companies, or corporations, Contractor and its employees or agents, and members of the general public). The sole negligence or willful misconduct of City, its employees or agents other than Contractor or Contractor’s subcontractors are excluded from this indemnity agreement. 7.12 RELEASE. Contractor agrees to release and covenants not to sue the City, its City Council and each member thereof, and its officers, employees, commission members and representatives for any damage or injury (including death) to itself, its officers, employees, agents and independent contractors damaged or claiming to be damaged from any performance under this Contract. 6 June 2020 7.13 INSURANCE. Contractor shall, at its own expense, procure and maintain policies of insurance of the types and in the amounts set forth below, for the duration of the Contract, including any extensions thereto. The policies shall state that they afford primary coverage. 7.13.1 Automobile Liability with minimum limits of at least $1,000,000 combined single limit including owned, hired, and non-owned liability coverage. (1) Contractor agrees to subrogate automobile liability resulting from performance under this agreement by agreeing to defend, indemnify and hold harmless, the City, and its respective employees, agents, and City Council from and against all claims, liabilities, suits, losses, damages, injuries and expenses, including all costs and reasonable attorney’s fees (“Claims”), which are attributable to any act or omission by the City under the performance of the services. 7.13.2 General Liability with minimum limits of at least $1,000,000 per occurrence and $2,000,000 in aggregate written on an Insurance Services Office (ISO) Comprehensive General Liability "occurrence" form or its equivalent for coverage on an occurrence basis. Premises/Operations and Personal Injury coverage is required. The City of Vernon, its directors, commissioners, officers, employees, agents and volunteers must be endorsed on the policy as additional insureds as respects liability arising out of the Contractor's performance of this Contract. A. If Contractor employs other contractors as part of the services rendered, Contractor's Protective Coverage is required. Contractor may include all subcontractors as insureds under its own policy or shall furnish separate insurance for each subcontractor, meeting the requirements set forth herein. B. Blanket Contractual Coverage. C. Products/Completed Operations coverage. D. Contractor agrees to subrogate General Liability resulting from performance under this agreement by agreeing to defend, indemnify and hold harmless, the City, and its respective employees, agents, and City Council from and against all claims, liabilities, suits, losses, damages, injuries and expenses, including all costs and reasonable attorney’s fees (“Claims”), which are attributable to any act or omission by the City under the performance of the services. 7.13.3 Errors and Omissions coverage in a sum of at least $1,000,000, where such risk is applicable. Applicable aggregates must be identified and claims history provided to determine amounts remaining under the aggregate. Contractor shall maintain such coverage for at least one (1) year after the termination of this Agreement. 7 June 2020 7.13.4 Contractor shall comply with the applicable sections of the California Labor Code concerning workers' compensation for injuries on the job. Compliance is accomplished in one of the following manners: A. Provide copy of permissive self-insurance certificate approved by the State of California; or B. Secure and maintain in force a policy of workers' compensation insurance with statutory limits and Employer's Liability Insurance with a minimal limit of $1,000,000 per accident. The policy shall be endorsed to waive all rights of subrogation against City, its directors, commissioners, officers, employees, and volunteers for losses arising from performance of this Contract; or C. Provide a "waiver" form certifying that no employees subject to the Labor Code's Workers' Compensation provision will be used in performance of this Contract. 7.13.5 Each insurance policy included in this clause shall be endorsed to state that coverage shall not be cancelled except after thirty (30) days' prior written notice to City. 7.13.6 Insurance shall be placed with insurers with a Best's rating of no less than AVIII. 7.13.7 Prior to commencement of performance, Contractor shall furnish City with a certificate of insurance for each policy. Each certificate is to be signed by a person authorized by that insurer to bind coverage on its behalf. The certificate(s) must be in a form approved by City. City may require complete, certified copies of any or all policies at any time. 7.13.8 Failure to maintain required insurance at all times shall constitute a default and material breach. In such event, Contractor shall immediately notify City and cease all performance under this Contract until further directed by the City. In the absence of satisfactory insurance coverage, City may, at its option: (a) procure insurance with collection rights for premiums, attorney's fees and costs against Contractor by way of set-off or recoupment from sums due Contractor, at City's option; (b) immediately terminate this Contract; or (c) self insure the risk, with all damages and costs incurred, by judgment, settlement or otherwise, including attorney's fees and costs, being collectible from Contractor, by way of set-off or recoupment from any sums due Contractor. 7.14 NOTICES. Any notice or demand to be given by one party to the other shall be given in writing and by personal delivery or prepaid first-class, registered or certified mail, addressed as follows. Notice simply to the City of Vernon or any other City department is not adequate notice. 8 June 2020 If to the City: City of Vernon Attn: Daniel Wall, Director of Public Works 4305 Santa Fe Avenue Vernon, CA 90058 With a Copy to: Carlos R. Fandino, Jr. City Administrator City of Vernon 4305 Santa Fe Avenue Vernon, CA 90058 If to the Contractor: Fasone Construction Attn: Leonardo Vargas, Vice-President of Construction and Development 9124 Norwalk Boulevard Santa Fe Springs, CA 90670 Any such notice shall be deemed to have been given upon delivery, if personally delivered, or, if mailed, upon receipt or upon expiration of three (3) business days from the date of posting, whichever is earlier. Either party may change the address at which it desires to receive notice upon giving written notice of such request to the other party. 7.15 TERMINATION FOR CONVENIENCE (Without Cause). City may terminate this Contract in whole or in part at any time, for any cause or without cause, upon fifteen (15) calendar days' written notice to Contractor. If the Contract is thus terminated by City for reasons other than Contractor's failure to perform its obligations, City shall pay Contractor a prorated amount based on the services satisfactorily completed and accepted prior to the effective date of termination. Such payment shall be Contractor's exclusive remedy for termination without cause. 7.16 DEFAULT. In the event either party materially defaults in its obligations hereunder, the other party may declare a default and terminate this Contract by written notice to the defaulting party. The notice shall specify the basis for the default. The Contract shall terminate unless such default is cured before the effective date of termination stated in such notice, which date shall be no sooner than ten (10) days after the date of the notice. Termination for cause shall relieve the terminating party of further liability or responsibility under this Contract, including the payment of money, except for payment for services satisfactorily and timely performed prior to the service of the notice of termination, and except for reimbursement of (1) any payments made by the City for service not subsequently performed in a timely and satisfactory manner, and (2) costs incurred by the City in obtaining substitute performance. 7.17 ASSIGNMENT OF ANTITRUST CAUSES OF ACTION. Contractor hereby agrees to assign to the City all rights, title and interest in and to all causes of action it may have under Section 4 of the Clayton Act (15 U.S.C. § 15) or under Chapter 2 of the Cartwright Act (commencing with Section 16700) or part 2 of Division 7 of the California Business and Professions Code, or any similar or successor provisions of Federal or State law, arising from purchases of goods, services or materials pursuant to this Contract or any 9 June 2020 subcontract. This assignment shall be made and become effective at the time the City tenders final payment to the Contractor, without further acknowledgment by the parties. 8.0 ADDITIONAL ASSURANCES 8.1 EQUAL EMPLOYMENT OPPORTUNITY PRACTICES. Contractor certifies and represents that, during the performance of this Contract, the Contractor and any other parties with whom it may subcontract shall adhere to equal opportunity employment practices to assure that applicants and employees are treated equally and are not discriminated against because of their race, religion, color, national origin, ancestry, disability, sex, age, medical condition, marital status. Contractor further certifies that it will not maintain any segregated facilities. Contractor further agrees to comply with The Equal Employment Opportunity Practices provisions as set forth in Exhibit “D”. 8.2 VERNON BUSINESS LICENSE. Contractor shall obtain, and pay any and all costs associated therewith, any Vernon Business License which may be required by the Vernon Municipal Code. 8.3 MAINTENANCE AND INSPECTION OF RECORDS. The City, or its authorized auditors or representatives, shall have access to and the right to audit and reproduce any of the Contractor's records to the extent the City deems necessary to insure it is receiving all money to which it is entitled under the Contract and/or is paying only the amounts to which Contractor is properly entitled under the Contract or for other purposes relating to the Contract. The Contractor shall maintain and preserve all such records for a period of at least 3 years after termination of the Contract. The Contractor shall maintain all such records in the City of Vernon. If not, the Contractor shall, upon request, promptly deliver the records to the City of Vernon or reimburse the City for all reasonable and extra costs incurred in conducting the audit at a location other than the City of Vernon, including, but not limited to, such additional (out of the City) expenses for personnel, salaries, private auditors, travel, lodging, meals and overhead. 8.4 CONFLICT. Contractor hereby represents, warrants and certifies that no member, officer or employee of the Contractor is a director, officer or employee of the City of Vernon, or a member of any of its boards, commissions or committees, except to the extent permitted by law. 8.5 ENFORCEMENT OF WAGE AND HOUR LAWS. Eight hours labor constitutes a legal day's work. The Contractor, or subcontractor, if any, shall forfeit twenty-five dollars ($25) for each worker employed in the execution of this Contract by the respective Contractor or subcontractor for each calendar day during which the worker is required or permitted to work more than 8 hours in any one calendar day and 40 hours in any one calendar week in violation of the provisions of Sections 1810 through 1815 of the California Labor Code as a penalty paid to the City; provided, however, work performed by employees of contractors in excess of 8 hours per day, and 40 hours during any one week, shall be permitted upon compensation for all hours worked in excess of 8 hours per day at not less than 1½ times the basic rate of pay. 10 June 2020 8.6 LIVING WAGES. Contractor, or Subcontractor, if any, working on City service contracts of any amount, as to all employees spending time on City contracts shall observe the City’s Living Wage Ordinance and all requirements thereof at all times on City contracts. The Current Living Wage Standards are set forth in Exhibit “E”. Upon request, certified payroll shall be provided to the City. 8.7 PREVAILING WAGES. The provisions of California Labor Code 1770, et seq., regarding the payment of prevailing wages on public works, and related regulations, apply to all City contracts. In addition, the selected consultant and/or any subcontractor must be currently registered and qualified (including payment of any required fee) with the State Department of Industrial Relations pursuant to Labor Code section 1725.5. This project is subject to compliance monitoring and enforcement by the State Department of Industrial Relations. If Living Wage Provisions and Prevailing Wage provisions should both apply to this Contract, Contractor and all of its Subcontractors shall pay the higher of the applicable wages to the extent required by law. [Signatures Begin on Next Page]. 11 June 2020 IN WITNESS WHEREOF, the Parties have signed this Agreement as of the Commencement Date stated on the cover page. City of Vernon, a California charter City and California municipal corporation By:____________________________ Carlos Fandino, City Administrator Fasone Construction, a California corporation By: Name: Title: ATTEST: _______________________________ Lisa Pope, City Clerk By: Name: Title: APPROVED AS TO FORM: _______________________________ Arnold M. Alvarez-Glasman, Interim City Attorney 12 June 2020 EXHIBIT A SPECIFICATIONS I-1 GENERAL I-1.01 Contractor Must Make Thorough Investigation It is the Contractor’s responsibility to examine the location of the proposed work, to fully acquaint itself with the Specifications and the nature of the work to be done. Contactor shall have no claim against the City based upon ignorance of the nature and requirements of the project, misapprehension of site conditions, or misunderstanding of the Specifications or contract provisions. I-1.02 Ineligibility to Contract If Contractor has been found by the State Labor Commissioner to be in violation of Sections 1777.1 and 1777.7 of the Labor Code Sections entitled “Public Works” Contractor shall be ineligible to be awarded a contract for this project. The period of debarment shall be not less than one year and up to three years as determined pursuant to Section 1777.7 of the Labor Code. The Contractor certifies that it is aware of these provisions and is eligible to bid on this contract. The Contractor shall also be prohibited from performing work on this project with a subcontractor who is ineligible to perform work on a public works project pursuant to Section 1777.1 or 1777.7 of the Labor Code. The Contractor certifies that it has investigated the eligibility of each and every subcontractor it intends to use on this project and has determined that none is ineligible to perform work pursuant to the above provisions of law. I-1.03 Patent Fees; Patent, Copyright, Trade Secret and Trademark Fees The Contractor cost shall include in the price bid any patent fees, royalties and charges on any patented article or process to be furnished or used in the prosecution of the work. I-1.04 Taxes Costs shall include all federal, state, local, and other taxes. I-2 GENERAL SPECIFICATIONS I-2.01 Quantities The quantities contained in the contract documents are approximate only. The City may, in accordance with the Standard Specifications, order more or less work or material as necessary in the City's sole discretion. Payment will be made for the amount of work or material actually provided as determined by the City and accepted at the unit prices noted in Exhibit C. I-2.02 Registration and Qualifications of Contractors Contractor shall be licensed to the extent required by Business and Professions Code Section 7000 et seq. 13 June 2020 I-2.03 Subcontracts Pursuant to California Labor Code §1021.5, the Contractor must not willingly and knowingly enter into any agreement with any person, as an independent contractor, to provide any services in connection with the work where the services provided or to be provided requires that such person hold a valid contractor’s license issued pursuant to California Business and Professions Code §§7000 et seq. and such person does not meet the burden of proof of his/her independent contractor status pursuant to California Labor Code §2750.5. In the event that the Contractor shall employ any person in violation of the foregoing, the Contractor shall be subject to the civil penalties under California Labor Code §1021.5 and any other penalty provided by law. In addition to the penalties provided under California Labor Code §1021.5, the Contractor’s violation of this Paragraph or the provisions of California Labor Code §1021.5 shall be deemed an event of the Contractor’s default. The Contractor must require any Subcontractor of any tier performing or providing any portion of the Work to adhere to and comply with the foregoing provisions. Pursuant to the provisions of Labor Code Section 1777.1, the Labor Commissioner publishes and distributes a list of contractors ineligible to perform work as a subcontractor on a public works project. This list of debarred contractors is available from the Department of Industrial Relations website at: http://www.dir.ca.gov/dlse/debar.html. The Contractor must not employ, hire, use or subcontract with any of the listed debarred contractors. I-2.04 Termination of Contract Section 6-5, entitled “Termination of Contract,” of the Standard Specifications is modified to read: "The City may terminate this contract in whole or in part at any time, for any cause or without cause, upon fifteen (15) calendar days written notice to the Contractor." If the contract is thus terminated by the City for reasons other than the Contractor’s failure to perform its obligations, the City shall pay the Contractor a prorated amount based on the services satisfactorily completed and accepted prior to the effective date of termination. Such payment shall be the Contractor’s exclusive remedy for termination without cause. I-2.05 Partial Payment Payment shall be due the Contractor within thirty (30) calendar days after receipt of an itemized statement for work performed during the progress payment period. I-2.06 Worker’s Compensation Certification California Labor Code §§ 1860 and 3700 provide that every Contractor will be required to secure the payment of compensation to its employees. In accordance with the provisions of California Labor Code § 1861, the Contractor, hereby certifies as follows: “I am aware of the provisions of California Labor Code § 3700 which requires every employer to be insured against liability for worker’s compensation or to undertake self-insurance in accordance with the provisions of that code, and I will comply with such provisions before commencing the performance of the work of this Contract.” 14 June 2020 I-3. CONTRACT BONDS I-3.01 Required Bonds Contractor shall furnish the following bonds: 1. A Performance Bond in an amount equal to one hundred percent (100%) of the total Contract price in the form shown in Exhibit "1" attached hereto. 2. A Payment Bond (Labor and Material) in an amount equal to one hundred percent (100%) of the total Contract price in the form shown in Exhibit "2" attached hereto. 3. A Maintenance Bond in an amount equal to ten percent (10%) of the total Contract price in the form shown in Exhibit "3" attached hereto. I-3.02 Power of Attorney All bonds shall be accompanied by a power of attorney from the surety company authorizing the person executing the bond to sign on behalf of the company. If the bonds are executed outside the State of California, all copies of the bonds must be countersigned by a California representative of the surety. The signature of the person executing the bond on behalf of Surety shall be acknowledged by a Notary Public as the signature of the person designated in the power of attorney. I-3.03 Approved Surety All bonds must be issued by a California admitted surety insurer with the minimum A.M Best Company Financial strength rating of “A: VII”, or better. Bonds issued by a California admitted surety not listed on Treasury Circular 570 will be deemed accepted unless specifically rejected by the City. Bonds issued from admitted surety insurers not listed in Treasury Circular 570 must be accompanied by all documents enumerated in California Code of Civil Procedure Section 995.660. All such bonds must be accompanied by a power of attorney from the surety company authorizing the person executing the bond to sign on behalf of the company. If the bonds are executed outside the State of California, all copies of the bonds must be countersigned by a California representative of the surety. The signature of the person executing the bond on behalf of Surety must be acknowledged by a Notary Public as the signature of the person designated in the power of attorney. I-3.04 Required Provisions Every bond must display the surety’s bond number and incorporate the Contract for construction of the Work by reference. The terms of the bonds shall provide that the surety agrees that no change, extension of time, alteration, or modification of the Contract Documents or the Work to be performed thereunder shall in any way affect its obligations and shall waive notice of any such change, extension of time, alteration, or modification of the Contract Documents. I-3.05 New or Additional Sureties If, during the continuance of the Contract, any of the sureties, in the opinion of the City, are or become non-responsible or otherwise unacceptable to City, City may require other new or additional sureties, which the Contractor shall furnish to the satisfaction of City within ten (10) 15 June 2020 days after notice, and in default thereof the Contract may be suspended and the materials may be purchased or the Work completed as provided in Article 5 herein. I-3.06 Waiver of Modifications and Alterations No modifications or alterations made in the Work to be performed under the Contract or the time of performance shall operate to release any surety from liability on any bond or bonds required to be given herein. Notice of such events shall be waived by the surety. I-3.07 Approval of Bonds The Contract will not be executed by City nor the Notice to Proceed issued until the required bonds have been received and approved by City. City's decision as to the acceptability of all sureties and bonds is final. No substitution of the form of the documents will be permitted without the prior written consent of City. 16 June 2020 EXHIBIT 1 Bond No.: Premium Amount: $ Bond’s Effective Date: PERFORMANCE BOND RECITALS: 1. The City of Vernon, California (“City”), has awarded to (Name, address, and telephone of Contractor) ________________________________________________________________________________ (“Principal”), a Contract (the “Contract”) for the Work described as follows: Specification No. : in Vernon, CA. 2. Principal is required under the terms of the Contract— and all contract documents referenced in it (“Contract Documents”)— to furnish a bond guaranteeing Principal’s faithful performance of the Work. 3. The Contract and Contract Documents, including all their amendments and supplements, are incorporated into this Bond and made a part of it by this reference. OBLIGATION: THEREFORE, for value received, We, Principal and ______________________________________________________________________________________________ (Name, address, and telephone of Surety) ______________________________________________________________________________________ (“Surety”), a duly admitted surety insurer under California’s laws, agree as follows: By this Bond, We jointly and severally obligate and bind ourselves, and our respective heirs, executors, administrators, successors, and assigns to pay City the penal sum of Dollars ($ ) (“the Bonded Sum”), this amount comprising not less than the total Contract Sum, in lawful money of the United States of America. The California Licensed Resident Agent for Surety is: ______________________________________________________________________________________________ (Name, address, and telephone) _________________________. Registered Agent’s California Department of Insurance License No. . THE CONDITION OF THIS BOND’S OBLIGATION IS THAT, if Principal promptly and faithfully performs the undertakings, terms, covenants, conditions, and agreements in the Contract and Contract Documents (including all their amendments and supplements), all within the time and in the manner that those documents specify, then this obligation becomes null and void. Otherwise, this Bond remains in full force and effect, and the following terms and conditions apply to this Bond: 1. This Bond specifically guarantees Principal’s performance of each obligation and all obligations under the Contract and Contract Documents, as they may be amended and supplemented— including, but not limited to, Principal’s liability for liquidated damages, Warranties, Guarantees, Correction, and Maintenance obligations as specified in the Contract and Contract Documents— except that Surety’s total obligation, as described here, will not exceed the Bonded Sum. 2. For those obligations of Principal that survive Final Completion of the Work described in the Contract and Contract Documents, the guarantees in this Bond also survive Final Completion of the Work. 3. When City declares that Principal is in default under the Contract, or Contract Documents, or both, Surety shall promptly: (a) remedy the default; (b) complete the Project according to the Contract Documents’ terms and conditions then in effect; or (c) using a procurement methodology approved by City, select a contractor or contractors— acceptable to City— to complete all of the 17 June 2020 Work, and arrange for a contract between the contractor(s) and City. Surety shall make available, as the Work progresses, sufficient funds to pay the cost of completion less the balance of the Contract Sum, and to pay and perform all obligations of Principal under the Contract and Contract Documents— including other costs and damages for which Surety is liable under this Bond— except that Surety’s total obligation, as described here, will not exceed the Bonded Sum. 4. An alteration, modification, change, addition, deletion, omission, agreement, or supplement to the Contract, Contract Documents, or the nature of the Work performed under the Contract or Contract Documents— including, without limitation, an extension of time for performance— does not, in any way, affect Surety’s obligations under this Bond. Surety waives any notice of alteration, modification, change, addition, deletion, omission, agreement, supplement, or extension of time. 5. Surety’s obligations under this Bond are separate, independent from, and not contingent upon any other surety’s guaranteeing Principal’s faithful performance of the Work. 6. No right of action accrues on this Bond to any entity other than City or its successors and assigns. 7. If an action at law or in equity is necessary to enforce or interpret this Bond’s terms, Surety must pay— in addition to the Bonded Sum— City’s reasonable attorneys’ fees and litigation costs, in an amount the court fixes. 8. Surety shall mail City written notice at least 30 days before: (a) the effective date on which the Surety will cancel, terminate, or withdraw from this Bond; or (b) this Bond becomes void or unenforceable for any reason. On the date set forth below, Principal and Surety duly executed this Bond, with the name of each party appearing below and signed by its representative(s) under the authority of its governing body. Date: PRINCIPAL: SURETY: (Company Name) (Company Name) (Signature) (Signature) By: By: (Name) (Name) Its: Its: (Title) (Title) Address for Serving Notices or Other Documents: Address for Serving Notices or Other Documents:  THIS BOND MUST BE EXECUTED IN TRIPLICATE.  EVIDENCE MUST BE ATTACHED OF THE AUTHORITY OF ANY PERSON SIGNING AS ATTORNEY-IN-FACT.  THE ATTORNEY-IN-FACT’S SIGNATURE MUST BE NOTARIZED.  A CORPORATE SEAL MUST BE IMPRESSED ON THIS FORM WHEN THE PRINCIPAL, OR THE SURETY, OR BOTH, ARE A CORPORATION. APPROVED AS TO SURETY AND APPROVED AS TO FORM: CORPORATE SEAL CORPORATE SEAL 18 June 2020 AMOUNT OF BONDED SUM: By By Director of Public Works City Attorney BOND ACKNOWLEDGMENT FOR SURETY’S ATTORNEY-IN-FACT STATE OF CALIFORNIA ) ) ss. COUNTY OF ) On this day of , 20 , before me, (name), a Notary Public for said County, personally appeared (name), who proved to me on the basis of satisfactory evidence to be the person whose name is subscribed to this instrument as the attorney in fact of , and acknowledged to me that he/she subscribed the name of thereto as principal, and his/he own name as attorney in fact. I certify under PENALTY OF PERJURY under the laws of the State of California that the foregoing paragraph is true and correct. Notary Public SEAL 19 June 2020 EXHIBIT 2 Bond No.: Premium Amount: $ Bond’s Effective Date: PAYMENT BOND (LABOR AND MATERIALS) RECITALS: 1. The City of Vernon, California (“City”), has awarded to __________________________________________________________________________________________ (Name, address, and telephone of Design-Builder) ________________________________________________________________________________ (“Principal”), a Contract (the “Contract”) for the Work described as follows: Specification No. : in Vernon, CA. 2. Principal is required under California Civil Code Sections 3247-3248 and the terms of the Contract— and all contract documents referenced in it (“Contract Documents”)— to furnish a bond guaranteeing Principal’s paying claims, demands, liens, or suits for any work, labor, services, materials, or equipment furnished or used in the Work. 3. The Contract and Contract Documents, including all their amendments and supplements, are incorporated into this Bond and made a part of it by this reference. OBLIGATION: THEREFORE, for value received, We, Principal and ______________________________________________________________________________________________ (Name, address, and telephone of Surety) ______________________________________________________________________________________ (“Surety”), a duly admitted surety insurer under California’s laws, agree as follows: By this Bond, We jointly and severally obligate and bind ourselves, and our respective heirs, executors, administrators, successors, and assigns to pay City the penal sum of Dollars ($ ) (“the Bonded Sum”), this amount comprising not less than the total Contract Sum, in lawful money of the United States of America. The California Licensed Resident Agent for Surety is: ______________________________________________________________________________________________ (Name, address, and telephone) _________________________. Registered Agent’s California Department of Insurance License No. . THE CONDITION OF THIS BOND’S OBLIGATION IS THAT, if Principal or a subcontractor fails to pay (a) any person named in California Civil Code Section 3181, or any successor legislation; (b) any amount due under California’s Unemployment Insurance Code, or any successor legislation, for work or labor performed under the Contract or Contract Documents; or (c) any amount under Unemployment Insurance Code Section 13020, or any successor legislation, that Principal or a subcontractor must deduct, withhold, and pay over to the Employment Development Department from the wages of its employees, for work or labor performed under the Contract or Contract Documents, then Surety shall pay for the same in an amount not-to-exceed the Bonded Sum. Otherwise, this obligation becomes null and void. While this Bond remains in full force and effect, the following terms and conditions apply to this Bond: 20 June 2020 1. This Bond inures to the benefit of any of the persons named in California Civil Code Section 3181, or any successor legislation, giving those persons or their assigns a right of action in any suit brought upon this Bond, unless California Civil Code Section 3267, or any successor legislation, applies. 2. An alteration, modification, change, addition, deletion, omission, agreement, or supplement to the Contract, Contract Documents, or the nature of the Work performed under the Contract or Contract Documents— including, without limitation, an extension of time for performance— does not, in any way, affect Surety’s obligations under this Bond. Surety waives any notice of alteration, modification, change, addition, deletion, omission, agreement, supplement, or extension of time. 3. Surety’s obligations under this Bond are separate, independent from, and not contingent upon any other surety’s paying claims, demands, liens, or suits for any work, labor, services, materials, or equipment furnished or used in the Work. 4. If an action at law or in equity is necessary to enforce or interpret this Bond’s terms, Surety must pay— in addition to the Bonded Sum— City’s reasonable attorneys’ fees and litigation costs, in an amount the court fixes. 5. Surety shall mail City written notice at least 30 days before: (a) the effective date on which the Surety will cancel, terminate, or withdraw from this Bond; or (b) this Bond becomes void or unenforceable for any reason. On the date set forth below, Principal and Surety duly executed this Bond, with the name of each party appearing below and signed by its representative(s) under the authority of its governing body. Date: PRINCIPAL: SURETY: (Company Name) (Company Name) (Signature) (Signature) By: By: (Name) (Name) Its: Its: (Title) (Title) Address for Serving Notices or Other Documents: Address for Serving Notices or Other Documents:  THIS BOND MUST BE EXECUTED IN TRIPLICATE.  EVIDENCE MUST BE ATTACHED OF THE AUTHORITY OF ANY PERSON SIGNING AS ATTORNEY-IN-FACT.  THE ATTORNEY-IN-FACT’S SIGNATURE MUST BE NOTARIZED.  A CORPORATE SEAL MUST BE IMPRESSED ON THIS FORM WHEN THE PRINCIPAL, OR THE SURETY, OR BOTH, ARE A CORPORATION. CORPORATE SEAL CORPORATE SEAL 21 June 2020 APPROVED AS TO SURETY AND APPROVED AS TO FORM: AMOUNT OF BONDED SUM: By By Director of Public Works City Attorney BOND ACKNOWLEDGMENT FOR SURETY’S ATTORNEY-IN-FACT STATE OF CALIFORNIA ) ) ss. COUNTY OF ) On this day of , 20 , before me, (name), a Notary Public for said County, personally appeared (name), who proved to me on the basis of satisfactory evidence to be the person whose name is subscribed to this instrument as the attorney in fact of , and acknowledged to me that he/she subscribed the name of thereto as principal, and his/he own name as attorney in fact. I certify under PENALTY OF PERJURY under the laws of the State of California that the foregoing paragraph is true and correct. Notary Public SEAL 22 June 2020 EXHIBIT 3 Bond No.: Premium Amount: $ Bond’s Effective Date: MAINTENANCE BOND RECITALS: 1. The City of Vernon, California (“City”), has awarded to (Name, address, and telephone of Contractor) ________________________________________________________________________________ (“Principal”), a Contract (the “Contract”) for the Work described as follows: Specification No. : in Vernon, CA. 2. Principal is required under the terms of the Contract— and all contract documents referenced in it (“Contract Documents”)— after completion of the Work and before the filing and recordation of a Notice of Completion for the Work, to furnish a bond to secure claims for Maintenance equal to ten percent (10%) of the total amount of the Contract Which shall hold good for a period of one (1) year from the date the City’s Notice of Completion and Acceptance of the Work is filed with the County Recorder, to protect the City against the result of faulty material or workmanship during that time. 3. The Contract and Contract Documents, including all their amendments and supplements, are incorporated into this Bond and made a part of it by this reference. OBLIGATION: THEREFORE, for value received, We, Principal and ______________________________________________________________________________________________ (Name, address, and telephone of Surety) ______________________________________________________________________________________ (“Surety”), a duly admitted surety insurer under California’s laws, agree as follows: By this Bond, We jointly and severally obligate and bind ourselves, and our respective heirs, executors, administrators, successors, and assigns to pay City the penal sum of Dollars ($ ) (“the Bonded Sum”), this amount comprising not less than ten percent (10%) of the total Contract Sum, in lawful money of the United States of America. The California Licensed Resident Agent for Surety is: ______________________________________________________________________________________________ (Name, address, and telephone) Registered Agent’s California Department of Insurance License No. . THE CONDITION OF THIS BOND’S OBLIGATION IS THAT if the said Principal or any of his or her or its subcontractors, or the heirs, executors, administrators, successors, or assigns or assigns of any, all, or either of them, shall fail to execute within a reasonable amount of time, or fail to respond within seven (7) days with a written schedule acceptable to the City for same, repair or replacement of any and all Work, together with any other adjacent Work which may be displaced by so doing, that proves to be defective in its workmanship or material for the period of one (1) year (except when otherwise required in the Contract to be for a longer period) from the date the City’s Notice of Completion and Acceptance, or equivalent, is filed with the County Recorder, ordinary wear and tear and unusual abuse or neglect excepted with respect to such Work and labor, the Surety herein shall pay for the same, in an amount not exceeding the sum specified in this Bond. 1. When City declares that Principal is in default under the Contract, or Contract Documents, or both, Surety shall promptly remedy the default using a procurement methodology approved by City, select a contractor or contractors— acceptable to City to 23 June 2020 complete all of the Work, and arrange for a contract between the contractor(s) and City. Surety shall make available sufficient funds to pay the cost of repair or replacement of any and all Work and to pay and perform all obligations of Principal under the Contract and Contract Documents— including other costs and damages for which Surety is liable under this Bond except that Surety’s total obligation, as described here, will not exceed the Bonded Sum. 2. Should the condition of this bond be fully performed, then this obligation shall become null and void, otherwise it shall be and remain in full force and effect. 3. Surety, for value received, hereby stipulates and agrees that no change, extension of time, alteration, or addition to the terms of said Contract or to the Work to be performed thereunder or the specifications accompanying the same shall in any manner affect its obligations on this bond, and it does hereby waive notice of any such change, extension, alteration, or addition. 4. Surety’s obligations under this Bond are separate, independent from, and not contingent upon any other surety’s guaranteeing Principal’s faithful performance of the Work. 5. No right of action accrues on this Bond to any entity other than City or its successors and assigns. 6. If an action at law or in equity is necessary to enforce or interpret this Bond’s terms, Surety must pay, in addition to the Bonded Sum, City’s reasonable attorneys’ fees and litigation costs, in an amount the court fixes. 7. Surety shall mail City written notice at least 30 days before: (a) the effective date on which the Surety will cancel, terminate, or withdraw from this Bond; or (b) this Bond becomes void or unenforceable for any reason. 8. Death of the Principal shall not relieve Surety of its obligations hereunder. On the date set forth below, Principal and Surety duly executed this Bond, with the name of each party appearing below and signed by its representative(s) under the authority of its governing body. Date: PRINCIPAL: SURETY: (Company Name) (Company Name) (Signature) (Signature) By: By: (Name) (Name) Its: Its: (Title) (Title) Address for Serving Notices or Other Documents: Address for Serving Notices or Other Documents:  THIS BOND MUST BE EXECUTED IN TRIPLICATE.  EVIDENCE MUST BE ATTACHED OF THE AUTHORITY OF ANY PERSON SIGNING AS ATTORNEY-IN-FACT.  THE ATTORNEY-IN-FACT’S SIGNATURE MUST BE NOTARIZED.  A CORPORATE SEAL MUST BE IMPRESSED ON THIS FORM WHEN THE PRINCIPAL, OR THE SURETY, OR BOTH, ARE A CORPORATION. CORPORATE SEAL CORPORATE SEAL 24 June 2020 APPROVED AS TO SURETY & AMOUNT OF BONDED SUM: APPROVED AS TO FORM: By By Director of Public Works City Attorney BOND ACKNOWLEDGMENT FOR SURETY’S ATTORNEY-IN-FACT STATE OF CALIFORNIA ) ) ss. COUNTY OF ) On this day of , 20 , before me, (name), a Notary Public for said County, personally appeared (name), who proved to me on the basis of satisfactory evidence to be the person whose name is subscribed to this instrument as the attorney in fact of , and acknowledged to me that he/she subscribed the name of thereto as principal, and his/he own name as attorney in fact. I certify under PENALTY OF PERJURY under the laws of the State of California that the foregoing paragraph is true and correct. Notary Public SEAL 25 June 2020 26 June 2020 EXHIBIT B SPECIAL PROVISIONS II-1.01 Scope of Work – The proposed project will consist of remodeling the dormitory, kitchen, and bathroom areas of the Vernon Fire Station No. 76 located at 3375 Fruitland Avenue in the City of Vernon, CA 90058. II-1.02 Length of Contract – All work in this project shall be completed within 90 (ninety) calendar days. II-1.03 Specifications – The work shall be done in accordance with the plans and specifications for City Contract No. CS-1266 -DORMITORY, KITCHEN AND BATHROOM IMPROVEMENTS AT VERNON FIRE STATION NO. 76, The latest edition of the California Building Code, California Plumbing Code, California Mechanical Code, California Electrical Code, California Energy Code, California Green Building Standards Code, The AMERICAN INSTITUTE OF ARCHITECT SPECIFICATIONS, and Part 1 – General Provisions of the “Greenbook” Standard Specifications for Public Works Construction (2015 Edition). II-1.04 Delays and Extensions of Time – The provisions of Section 6-6 entitled "Delays and Extensions of Time" of the Standard Specifications for Public Works Construction (2015) shall apply except as modified and supplemented below. The second paragraph of subsection 6-6.1 is hereby deleted and the following paragraph shall be inserted in its place: No extension of time will be granted for a delay caused by the inability of the Contractor to obtain materials, equipment and labor, except as authorized by the City Engineer. The length of contract time stipulated includes any time which may be required to obtain materials, equipment and labor, and the Contractor in submitting a bid shall be deemed to have ascertained the availability of materials, equipment and labor and considered same in his proposed construction schedule. II-1.05 Quality of Work – The provisions of Section 4-1.1 entitled "Materials and Workmanship" of the Standard Specifications for Public Works Construction (2015) shall apply. In addition, any work deemed unacceptable by the City Engineer, whether a cause is determined or not shall be repaired or replaced by the Contractor at his expense. II-l.06 Liquidated Damages – In accordance with Section 6-9 of the Standard Specifications (2015), for each consecutive calendar day required to complete the work in excess of the time specified herein for its completion, as adjusted in accordance with Section 6-6 of the Standard Specifications for Public Works Construction (2015), the Contractor shall pay to the City, or have withheld from monies due it, the sum of $1,500. II-2.01 Scheduling of Work – The Contractor shall submit his work schedule to the City Engineer at the pre-construction meeting. The construction schedule shall show the sequence of work, critical path and estimated time for completion of each segment of work. This schedule must be reviewed and accepted by the City Engineer before the Contractor will be permitted to begin work. In addition, the Contractor shall submit a detailed schedule forecasting two weeks of work describing each day’s work. This schedule shall be updated and submitted to the City every 27 June 2020 other Monday during the construction period. The Contractor shall give 48 hours notice to the City Engineer prior to the start of the work. II-2.02 Construction Hours – The type of work below will have time restrictions as followed: All work shall occur Monday thru Friday between the hours of 7 a.m. - 4 p.m. Weekend work will be allowed upon approval of the City Engineer II-3.01 General Scope of Work - The contractor shall refer to the construction drawings and project specifications for information regarding the scope of work, which includes the remodeling of the dormitory, kitchen, and bathroom areas of the Vernon Fire Station No. 76. II-4.01 Extra Work – In the event the City and the Contractor are unable to negotiate an agreed price for extra work, which is acceptable to both parties, payment shall be made based on time and materials as follows: a. Work by the Contractor: The following percentages shall be added to the Contractor's cost and shall constitute the markup for all overhead and profits: 1. Labor 20% 2. Materials 15% 3. Equipment Rental 15% 4. Other Items and Expenditures 15% b. Work by the Subcontractor - When all or any part of the extra work is performed by a subcontractor, the above markups shall apply to the aggregate sum of the extra work, regardless of the number of tiers of subcontractors used. In addition, a markup of 5- percent on the subcontracted portion of each extra work may be added by the Contractor. II-4.02 Compliance with Laws. Regulations. and Safe Practices – The Contractor shall perform all work in a safe, competent manner and in accordance with all federal, state, and local statues, regulations, ordinances, rules, and governmental orders. The Contractor will be solely and completely responsible for the conditions of the job site, including safety of all persons and property during performance of the work. This requirement will apply continuously and not be limited to normal working hours. Inspection of the Contractor's performance by the City, its agents, or employees is not intended to include review of the adequacy of the Contractor's safety measures in or near the job site. II-5.01 Noise Restrictions – The noise level from the Contractor's operations shall not exceed 85 dBA when measured within a one hundred (100) foot radius at any time. II-6.01 Construction Order of Work – Work shall be scheduled so as to lessen the impact upon neighboring properties. Requirements – General: 1. All construction shall conform to Sections 6-1 and 6-2 of the 2015 edition of the Standard Specifications for Public Works Construction and shall proceed in a smooth, efficient, 28 June 2020 timely and continuous manner. As such, once construction is started in a work area, the Contractor will be required to work continuously in that work area until construction has been completed 2. Once construction is started in a work area, the Contractor shall not withdraw manpower or equipment from that work area in order to start construction in another work area if doing so, in the opinion of the City Engineer, delays the completion of the work presently under construction. 3. No stockpiling of material and construction equipment in or on areas outside of the construction site will be permitted on this project unless approved by the City Engineer. Upon the review and approval of the City, the Contractor may elect to obtain a storage yard for his materials and construction equipment for the duration of this contract in order that work on this project will proceed in an efficient manner. Said storage yard shall conform to all City regulations, ordinances, and zoning requirements and shall be maintained in a neat and orderly manner. II-7.01 Character of Workers – If any subcontractor or person employed by the Contractor shall appear to the City Engineer to be incompetent, intemperate, troublesome, or acts in a disorderly or otherwise objectionable manner, he shall be immediately discharge from the project on the requisition of the City Engineer, and such person shall not be reemployed on the work. If said individual has an ownership interest in the contracting entity, the City Engineer will serve written notice upon the Contractor and the Surety providing the faithful performance bond, in accordance with Section 6-4, "Termination of the Contract for Default," of the Standard Specifications for Public Works Construction (2015), demanding complete and satisfactory compliance with the Contract. II-8.01 Examination of the Site – The Contractor is required to examine the site and judge for themselves the location, physical conditions, substructures, and surroundings of the proposed work. II-9.01 Mobilization – The cost of all preparatory work and operations for the multiple movements of personnel, equipment, supplies, and incidentals to the project site must be included in the various bid items, and no extra compensation will be paid to the Contractor. II-10.01 Dust Control – Throughout all phases of construction, including suspension of work, and until final acceptance of the project, the Contractor shall abate dust nuisance by cleaning or other means as necessary when requested by the City. Failure of the Contractor to comply with the City Engineer's cleanup orders may result in an order to suspend work until the condition is corrected. No additional compensation nor extension of contract completion time will be allowed as a result of such suspension. The cost of furnishing and operating dust control during the construction project must be included in the various bid items, and no extra compensation will be paid to the Contractor. II-11.01 Cleaning of Site During Construction – During construction, all existing improvements adjacent to the Vernon Fire Station No. 76 site shall be cleaned of all dirt or debris on a daily basis. II-12.01 Final Cleaning of Site and Restoration – The Contractor shall be responsible for cleaning and restoration of all damaged existing improvements at no cost to the City. 29 June 2020 All existing improvements adjacent to the Vernon Fire Station No. 76 site shall be cleaned of all dirt or debris. The cost of such cleaning after the construction of the project must be included in the various bid items, and no extra compensation will be paid to the Contractor. II-13.01 Sanitary Facilities – The Contractor shall furnish and maintain sanitary facilities by the work sites for the entire construction period. The costs for this shall be incorporated in the most closely related bid item and no extra compensation will be paid to the contractor. II-14.01 Protection of the Public – The Contractor shall take such steps and precautions as his/her operations warrant to protect the public from danger, loss of life, loss of property or interruption of public services. Unforeseen conditions may arise which will require that immediate provisions be made to protect the public from danger or loss, or damage to life and property, due directly or indirectly to prosecution of work under this contract. Whenever, in the opinion of the City Engineer, a condition exists in which the Contractor has not taken sufficient precaution of public safety, protection of utilities, and/or protection of adjacent structures or property, the City Engineer will order the Contractor to provide a remedy for the condition. If the Contractor fails to act on the situation within a reasonable time period as determined by the City Engineer, or in the event of an emergency situation, the City Engineer may provide suitable protection by causing such work to be done and material to be furnished as, in the opinion of the City Engineer, may seem reasonable and necessary. The cost and expense of all repairs (including labor and materials) as are deemed necessary, shall be borne by the Contractor. All expenses incurred by the City for emergency repairs will be deducted from the final payment due to the Contractor. II-15.01 Submittals – Prior to commencement of the work, the contractor shall provide the City with samples or cut sheets of the proposed materials including but not limited to the following list: Paint color Interior light fixtures Plumbing fixtures Flooring materials Bathroom tile Kitchen cabinets shop drawings and samples Kitchen tile Appliances or any other equipment to be provided by the contractor No gas lines, electrical lines or water lines shall be abandoned in place. The replacement/modification of any water, electrical or gas lines shall include the removal and disposal of unused lines. The cost for the removal and disposal shall be included in the various bid items and no additional compensation will be paid to the contractor. Additionally, all demolition debris shall be hauled away in accordance with State regulations at no additional cost to the City. II-16.01 Permits – The contractor shall be responsible for applying and procuring all applicable Building, Electrical, Plumbing, and Mechanical permits from the City’s Building Division of the Public Works Department. 30 June 2020 EXHIBIT C SCHEDULE OF COSTS 8/20/2020 Fasone Job #200018 TBD TBD 3375 Fruitland Avenue 2272 Vernon CA, 90058 240.73$ Hours Rate Total Labor Qty. Cost Total Mat/Equip Unit Cost Total Subcontractor General Requirements Supervision (9 weeks) 360 95.00$ 34,200.00$ Project Management 300 95.00$ 28,500.00$ Design Services Architectural Programming and Design 24 95.00$ 2,280.00$ Prints Allowance 250.00$ J.L. Zane Architecture CAD Drafting 180 65.00$ 11,700.00$ Fasone MEP Engineering Alpha MEP 7,500.00$ Permit Procurement 24 65.00$ 1,560.00$ Existing Conditions Selective Demolition 480 71.88$ 34,502.40$ Debris Containers & Hauling 3 800.00$ 2,400.00$ Relocate Existing Appliances to a Secure Location 6 71.88$ 431.28$ Dust Control and Daily Clean-up 80 71.88$ 5,750.40$ Plastic, tape and Misc. supplies 850.00$ Sawcut Openings in CMU wall for new doors and Windows Full-Blast Concrete Cutting 3,200.00$ Concrete cutting and excavating as needed for New Plumbing Work 64 71.88$ 4,600.32$ Patching Materials 750.00$ Equipment Rental 1,250.00$ Metals Stainless Steel Countertops Restaurant Equipment Fabricators 17,662.71$ Metal Fabrications Cabinet Hardware 2,500.00$ Wood, Plastic and Composite Rough Framing 140 81.98$ 11,477.20$ Lumber & Hardware 2,626.32$ Plastic Laminate Kitchen Cabinets 120 81.98$ 9,837.60$ Fabrication: Base 18 200.00$ 3,600.00$ Fabrication: Uppers 27 140.00$ 3,780.00$ Fabrication: Island (4x12)24 200.00$ 4,800.00$ Fabrication: Full Height 7 300.00$ 2,100.00$ Openings Provide and Install 6 New Windows in Dormitories 24 81.98$ 1,967.52$ Windows 2,992.58$ Patch (3) Existing Openings in concrete wall 24 81.98$ 1,967.52$ Gyp. Bd. Materials 315.00$ Re-Stucco (6) new window openings and (3) Existing Openings 20 81.98$ 1,639.60$ Stucco Materials 250.00$ Provide and Install (3) dormitory doors and frames 18 81.98$ 1,475.64$ Doors and Hardware 1,554.00$ Reinstall existing Dormitory doors and frames 18 81.98$ 1,475.64$ New Locksets 3,782.00$ Restroom Area: Install new doors and Frames 20 81.98$ 1,639.60$ Misc. Materials 4,120.00$ Finishes Gypsum Board Installation 96 81.65$ 7,838.40$ All Gyp. Bd. Materials 2,200.00$ Gypsum Board Finishing 160 78.72$ 12,595.20$ Interior Paint Throughout Areas of work 153 62.00$ 9,486.00$ Misc. Materials: Paint 2,000.00$ Exterior Paint: Column to column in (3) Sections receiving new windows 24 62.00$ 1,488.00$ Misc. Materials: Paint 250.00$ Flooring: provide and install carpet tiles in Dormitories DFS Flooring 47,887.00$ Flooring: Provide and install VCT in Corridor and Storage Areas DFS Flooring -$ Flooring: Provide and Install Sheet Vinyl in Bathroom DFS Flooring -$ Flooring: Provide and Install Quarry Tile in Kitchen DFS Flooring -$ Wall base in kitchen: Quarry tile base DFS Flooring -$ Coved Wall base by Johnsonite Through area of work DFS Flooring -$ Moisture Testing DFS Flooring 1,100.00$ Plumbing Relocate Water Heater, Remove and replace fixtures in bathroom per preliminary layout and provide piping for new kitchen layout. O'Connor Plumbing 30,477.00$ Heating, ventilating and Air Conditioning Kitchen: Relocate and Run new grease duct to new range location. Fire Wrap Included Air West Mechanical 7,991.00$ Dormitories: Remove and replace (6) old ceiling grilles with new, relocate (3) exhaust grills in bathroom. Relocate make up vent duct and heater vent for water heater to new location. Install new Run Supply and return ducts and grilles as needed in dormitories. Air West Mechanical 12,425.00$ Third party test and balance report Air West Mechanical 2,200.00$ Electrical Demolition 80 87.00$ 6,960.00$ Electrical Materials 28,361.17$ Low Voltage Rough-In 24 87.00$ 2,088.00$ Wall Rough-In 193 87.00$ 16,791.00$ Lighting 113 87.00$ 9,831.00$ Finish 40 87.00$ 3,480.00$ CA Sales Tax 7,121.81$ SUBTOTALS LABOR 225,562.32$ 76,602.88$ 131,692.71$ SUBTOTALS MATERIAL 76,602.88$ SUBTOTALS EQUIPMENT/SUBS 131,692.71$ GRAND SUBTOTAL (LABOR/MATERIAL/EQUIPMENT)433,857.91$ 012000 MATERIAL/SUB MARKUP 5% 10,414.78$ 012000 OVERHEAD ON SELF PERFORMED LABOR 20% 45,112.46$ SUBTOTALS 489,385.15$ 012000 PROFIT 8% 39,150.81$ SUBTOTAL 528,535.97$ 017800 INSURANCE (1%) & BOND (2.5%) 3.5% 18,498.76$ Lump Sum LS Lump Sum Lump Sum Lump Sum Lump Sum Lump Sum Lump Sum Lump Sum Lump Sum Lump Sum Lump Sum Schedule Start Date: L.A. County Fire Department / City of Vernon Vernon Fire #76 Confidential Project Number:Submission Date: Company Project Address:Schedule End Date: Lump Sum Lump Sum Lump Sum LS Project Total Sq. Ft.: Cost Per Sq. Ft: Div.Description Labor Description Material/Equipment Subcontractor 7,500.00 Lump Sum Included Above Included Above Lump Sum Lump Sum Lump Sum Lump Sum Included Above Included Above Included Above Lump Sum GRAND TOTAL 547,034.72$ Lump Sum Dormitory, Kitchen and Bathroom Improvements - Revision 01 1 OF 1 8/20/2020 Exhibit C 31 June 2020 EXHIBIT D CONSTRUCTION PLANS 32 June 2020 EXHIBIT E EQUAL EMPLOYMENT OPPORTUNITY PRACTICES PROVISIONS A. Contractor certifies and represents that, during the performance of this Agreement, the contractor and each subcontractor shall adhere to equal opportunity employment practices to assure that applicants and employees are treated equally and are not discriminated against because of their race, religious creed, color, national origin, ancestry, handicap, sex, or age. Contractor further certifies that it will not maintain any segregated facilities. B. Contractor agrees that it shall, in all solicitations or advertisements for applicants for employment placed by or on behalf of Contractor, state that it is an "Equal Opportunity Employer" or that all qualified applicants will receive consideration for employment without regard to their race, religious creed, color, national origin, ancestry, handicap, sex or age. C. Contractor agrees that it shall, if requested to do so by the City, certify that it has not, in the performance of this Agreement, discriminated against applicants or employees because of their membership in a protected class. D. Contractor agrees to provide the City with access to, and, if requested to do so by City, through its awarding authority, provide copies of all of its records pertaining or relating to its employment practices, except to the extent such records or portions of such records are confidential or privileged under state or federal law. E. Nothing contained in this Agreement shall be construed in any manner as to require or permit any act which is prohibited by law. 33 June 2020 EXHIBIT F LIVING WAGE PROVISIONS Minimum Living Wages: A requirement that Employers pay qualifying employees a wage of no less than $10.30 per hour with health benefits, or $11.55 per hour without health benefits. Paid and Unpaid Days Off: Employers provide qualifying employees at least twelve compensated days off per year for sick leave, vacation, or personal necessity, and an additional ten days a year of uncompensated time for sick leave. No Retaliation: A prohibition on employer retaliation against employees complaining to the City with regard to the employer’s compliance with the living wage ordinance. Employees may bring an action in Superior Court against an employer for back pay, treble damages for willful violations, and attorney’s fees, or to compel City officials to terminate the service contract of violating employers.