The URL can be used to link to this page

20220405 City Council Agenda PacketRegular Vernon City Council Meeting Tuesday, April 5, 2022 Page 1 of 7 Agenda City of Vernon Regular City Council Meeting Tuesday, April 5, 2022, 9:00 AM City Hall, Council Chamber 4305 Santa Fe Avenue Vernon, California Melissa Ybarra, Mayor William Davis, Mayor Pro Tem Leticia Lopez, Council Member Crystal Larios, Council Member Judith Merlo, Council Member MEETING ATTENDANCE PROTOCOLS Assembly Bill 361 (AB 361) authorizes public meetings to take place via teleconference because State and Local officials are recommending measures to promote social distanc ing. Meetings are conducted in a hybrid format that includes both in -person and Zoom public participation. The public is encouraged to view the meeting at https://www.cityofvernon.org/webinar-cc or by calling (408) 638-0968, Meeting ID 815-4019-2002#. You may address the Council via Zoom or submit comments to PublicComment@cityofvernon.org with the meeting date and item number in the subject line. CALL TO ORDER FLAG SALUTE ROLL CALL APPROVAL OF THE AGENDA PUBLIC COMMENT At this time the public is encouraged to address the City Council on any matter that is within the subject matter jurisdiction of the City Council. The public will also be given a chance to comment on matters which are on the posted agenda during City Council deliberation on those specific matters. PRESENTATIONS 1. Police Department Swearing-In Ceremony for New Police Officers in the Police Department Recommendation: Administer the Oath of Office to Police Officers Alan Escarpe, Brittany Gonzalez and Melissa Hernandez. Regular Vernon City Council Meeting Tuesday, April 5, 2022 Page 2 of 7 2. Human Resources Proclamation Declaring Sexual Assault Awareness Month and Denim Day Recommendation: Proclaim the month of April 2022 as "Sexual Assault Awareness Mont h" and Wednesday, April 27, 2022 as "Denim Day" in the City of Vernon. 1. Proclamation - Sexual Assault Awareness Month 3. City Administration Proclamation Celebrating the 70th Anniversary of the Greater Los Angeles County Vector Control District Recommendation: Commend and honor the Greater Los Angeles County Vector Control District on their 70th Anniversary Milestone. 1. Proclamation - GLACVCD 70th Anniversary 4. City Administration City Administrator Report: • New Business Welcome • Partnerships to Aid Unhoused Population • Clean California Grant for Vernon Park • Utility in Southern California Public Power Association (SCPPA) Newsletter • Vernon Job Fair • Community Engagement Recommendation: No action is required by City Council. This is a presentation only. PUBLIC HEARINGS 5. Finance/Treasury General Fee Schedule for Fiscal Year 2022-2023 Recommendation: Adopt Resolution No. 2022-06 approving and adopting the General Fee Schedule for Fiscal Year (FY) 2022-2023. 1. Resolution No. 2022-06 2. Notice of Public Hearing - General Fee Schedule CONSENT CALENDAR All matters listed on the Consent Calendar are to be approved with one motion. Items may be removed from the Consent Calendar for individual consideration. Removed items will be considered immediately following the Consent Calendar. 6. City Clerk Approval of Minutes Recommendation: Approve the March 15, 2022 Regular City Council meeting minutes. 1. 20220315 City Council Minutes Regular Vernon City Council Meeting Tuesday, April 5, 2022 Page 3 of 7 7. City Clerk Conduct of Meetings via Teleconference Pursuant to Assembly Bill 361 Recommendation: Ratify the findings in Resolution No. 2021-36 authorizing continued conduct of City Council and all other City legislative body meetings via teleconference, in accordance with Assembly Bill 361 (AB 361), due to continued public health and safety concerns caused by COVID-19. 1. Resolution No. 2021-36 8. City Clerk Claims Against the City Recommendation: Receive and file the claim submitted by Mayra A. Llamas in the amount of $1,620. 1. 20220315 Mayra A. Llamas 9. Finance/Treasury Operating Account Warrant Register Recommendation: Approve Operating Account Warrant Register No. 84, for the period of February 27 through March 19, 2022, totaling $10,616,891.14 and consisting of ratification of electronic payments totaling $9,706,845.77 and ratification of the issuance of early checks totaling $910,045.37. 1. Operating Account Warrant Register No. 84 10. Public Works Public Works Department Monthly Report Recommendation: Receive and file the February 2022 Building Report. 1. Public Works Department February 2022 Building Report 11. Finance/Treasury Recovered Organic Waste Product and Recycled-Content Paper Procurement Policy Recommendation: Adopt the Recovered Organic Waste Product and Recycled-Content Paper Procurement Policy. 1. Draft Recovered Organic Waste and Recycled-Content Paper Procurement Policy 2. Notification of Procurement Target Regular Vernon City Council Meeting Tuesday, April 5, 2022 Page 4 of 7 12. Public Works Agreements with the California Department of Transportation (CalTrans) Recommendation: Adopt Resolution No. 2022-07 authorizing the Director of Public Works to execute all Federal or State Grant Funding Agreements with the State of California, acting by and through the Department of Transportation. 1. Resolution No. 2022-07 13. Public Utilities Electrical Easement at 2340 East 52nd Street - Assessor’s Parcel Number (APN) 6308-016-025 Recommendation: Accept the Electrical Easement and authorize the Mayor to execute the Certificate of Acceptance for 2340 East 52nd Street (APN 6308-016-025). 1. Electrical Easements and Certificate of Acceptance - 2340 East 52nd Street 14. Public Works Services Agreement with YESCO LLC dba YESCO Signs LLC (Contract No. CS- 1425) for Vernon Gateway Arch Project Recommendation: A. Find that the proposed action is categorically exempt under the California Environmentally Quality Act (CEQA) in accordance with CEQA Guidelines Section 15303, because the project consists of new construction of limited small new facilities; and Section 15311, because the project only consists of construction or placement of minor structures accessory to (appurtenant to) existing commercial, industrial, or institutional facilities; B. Approve and authorize the City Administrator to execute Services Agreement Contract CS-1425 with YESCO LLC, dba YESCO Signs LLC in substantially the same form as submitted, in an amount not-to-exceed $499,364.97 for the City of Vernon Gateway Arch Project for a three-year term; and C. Authorize a contingency of $75,000 in the event of an unexpected changed condition in the project and grant authority to the City Administrator to issue Change Orders for an amount up to the contingency amount, if necessary. 1. Services Agreement CS-1425 with YESCO 2. Gateway Arch Rendering 15. Public Works Vernon Rental Housing Policy Recommendation: Adopt Resolution No. 2022-08 approving a Vernon Rental Housing Policy for the Vernon Housing Commission and repealing Resolution No. 2011-175. 1. Resolution No. 2022-08 2. Resolution No. VHC-9 Regular Vernon City Council Meeting Tuesday, April 5, 2022 Page 5 of 7 16. Public Utilities Construction Contract with Capital Industrial Coatings, LLC for the Rehabilitation of Reservoirs 2-1, 2-2, and 2-3 Project Recommendation: A. Find that the proposed action is categorically exempt from California Environmental Quality Act (CEQA) review, in accordance with CEQA Guidelines Section 15301, because the project consists of the maintenance, repair or minor alteration of existing facilities and equipment and involves negligible or no expansion of an existing use; B. Accept the bid from Capital Industrial Coatings, LLC as the lowest responsive and responsible bidder and reject all other bids; C. Approve and authorize the City Administrator to execute a Construction Contract with Capital Industrial Coatings, LLC in substantially the same form as submitted, in an amount not-to-exceed $2,033,308 for the Rehabilitation of Reservoirs 2-1, 2-2, and 2-3; and D. Authorize a contingency amount of $200,000 in the event of unforeseen changes in the project and grant authority to the City Administrator to issue Change Orders for an amount up to the contingency amount, if necessary. 1. Construction Contract with Capital Industrial Coatings, LLC 17. City Council Payment and Blanket Purchase Contract with ABB, Inc. Recommendation: A. Find that the proposed action is categorically exempt from California Environmental Quality Act (CEQA) review, in accordance with CEQA Guidelines § 15301, because the project consists of the maintenance, repair or minor alteration of an existing facility and involves negligible or no expansion of an existing use; B. Approve payment to ABB, Inc. for Invoice No. 7105433953, in the amount of $340,716.69 for starting motor drive replacement parts; C. Find that the best interests of the City are served by a direct award of a purchase contract to ABB, Inc., without a competitive selection process pursuant to Section 3.32.110 B.2 of the Vernon Municipal Code (VMC); and D. Authorize issuance of a blanket Purchase Contract in an amount not -to-exceed $92,283.31 with ABB, Inc., subject to City Attorney’s Office approval of terms and conditions, for the installation of a starting motor drive and maintenance services needed at Malburg Generating Station (MGS) for the remainder of fiscal year (FY) 2021-2022. 1. ABB, Inc. - Invoice No. 7105433953 2. ABB, Inc. - Purchase Order No. MGS 21969 Regular Vernon City Council Meeting Tuesday, April 5, 2022 Page 6 of 7 NEW BUSINESS 18. Finance/Treasury Amendments to Vernon Municipal Code Section 3.32.250 Emergency Purchases Recommendation: A. Introduce and conduct the first reading of Ordinance No. 1279 amending Section 3.32.250 of Title 3 Revenue and Finance of the Vernon Municipal Code regarding emergency purchases; and B. Direct staff to schedule second reading and adoption for the April 19, 2022 City Council meeting. 1. Ordinance No. 1279 ORAL REPORTS City Administrator Reports on Activities and Other Announcements. City Council Reports on Activities (including AB 1234), Announcements, or Directives to Staff. CLOSED SESSION 19. CONFERENCE WITH LEGAL COUNSEL – ANTICIPATED LITIGATION – Significant exposure to litigation Government Code Section 54956.9(d)(2) Number of potential cases: 1 20. CONFERENCE WITH LEGAL COUNSEL – EXISTING LITIGATION Government Code Section 54956.9(d)(1) Teresa Rodriguez v. City of Vernon Los Angeles Superior Court Case No. 22STCV09515 21. PUBLIC EMPLOYMENT Government Code Section 54957(b)(1) Title: City Attorney CLOSED SESSION REPORT ADJOURNMENT I hereby certify under penalty of perjury under the laws of the State of California, that the foregoing agenda was posted in accordance with applicable legal requirements. Regular and Adjourned Regular meeting agendas may be amended up to 72 hours prior to the meeting. Dated this 30th day of March, 2022. By: __________________________________ Sandra Dolson, Administrative Secretary Regular Vernon City Council Meeting Tuesday, April 5, 2022 Page 7 of 7 Guide to City Council Proceedings Meetings of the City Council are held the first and third Tuesday of each month at 9:00 a.m. and are conducted in accordance with Rosenberg's Rules of Order (Vernon Municipal Code Section 2.04.020). Copies of all agenda items and back-up materials are available for review in the City Clerk Department, Vernon City Hall, 4305 Santa Fe Avenue, Vernon, California, and are available for public inspection during regular business hours, Monday through Thursday, 7:00 a.m. to 5:30 p.m. Agenda reports may be reviewed on the City's website at www.cityofvernon.org or copies may be purchased for $0.10 per page. Disability-related services are available to enable persons with a disability to participate in this meeting, consistent with the Americans with Disabilities Act (ADA). In compliance with ADA, if you need special assistance, please contact the City Clerk department at CityClerk@ci.vernon.ca.us or (323) 583-8811 at least 48 hours prior to the meeting to assure arrangements can be made. The Public Comment portion of the agenda is for members of the public to present items, which are not listed on the agenda but are within the subject matter jurisdiction of the City Council. The City Council cannot take action on any item that is not on the agenda but matters raised under Public Comment may be referred to staff or scheduled on a future agenda. Comments are limited to three minutes per speaker unless a different time limit is announced. Speaker slips are available at the entrance to the Council Chamber. Public Hearings are legally noticed hearings. For hearings involving zoning matters, the applicant and appellant will be given 15 minutes to present their position to the City Council. Time may be set aside for rebuttal. All other testimony shall follow the rules as set for under Public Comment. If you challenge any City action in court, you may be limited to raising only those issues you or someone else raised during the public hearing, or in written correspondence delivered to the City Clerk at or prior to the public hearing. Consent Calendar items may be approved by a single motion. If a Council Member or the public wishes to discuss an item, it may be removed from the calendar for individual consideration. Council Members may indicate a negative or abstaining vote on any individual item by so declaring prior to the vote on the motion to adopt the Consent Calendar. Items excluded from the Consent Calendar will be taken up following action on the Consent Calendar. Public speakers shall follow the guidelines as set forth under Public Comment. New Business items are matters appearing before the Council for the first time for formal action. Those wishing to address the Council on New Business items shall follow the guidelines for Public Comment. Closed Session allows the Council to discuss specific matters pursuant to the Brown Act, Government Code Section 54956.9. Based on the advice of the City Attorney, discussion of these matters in open session would prejudice the position of the City. Following Closed Session, the City Attorney will provide an oral report on any reportable matters discussed and actions taken. At the conclusion of Closed Session, the Council may continue any item listed on the Closed Session agenda to the Open Session agenda for discussion or to take fo rmal action as it deems appropriate. ! " #$"" %& % &$&"$""$"" %'% (( %% ) (* +& , -,. &% " $"" /% & /% %"% %* %%%" &," %&/%%/&%%%/ / /% %/ %%/ %""%& %* " & /% & , & %%% " & ) 0% % -)0. & %% %%%* % / " & 1"% " & & " 2%/ 3 /%% % & '% (( %% ) ( &%1" %"&/$"" %%* & % " &0) !%%45 &6 * """ %/ &2%%%% &&% &%"&%% % % "%" & & % /& 7% " 8%9 5* #* !" # ##$ %!" #% & '% %#( $ ) *#+ , # %!" #% # $ - . # '% %/)*# 0 ( # " 1) 0 # # 1 #### # 2 # 1 ) *# "#$# ! ) *# $$ 2"## $# " 1 ' $ !)*##3 # . # # -# 4 # #) *# $ "## ) 5) 6!" # !"!# $!% & !!% & !"! # ' (# !% & )! %&*!# ! !# $+, !!# + !- .!/ ' %&.$ ! 01!!+ $ ! ! 2 $#$ +$! 3#' !! !# # # , 2 4( .!5, ! 3#' 6 ! - 0 + # # # !- $ 75 !! $2 2 % ! . 4 . &' 6! 4 ! "!# $ ! % & # # '6 ! !%&!$ #!!! '8 05!! !"!# 8#$0!( +.! !. $! ' 6! !# +# ! $& 0"'9 . $ ! !4 ! %& $ ! # ! ! $$ $ ! $ ! # ! #!# $!$$ ! $ '6! . ! : # 8#' 6!$ .!!' 0' ,%&"!# !" # $ %$ # & ' &(# ) % $ & #"#" *##+ (, - ". "/0$ / 0$ $$$ 1" ". 2 "2&$" /0$ 2 $&$/ 0$&" " " $$/ / ! "# $%& #' ##(#)%*#+ #! ! "# $,$-%&) !. #+ + "#"# + # # # #" #+ ! + "# /!! ! " ! # ! # !# "#"" ""+ + #" + . # ) ! ###+!"# #" + /!! " ! . 0 # +# # )12 #". " +# !! +# ## + ) #"! # !. 0 ! +/ # !!" # /!" / ). +/" "# + 3# # # /" # #3 ! # 2 " ) 4 ## # /! +/ ! ! "" ! "# ## #"!# . .# #"!)! " ! "#$ %&# "/" # !5 6 1 # #% + + 7# .# # #+ # /!!!!!! 12!#!! ##) 6 # #+.# #**89#!8!!# / # . : # ! . 0 / ! ! :# 63 5,!-) ! ! ! !# !. !"# + );!! 2# #" ! "/ / " # ! ! 2 " ! ) '+"#" # /!! # #2 <88=&"# .! "#+ <&8="#> 6 / !. 0 #? "#$%&) 8)' ##(#)%* )(##"6:% ! RESOLUTION NO. 2022-06 A RESOLUTION OF THE CITY COUNCIL OF THE CITY OF VERNON APPROVING AND ADOPTING THE GENERAL FEE SCHEDULE FOR FISCAL YEAR 2022-2023 SECTION 1. Recitals. A. The City’s fees are reviewed and updated on an annual basis in preparation for the budget adoption. B. On April 6, 2021, the City Council adopted Resolution No. 2021-05, approving and adopting a General Fee Schedule for Fiscal Year 2021-2022 incorporating only fees that were missing from the schedule, mandated by the State, and/or minor revisions that do not impact businesses for fees related to permits and inspections. C. On April 5, 2022, the Director of Finance recommended the City Council adopt the proposed General Fee Schedule for Fiscal Year 2022-2023 incorporating only fees that were missing from the schedule and minor revisions. D. The City Council desires to approve the General Fee Schedule for Fiscal Year 2022-2023. NOW, THEREFORE, BE IT RESOLVED BY THE CITY COUNCIL OF THE CITY OF VERNON AS FOLLOWS: SECTION 2. The City Council of the City of Vernon hereby finds and determines that the above recitals are true and correct. SECTION 3. The City Council of the City of Vernon hereby approves and adopts the General Fee Schedule for Fiscal Year 2022-2023, a copy of which is attached hereto as Exhibit A. SECTION 4. All resolutions or parts of resolutions, specifically Resolution No. 2021-05, not consistent with or in conflict with this resolution are hereby repealed. / / / / / / / / / Resolution No. 2022-06 Page 2 of 14 _______________________ SECTION 5. The City Clerk shall certify the passage and adoption of this resolution and enter it into the book of original resolutions. APPROVED AND ADOPTED this 5th day of April, 2022. ________________________ MELISSA YBARRA, Mayor ATTEST: LISA POPE, City Clerk (seal) APPROVED AS TO FORM: ZAYNAH N. MOUSSA, Interim City Attorney GENERAL FEE SCHEDULE City of Vernon Effective July 1, 2022 Resolution No. 2022-06 Page 3 of 14 ________________________ City of Vernon General Fee Schedule Page 2 of 12 CITY OF VERNON GENERAL FEE SCHEDULE TABLE OF CONTENTS ADMINISTRATIVE FEES ............................................................................................................ 3 BUSINESS LICENSE FEES** ........................................................................................................... 3 COPIES ................................................................................................................................................ 3 CREDIT CARD PAYMENT FEE ....................................................................................................... 3 ELECTIONS ........................................................................................................................................ 3 FILMING ............................................................................................................................................. 4 MISCELLANEOUS .................................................................................................................................... 4 PASSPORTS ............................................................................................................................................... 4 STAFF TIME – Special Projects Beyond Normal Course of Business ............................................... 4 SUBPOENA DUCES TECUM............................................................................................................ 4 BUILDING PERMIT FEES ........................................................................................................... 5 PERMIT FEES ..................................................................................................................................... 5 CERTIFICATE OF OCCUPANCY FEES .......................................................................................... 5 INSPECTION AND OTHER FEES .................................................................................................... 6 ENGINEERING FEES ................................................................................................................... 7 ENGINEERING FEES ........................................................................................................................ 7 ENCROACHMENT FEES .................................................................................................................. 7 GRADING .................................................................................................................................................. 8 ENCROACHMENT PERMIT FAITHFUL PERFORMANCE BONDS OR CASH DEPOSIT REQUIREMENTS ............................................................................................................................... 8 Type of Work to be performed............................................................................................................. 8 HEALTH AND ENVIRONMENTAL CONTROL PERMIT FEES .............................................. 9 CERTIFIED UNIFIED PROGRAM AGENCY .................................................................................. 9 FOOD PROTECTION PROGRAM .................................................................................................... 9 HEALTH & ENVIRONMENTAL CONTROL SERVICE FEES ............................................... 11 POLICE FEES .............................................................................................................................. 12 GENERAL ......................................................................................................................................... 12 FALSE ALARMS .............................................................................................................................. 12 Resolution No. 2022-06 Page 4 of 14 ________________________ City of Vernon General Fee Schedule Page 3 of 12 ADMINISTRATIVE FEES BUSINESS LICENSE FEES** Warehousing Square Feet Square Feet (Maximum tax is per square feet Manufacturing Based on number of employees Application Hybrid Business Please refer to business license tax calculation worksheet Application Contractor Based on number of employees and quarters working Application Catering Catering Vehicle-Hot Food (Section %D \U Catering Vehicle-Cold Food (Section %E $\U Hazardous Waste Treatment, Storage or Disposal Facilities See Vernon Code Section 5. Hazardous Waste Treatment, Storage or Disposal by or on behalf of related corporate entities. See Vernon Code Section 5. Waste to Energy Facilities See Vernon Code Section 5. Solid Waste Materials Processing and Recycling Facilities See Vernon Code Section 5. Lead-Acid Battery Recycling Facilities See Vernon Code Section 5. ** Business license fees not listed above may be found in Vernon Code Chapter 5 – Business License Taxes and other City Taxes. COPIES Standard per page Certified $16 per document Oversized Plans per sheet or direct cost of duplication Special Projects Direct cost of duplication $XGLR9LGHR&''9' duplication (medium provided by UHTXHVWRU CREDIT CARD PAYMENT FEE City’s direct cost to process credit card transactions for the convenience of the credit card user shall be collected from the credit card user as part of the transaction. ELECTIONS Candidate Statement Deposit Filing Fee – Intent to Circulate a Petition (Election Code Section E Resolution No. 2022-06 Page 5 of 14 ________________________ City of Vernon General Fee Schedule Page 4 of 12 FILMING Permit Filming Location Fee – Private Property per permit Filming Location Fee – Under City Control per day Filming Location Fee – City Street per day Health Department Inspection Fee per permit Building Department Inspection Fee per permit On-Duty Police Officer (See Filming *XLGHOLQHV Per Agreement with Police Officers Association Encroachment Inspector $75 per hour Posting per location (QFURDFKPHQW Traffic and Street Closure Fees See Engineering Fees Filming without a Permit* Double all permit fees *With the exception of film permit YLRODWLRQV all Filming Fees are collected on behalf of the City by the City’s Film Permit consultant )LOP/$ MISCELLANEOUS Returned Checks Administrative Citations See Resolution No. -195 Civil Penalties See Resolution No. -195 PASSPORTS Processing Fee (Established by the U.S. Department of 6WDWH Photograph per photo STAFF TIME – Special Projects Beyond Normal Course of Business As provided for in the California Public Records $FW City’s staff time spent on extraordinary or infrequent requests that are large in scope or require development of information to satisfy such requests will require the requestor to reimburse the City for its actual direct cost. Actual direct cost will include the City staff’s fully burdened hourly rate which includes PERS and Medicare. Outsourced consultant and attorney fees will be at cost billed to the City. A GHSRVLW based upon an estimate to fulfill a UHTXHVW will be collected prior to commencement. SUBPOENA DUCES TECUM Documents (Deposit for Civil Cases. No charge for Criminal Cases (Evidence Code Section E No charge for Federal Cases unless significant (Federal Rules of Civil Procedure 5XOH Persons (Deposit for Civil Cases pursuant to Government Code Section 1Rcharge for Criminal Cases pursuant to Penal Code Section Resolution No. 2022-06 Page 6 of 14 ________________________ City of Vernon General Fee Schedule Page 5 of 12 BUILDING PERMIT FEES PERMIT FEES %XLOGLQJ (OHFWULFDO 3OXPELQJ +HDWLQJ 9HQWLODWLQJ &RROLQJ 5HIULJHUDWLRQ and Fire Prevention Permits VALUATION FEE WR WR IRU the first SOXVIRU each additional RU fraction WKHUHRI up to and LQFOXGLQJ WR IRU the first SOXVIRU each additional RU fraction WKHUHRI up to and including WR IRU the first SOXVIRU each additional RU fraction WKHUHRI up to and including WR IRU the first SOXVIRU each additional RU fraction WKHUHRI up to and including WR IRU the first SOXV for each additional RU fraction WKHUHRI up to and including and up IRU the first SOXV for each additional RU fraction thereof. Plan Check Fee when required, shall be equal to 65% of the Permit Fee. Plan Check Energy Fee 25% of the Permit Fee. Permit Energy Fee 10% of the Permit Fee. DESCRIPTION FEE Green Building Standards Plan Review Mandatory Provisions Green Building Standards Plan Review Tier 1 Provision s Green Building Standards Plan Review Tier 2 Provision s Green Building Standards Inspection Mandatory Provisions Green Building Standards Inspection Tier 1 Provisions Green Building Standards Inspection Tier 2 Provisions Grading Plan Review Fee (First VKHHWV Grading Plan Review Fee Each Additional Sheet NPDES LID Inspection Industrial Wastewater Discharge Permit Application Review Penalty Fees Work commencing prior to the issuance of a permit shall be subject to an additional fee equal to the permit fee. (Authorized by California Building Code CERTIFICATE OF OCCUPANCY FEES AFFECTED FLOOR AREA Inspection Fee: square feet or less WRsquare feet Resolution No. 2022-06 Page 7 of 14 ________________________ City of Vernon General Fee Schedule Page 6 of 12 BUILDING PERMIT FEES WRsquare feet $1 Over square feet $1 Issuance of a Temporary Certificate of Occupancy Less than VTXDUH feet Less than VTXDUH feet WRsquare feet Over square feet INSPECTION AND OTHER FEES DESCRIPTION FEE Permit Inspection outside of normal business hours (minimum charge four KRXUV KRXU Minimum of Inspection of work not requiring a permit KU Re-inspection fee KU Additional structural plan review required by FKDQJHV additions or revisions to the plans submitted or determination if an existing structure can accept additional loads KU Additional non-structural plan review required by FKDQJHV additions or revisions to the plans submitted KU Certified Access 6SHFLDOLVW&$6SReview Fee KU Trailer Permit WUDLOHU Trailer Permit for subsequent years Final 0DS parcel PDS or tentative map which contains four or less parcels or lots Final 0DSSDUFHOPDSRUWHQWDWLYHPDSZKLFKFRQWDLQVILYHRU more parcels or lots $1 Conditional Use Permit $ plus applicant is responsible for cost to retain a consultant to prepare the environmental document for the project plus a 25% administration fee Zoning Variance and Zoning Amendment Resolution No. 2022-06 Page 8 of 14 ________________________ City of Vernon General Fee Schedule Page 7 of 12 BUILDING PERMIT FEES Building Code Variance Certificate of Compliance Fee Covenant and Lot Merger Review Fee Grant Easement Deed Review Zoning Verification &RPPHUFLDO,QGXVWULDO solar panel or other alternative energy sources installation greater than NZ SOXVper kW for each Kw above N: WRN:and per kW above N: Residential Solar Panel Installation SOXVper kW for each kW above 15kW Water Efficient Landscape Plan Review and Inspection Fee Sanitary Sewer Flow Study Fee $2 Green building Standards Administration Special Revolving fee IRU every RUportion thereof of valuation Release of Building Drawings 6SHFLDO(YHQW$SSOLFDWLRQ3XEOLF$VVHPEO\$SSOLFDWLRQ Temporary Use Permit ENGINEERING FEES ENGINEERING FEES FEE Lot Line Adjustment Fee Per App Street Vacation Fee Per App $11 ENCROACHMENT FEES Permit Issuance Fee Per App Permit Inspection and Plan Check Fees Regular Time KUOvertime KU Annual Permit Per App Reconstruction Fees for Work Completed by City All other direct costs to the City resulting from the Permitee’s DFWLYLW\ calculated at actual cost plus 25% administrative cost FRANCHISES AND LICENSES Issuance Annual Fee Railroad FURVVLQJV conveyor EULGJHV and tunnels across a street Resolution No. 2022-06 Page 9 of 14 ________________________ City of Vernon General Fee Schedule Page 8 of 12 ENGINEERING FEES Railroad 7UDFNV SLSHOLQHV or conduits along a street for each one-half PLOH or portion thereof for each one- half mile or portion thereof Pipelines or conduits across a street or a metering manhole in the street Building footings and appendages for traffic VHQVRUV VLJQV monitoring wells and architectural projections The fee for any encroachment not specifically listed in the table shall be the same fee for the most similar structure listed in the table as determined by the City. GRADING Low Impact Development Plan Review Grading Inspection (No /,' ENCROACHMENT PERMIT FAITHFUL PERFORMANCE BONDS OR CASH DEPOSIT REQUIREMENTS The amount of an encroachment permit cash GHSRVLW certified or cashier' s FKHFN surety ERQG or letter of credit shall be determined by multiplying the quantity of asphalt SDYLQJ concrete SDYLQJ VLGHZDON concrete FXUE monuments and trench excavations proposed to be UHPRYHG disturbed or opened by the rate shown in the table EHORZ the sum of the totals shall establish the minimum amount of the bond or GHSRVLW except that in no case shall the faithful total security be less than Authorized by Vernon Municipal Code Section . Type of Work to be performed Asphalt pavement VTfoot Concrete pavement and driveway VTfoot Concreate sidewalk VTfoot Concrete curb and gutter OLQFoot Trench excavations $9each open excavation Monument replacement PRQXPHQW Resolution No. 2022-06 Page 10 of 14 ________________________ City of Vernon General Fee Schedule Page 9 of 12 HEALTH AND ENVIRONMENTAL CONTROL PERMIT FEES CERTIFIED UNIFIED PROGRAM AGENCY ABOVE GROUND PETROLEUM STORAGE ACT PROGRAM Total Storage Capacity WR Gallons Total Storage Capacity WR Gallons Total Storage Capacity WR Gallons $1 Total Storage Capacity WR Gallons $2 Total Storage Capacity WR Gallons $2 Total Storage Capacity or more Gallons $2 HAZARDOUS MATERIALS BUSINESS PLAN PROGRAM Hazardous Material Inventory Class A Hazardous Material Inventory Class B Hazardous Material Inventory Class C $2 Application Fee UNDERGROUND STORAGE TANK PROGRAM Annual Tank Operating Permit 7DQN Underground Storage Tank Facility )DFLOLW\ HAZARDOUS MATERIAL CLOSURE Small Medium Large Extra Large Certificate of Closure WELL PERMITS DRILLING A WATER WELL DESTROYING OR CONVERTING AN EXISTING WATER WELL DRILLING A MONITORING WELL OHVVWKDQfeet REPAIRING MODIFYING A WELL FOOD PROTECTION PROGRAM FOOD PERMITS AGRICULTURAL OPERATION Annual CATERER Annual CATERER Daily COMMISSARY FOOD PROCESSING Under square feet Resolution No. 2022-06 Page 11 of 14 ________________________ City of Vernon General Fee Schedule Page of 12 HEALTH AND ENVIRONMENTAL CONTROL PERMIT FEES ESTABLISHMENT Over square feet FOOD VENDING MACHINE BUSINESS machine FOOD WAREHOUSE RESTAURANT - SEATS RESTAURANT 31 SEATS AND OVER RETAIL FOOD MARKET RETAIL FOOD PRODUCTION ESTABLISHMENT TEMPORARY EVENT ORGANIZER TEMPORARY FOOD FACILITY FOOD VEHICLES MOBILE FOOD FACILITY &$57 WHOLE PRODUCE MOBILE FOOD PREP UNIT (HOT 758&. Annual MOBILE FOOD PREP UNIT (HOT 758&. Daily WHOLESALE FOOD VEHICLE RETAIL FOOD VEHICLE NON-FOOD GARMENT MANUFACTURING LAUNDRY FACILITY 1$ IF FACILITY IS NOT A VERNON %86,1(66 LAUNDRY VEHICLE per vehicle WASTE PROCESSING FACILITY WASTE TRANSFER STATION WASTE COLLECTION BUSINESS WASTE COLLECTION VEHICLE WASTE COLLECTION VEHICLE YARD RENDERING PLANT BUSINESS RENDERING PLANT VEHICLE WASTE DISPOSAL SITE WATER SUPPLY UTILITY Service connection LIQUID WASTE PUMPING BUSINESS LIQUID WASTE PUMPING VEHICLE OFFAL BUSINESS OFFAL VEHICLE Resolution No. 2022-06 Page 12 of 14 ________________________ City of Vernon General Fee Schedule Page 11 of 12 HEALTH & ENVIRONMENTAL CONTROL SERVICE FEES GENERAL PLAN CHECK 1-5 sheets 6-VKHHWV $1 11-25 sheets Additional Sheets Resolution No. 2022-06 Page 13 of 14 ________________________ City of Vernon General Fee Schedule Page 12 of 12 POLICE FEES GENERAL FEE Vehicle release fee - standard Vehicle release fee - driving under the influence Fee to release complete copy of arrest UHSRUWV traffic accident UHSRUWV incident reports Fee to release complete copy of arrest UHSRUWV traffic accident UHSRUWV and incident reports FHUWLILHG Repossession fee for vehicles repossessed in Vernon (Government Code VIN verification fee Citation sign-off fee DUI Emergency Response City’s cost Subpoenas witness attendance deposit (Government Code Section Subpoenas for discovery motions Basic Police background investigation Video tape copy (blank tape provided by UHTXHVWHU – Digital FALSE ALARMS No charge for the first 3 within a fiscal year 4th false security alarm 5th false security alarm 6th false security alarm 7th false security DODUP and each additional security alarm thereafter Resolution No. 2022-06 Page 14 of 14 ________________________ CALIFORNIA NEWSPAPER SERVICE BUREAU PRE# D A I L Y J O U R N A L C O R P O R A T I O N To the right is a copy of the notice you sent to us for publication in the HUNTINGTON PARK BULLETIN. Please read this notice carefully and call us with any corrections. The Proof of Publication will be filed with the County Clerk, if required, and mailed to you after the last date below. Publication date(s) for this notice is (are): Mailing Address : 915 E FIRST ST, LOS ANGELES, CA 90012 Telephone (800) 788-7840 / Fax (800) 464-2839 Visit us @ www.LegalAdstore.com LISA POPE CITY OF VERNON CITY CLERK 4305 SANTA FE AVE VERNON, CA 90058 HRG2 NOTICE OF HEARING Notice of Public Hearing - Adoption of the FY 2022-2023 General Fee Schedule 03/17/2022 , 03/24/2022 Notice Type: Ad Description COPY OF NOTICE 3564565 !A000005962034! An invoice will be sent after the last date of publication. If you prepaid this order in full, you will not receive an invoice. NOTICE OF CITY COUNCIL PUBLIC HEARING The City Council of the City of Vernon will conduct a public hearing, which you may attend, at Vernon City Hall, City Council Chamber, 4305 Santa Fe Avenue, Vernon, CA 90058, or via Zoom Webinar at http://www.cityofvernon.org/webinar-cc, in accordance with Assembly Bill 361 on Tuesday, April 5, 2022, at 9:00 a.m.(or as soon thereafter as the matter can be heard), to: Consider the approval and adoption of the Fiscal Year 2022-2023 G eneral Fee Schedule for services provided by the City. TheproposedGeneralFeeSchedulewillbe available for public review on the City’s website once the agenda for the meeting is posted or from the City Clerk at CityClerk@cityofvernon.org or 323-583-8811, ext. 546. Please send your comments or questions to: Scott Williams, Director of Finance/City Treasurer City of Vernon 4305 Santa Fe Avenue, Vernon, CA 90058 (323) 583-8811 ext. 849 Email: swilliams@cityofvernon.org During the hearing, any person interested, including all persons owning property in the local agency, may appear and be heard as to whether the proposed rates and charges are discriminatory or excessive, or will not be sufficient under Government Code Section 54515, or will not comply with any other provision of this chapter, or will not be sufficient under the provisions or covenants of any outstanding revenue bonds of the local agency payable from the revenues of the enterprise, or on any other matter relating to said proposed resolution or ordinance or the rates or charges proposed therein. If you challenge the approval and adoption of the proposed General Fee Schedule for services provided by the City, or any provision thereof in court, you may be limited to raising only those issues you or someone else raised at the hearing described in this notice or in written correspondence delivered to the City of Vernon at, or prior to, the meeting. In compliance with the Americans with Disabilities Act (ADA), if you need special assistance to participate in the meeting, please contact the Office of the City Clerk at (323) 583-8811 ext. 546. The hearing may be continued, adjourned, or cancelled and rescheduled to a stated time and place without further notice of a public hearing. Dated: March 9, 2022 /s/ Lisa Pope, City Clerk 3/17, 3/24/22 PRE-3564565# HUNTINGTON PARK BULLETIN !" # # $ %# !#&! MINUTES VERNON CITY COUNCIL REGULAR MEETING TUESDAY, MARCH 15, 2022 COUNCIL CHAMBER, 4305 SANTA FE AVENUE CALL TO ORDER Mayor Ybarra called the meeting to order at 9:00 a.m. FLAG SALUTE Mayor Ybarra led the Flag Salute. ROLL CALL PRESENT: Melissa Ybarra, Mayor William Davis, Mayor Pro Tem Leticia Lopez, Council Member Crystal Larios, Council Member Judith Merlo, Council Member STAFF PRESENT: Carlos Fandino, City Administrator Angela Kimmey, Deputy City Administrator Zaynah Moussa, Interim City Attorney Lisa Pope, City Clerk Scott Williams, Finance Director Fredrick Agyin, Health and Environmental Control Director Michael Earl, Human Resources Director Robert Sousa, Police Chief Abraham Alemu, Public Utilities General Manager Dan Wall, Public Works Director Todd Dusenbury, Public Utilities Assistant General Manager Rich Olsen, Public Utilities Assistant General Manager of Generation & Operations APPROVAL OF THE AGENDA MOTION Council Member Lopez moved and Mayor Pro Tem Davis seconded a motion to approve the agenda. The question was called and the motion carried unanimously. PUBLIC COMMENT None. Regular City Council Meeting Minutes Page 2 of 8 March 15, 2022 RECESS Mayor Ybarra recessed the meeting at 9:03 a.m. The meeting reconvened at 9:07 a.m. with all Council Members present. PRESENTATIONS 1. Employee Service Pin Awards for February 2022 Recommendation: No action required by the City Council. This is a presentation only. Human Resources Director Earl acknowledged Victor A. Vasquez Jr., Street Maintenance Worker, Lead; and Raymond L. Godoy, Police Officer as the Employee Service Pin Awards recipients for February 2022. 2. Fiscal Year 2020-2021 Government-wide Audited Financial Results Recommendation: A. Receive presentation on Government-wide Audited Financial Results for Fiscal Year 2020-2021; and B. Receive and file Fiscal Year 2020-2021 Government-wide Annual Financial Report. Finance Director Williams and Bob Callanan, CLA Connect, presented the item. MOTION Council Member Lopez moved and Mayor Pro Tem Davis seconded a motion to receive and file the Fiscal Year 2020-2021 Government-wide Annual Financial Report. The question was called and the motion carried unanimously. CONSENT CALENDAR MOTION Council Member Lopez moved and Mayor Pro Tem Davis seconded a motion to approve the Consent Calendar. The question was called and the motion carried unanimously. The Consent Calendar consisted of the following items: 3. Approval of Minutes Recommendation: Approve the March 1, 2022 Regular City Council meeting minutes. 4. Operating Account Warrant Register Recommendation: Approve Operating Account Warrant Register No. 83, for the period of February 13 through February 26, 2022, totaling $10,359,152.54 and consisting of ratification of electronic payments totaling $10,098,309.85 and ratification of the issuance of early checks totaling $260,842.69. 5. City Payroll Warrant Register Recommendation: Approve City Payroll Warrant Register No. 789, for the period of February 1 through February 28, 2022, totaling $2,993,490.97 and consisting of ratification of direct deposits, checks and taxes totaling $2,102,761.38 and Regular City Council Meeting Minutes Page 3 of 8 March 15, 2022 ratification of checks and electronic fund transfers (EFT) for payroll related disbursements totaling $890,729.59 paid through operating bank account. 6. Fire Department Activity Report Recommendation: Receive and file the January 2022 Fire Department Activity Report. 7. Police Department Activity Report Recommendation: Receive and file the January 2022 Police Department Activity Report. 8. Quarterly City Housing Report Recommendation: Receive and file the March 2022 City Housing Quarterly Report. 9. Quarterly Report of Cash and Investments Recommendation: Receive and file the Cash and Investment Report for the quarters ending September 30, 2021 and December 31, 2021. 10. Right of Way Agreements for the Atlantic Bridge Improvement Project Recommendation: A. Find that the proposed action is categorically exempt from California Environmental Quality Act (CEQA) review, in accordance with CEQA Guidelines Section 15301, because the project consists of the minor alteration of existing facilities and involves negligible or no expansion of an existing use; B. Approve and authorize the City Administrator to execute a Possession and Use Agreement with Magellan Atlantic I, LLC, in substantially the same form as submitted, for portions of 3030 Atlantic and deposit an amount of $453,000 in escrow, and authorize the Mayor to execute related Certificates of Acceptance for certain easements; C. Approve and authorize the City Administrator to execute a Fixtures/Equipment Agreement with Clear Channel Outdoor, in substantially the same form as submitted, for the removal of a billboard located at 5122 S. Atlantic Blvd for an amount of $34,405; and D. Approve and Authorize the City Administrator to execute a Document Approval Letter with Los Angeles County Flood Control District, in substantially the same form as submitted, for the permanent easements and temporary construction easements over Los Angeles Rivers Parcels for an amount of $1,431,762, and authorize the Mayor to execute related Certificates of Acceptance for certain easements. 11. Professional Service Agreement with GovInvest Inc. for Actuarial Consulting and Technology Services Recommendation: Approve and authorize the City Administrator to execute a Professional Services Agreement with GovInvest Inc., in substantially the same form as submitted, for actuarial consulting and technology services for a total amount not-to-exceed $116,600, for a three-year term. 12. Amendment No. 2 Janitorial Services Agreement with Priority Building Services Recommendation: A. Find that the approval of the proposed amendment is exempt from California Environmental Quality Act (CEQA) review, as it is an administrative activity that will not result in direct or indirect physical changes in the environment, and therefore is not a “project” as defined by Section 15378 of the CEQA Guidelines; and B. Approve and authorize the City Administrator to execute Amendment No. 2 to Services Agreement with Priority Building Services, LLC, in substantially the same form as submitted, for janitorial services, changing the contract total from $398,307 to $436,006.30. Regular City Council Meeting Minutes Page 4 of 8 March 15, 2022 13. Supplemental to Purchase Contract No. CS-1363 with Mega Renovation, Inc. for the Remodel of 4328 Furlong Place Recommendation: A. Find that the proposed action is categorically exempt under the California Environmental Quality Act (CEQA) in accordance with CEQA Guidelines Section 15301, because the project consists of the maintenance, repair or minor alteration of an existing facility and involves negligible or no expansion of an existing use; and B. Approve and authorize the issuance of a Supplemental to Purchase Contract No. CS-1363 with Mega Renovations, Inc. for the Remodel of City-Owned Residential Property Located at 4328 Furlong Place for an amount not to exceed $19,283.95. NEW BUSINESS 14. Fiscal Year 2021-22 Mid-Year Financial Update Recommendation: A. Find that approval of the proposed action is exempt from California Environmental Quality Act (CEQA) review, because it is a government fiscal activity that will not result in direct or indirect physical changes in the environment, and therefore does not constitute a “project” as defined by CEQA Guidelines section 15378; and B. Adopt Resolution No. 2022-05 approving Mid- Year Budget Appropriations and amending the Annual Operating and Capital Budget for Fiscal Year 2021-22. Finance Director Williams presented the staff report. MOTION Council Member Lopez moved and Council Member Larios seconded a motion to: A. Find that approval of the proposed action is exempt from California Environmental Quality Act (CEQA) review, because it is a government fiscal activity that will not result in direct or indirect physical changes in the environment, and therefore does not constitute a “project” as defined by CEQA Guidelines section 15378; and B. Adopt Resolution No. 2022-05 approving Mid-Year Budget Appropriations and amending the Annual Operating and Capital Budget for Fiscal Year 2021-22. The question was called and the motion carried unanimously. 15. Reimbursement Agreement for Shelter Beds Within the Salvation Army Bell Shelter Recommendation: Approve and authorize the Mayor to execute a Reimbursement Agreement for shelter beds within the Salvation Army Bell Shelter with the cities of Bell, Bell Gardens, Commerce, Cudahy, Huntington Park, Maywood, and Southgate, collectively referred to as the Local Coordinating Alliance 1 (LCA1) at an estimated cost of $62,415.50 and not to exceed total of $100,000 for a term beginning March 1, 2022 and ending on June 30, 2023. City Administrator Fandino presented the staff report. Regular City Council Meeting Minutes Page 5 of 8 March 15, 2022 In response to Council questions, City Administrator Fandino, Deputy City Administrator Kimmey and Chief Sousa explained Vernon’s bed allocation; shelter location; use of the Salvation Army Bell Shelter; and wrap around services. MOTION Council Member Lopez moved and Council Member Larios seconded a motion to approve and authorize the Mayor to execute a Reimbursement Agreement for shelter beds within the Salvation Army Bell Shelter with the cities of Bell, Bell Gardens, Commerce, Cudahy, Huntington Park, Maywood, and Southgate, collectively referred to as the Local Coordinating Alliance 1 (LCA1) at an estimated cost of $62,415.50 and not to exceed total of $100,000 for a term beginning March 1, 2022 and ending on June 30, 2023. The question was called and the motion carried unanimously. 16. Change Order No.16 to the Amended and Restated Services Agreement with Siemens Energy, Inc. Recommendation: A. Find that approval of the proposed action is exempt from California Environmental Quality Act (CEQA) review, because it is a government fiscal activity that will not result in direct or indirect physical changes in the environment, and therefore does not constitute a “project” as defined by CEQA Guidelines section 15378; to the extent the Services Agreement with Siemens Energy provides for facility and equipment maintenance or repairs, such work is categorically exempt from CEQA review, in accordance with CEQA Guidelines § 15301, because the project consists of the maintenance, repair or minor alteration of existing structures, facilities, or equipment, and involves negligible or no expansion of an existing use; B. Approve and authorize the City Administrator to execute Change Order No. 16 to the Amended and Restated Services Agreement with Siemens Energy, Inc., (Siemens Energy) in substantially the same form as submitted, to revise the Payment Schedule and amend the termination date of the agreement; and C. Approve the issuance of a blanket Purchase Contract in an amount not-to-exceed $450,000 for maintenance services with Siemens Energy for the remainder of fiscal year 2021-2022. Public Utilities General Manager Alemu and Public Utilities Assistant General Manager of Generation and Operations Olsen presented the staff report. In response to Council questions, Public Utilities Assistant General Manager of Generation and Operations Olsen explained the proposed blanket purchase contract and anticipated costs. MOTION Council Member Lopez moved and Mayor Pro Tem Davis seconded a motion to: A. Find that approval of the proposed action is exempt from California Environmental Quality Act (CEQA) review, because it is a government fiscal activity that will not result in direct or indirect physical changes in the environment, and therefore does not constitute a “project” as defined by CEQA Guidelines section 15378; to the extent the Services Agreement with Siemens Energy Regular City Council Meeting Minutes Page 6 of 8 March 15, 2022 provides for facility and equipment maintenance or repairs, such work is categorically exempt from CEQA review, in accordance with CEQA Guidelines § 15301, because the project consists of the maintenance, repair or minor alteration of existing structures, facilities, or equipment, and involves negligible or no expansion of an existing use; B. Approve and authorize the City Administrator to execute Change Order No. 16 to the Amended and Restated Services Agreement with Siemens Energy, Inc., (Siemens Energy) in substantially the same form as submitted, to revise the Payment Schedule and amend the termination date of the agreement; and C. Approve the issuance of a blanket Purchase Contract in an amount not-to-exceed $450,000 for maintenance services with Siemens Energy for the remainder of fiscal year 2021-2022. The question was called and the motion carried unanimously. 17. City Council Appointments to Outside Agencies Recommendation: Appoint a delegate and alternate to represent the City at the Southern California Association of Government 2022 Regional Conference and General Assembly. City Clerk Pope presented the staff report. No appointments were made and the item tabled. 18. Labor and Materials Contract with Petrelli Electric, Inc. to Provide High Voltage Electric System Service, Maintenance and Utility Support Recommendation: A. Approve and authorize the City Administrator to execute a Labor and Materials Contract with Petrelli Electric, Inc. (Petrelli Electric), in substantially the same form as submitted, for a five-year term effective July 18, 2022, with an option to extend for an additional five years after the expiration of the initial term, to provide high voltage electric system service, maintenance, and utility support to Vernon’s Electric and Fiber Optic Systems; and B. Pursuant to Sections 3.32.220(B) and 3.32.110(B)(3) of the Vernon Municipal Code (VMC), find that it is commercially unreasonable to rebid the proposed contract for high voltage electric system service, maintenance, and utility support every three years due to significant risks to the electric system reliability and responsiveness, as well as added costs to the City and contractor including a steep learning curve in potential frequent transitions in contracted services. Public Utilities General Manager Alemu and Public Utilities Assistant General Manager Dusenbury presented the staff report. In response to Council questions Public Utilities Assistant General Manager Dusenbury explained Petrelli Electric, Inc. tenure and experience and the competitive bid process conducted in 2012. MOTION Mayor Pro Tem Davis moved and Council Member Lopez seconded a motion to: A. Approve and authorize the City Administrator to execute a Labor and Materials Regular City Council Meeting Minutes Page 7 of 8 March 15, 2022 Contract with Petrelli Electric, Inc. (Petrelli Electric), in substantially the same form as submitted, for a five-year term effective July 18, 2022, with an option to extend for an additional five years after the expiration of the initial term, to provide high voltage electric system service, maintenance, and utility support to Vernon’s Electric and Fiber Optic Systems; and B. Pursuant to Sections 3.32.220(B) and 3.32.110(B)(3) of the Vernon Municipal Code (VMC), find that it is commercially unreasonable to rebid the proposed contract for high voltage electric system service, maintenance, and utility support every three years due to significant risks to the electric system reliability and responsiveness, as well as added costs to the City and contractor including a steep learning curve in potential frequent transitions in contracted services. The question was called and the motion carried unanimously. ORAL REPORTS City Administrator Reports on Activities and other Announcements. City Administrator Fandino announced the Gas Rate Adjustments Community Meeting and Urban Tree Summit on March 16th, and the City’s Spring event on March 24, 2022. City Council Reports on Activities (including AB 1234), Announcements, or Directives to Staff. None. RECESS Mayor Ybarra recessed the meeting to Closed Session at 10:05 a.m. CLOSED SESSION 19. PUBLIC EMPLOYEE PERFORMANCE EVALUATION Government Code Section 54957(b)(1) Title: City Administrator 20. CONFERENCE WITH LEGAL COUNSEL – ANTICIPATED LITIGATION Initiation of Litigation Government Code Section 54956.9(d)(4) Number of potential cases: 1 RECONVENE At 12:30 p.m., Mayor Ybarra adjourned Closed Session and reconvened the regular meeting. Regular City Council Meeting Minutes Page 8 of 8 March 15, 2022 CLOSED SESSION REPORT Interim City Attorney Moussa reported that the Council met in Closed Session, discussed the items on the agenda, and took no reportable action. ADJOURNMENT Mayor Ybarra adjourned the meeting at 12:31 p.m. ______________________________ MELISSA YBARRA, Mayor ATTEST: _____________________________________ LISA POPE, City Clerk (seal) ! "#$% & ' & ()%*#$'+ ' ,' "#$%-"#$%. '' /01*%2) " #$% -" #$%. '+ ,' ,'' 3 '&')", ) /%%' & ()%*#$'+ ' ,' " #$% '' /01*%2) ! "#$% ' '' 4 ' '' ') ' ' & ()%*#$ 5 %) 1' ' 6' ' ' & ()%*#$) ' ,'') %)& ()%*#$ ! "# !$%&" ' % !( )! * "# *$%& + ","- ! !! !( " . ! (" %",% "# !"#$ "%!"#$&"'() "*" " +*"* *,- "., /,/(-,',) "" "" " ".-+ /()'++ "" *" *0".-, )'1+' "'1' / " *2"3" *3 "*"4 *5"%" *3 5**" "3 3" " "%'"* "" " "*3 * !"#$&"'()"% *" " +*"**,- 5"" 5 "#60 "3 3""%' * " "% ! " # $ &"' () " ., /,/(-,',)'** * " * %*%" "!" #$&"'()' ,'!"#$&"'() /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮ/ ŚĞƌĞďǇ ĐĞƌƟĨǇ ƚŚĂƚ ĐůĂŝŵƐ ĂŶĚͬŽƌ ĚĞŵĂŶĚƐ ŝŶĐůƵĚĞĚ ŝŶ ĂďŽǀĞ ůŝƐƚĞĚ ǁĂƌƌĂŶƚƌĞŐŝƐƚĞƌŚĂǀĞďĞĞŶĂƵĚŝƚĞĚĨŽƌĂĐĐƵƌĂĐǇĂŶĚĂǀĂŝůĂďŝůŝƚǇŽĨĨƵŶĚƐĨŽƌƉĂǇŵĞŶƚƐĂŶĚƚŚĂƚƐĂŝĚĐůĂŝŵƐĂŶĚͬŽƌĚĞŵĂŶĚƐĂƌĞĂĐĐƵƌĂƚĞĂŶĚƚŚĂƚƚŚĞĨƵŶĚƐĂƌĞĂǀĂŝůĂďůĞĨŽƌƉĂǇŵĞŶƚƐƚŚĞƌĞŽĨ͘ͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺ^ĐŽƩtŝůůŝĂŵƐŝƌĞĐƚŽƌŽĨ&ŝŶĂŶĐĞͬŝƚǇdƌĞĂƐƵƌĞƌĂƚĞ͗ͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺdŚŝƐŝƐƚŽĐĞƌƟĨǇƚŚĂƚƚŚĞĐůĂŝŵƐŽƌĚĞŵĂŶĚƐĐŽǀĞƌĞĚďǇƚŚĞĂďŽǀĞůŝƐƚĞĚǁĂƌƌĂŶƚƐŚĂǀĞďĞĞŶĂƵĚŝƚĞĚďǇƚŚĞŝƚǇŽƵŶĐŝůŽĨƚŚĞŝƚǇŽĨsĞƌŶŽŶĂŶĚƚŚĂƚĂůůŽĨƐĂŝĚǁĂƌƌĂŶƚƐĂƌĞĂƉƉƌŽǀĞĚĨŽƌƉĂǇŵĞŶƚƐĞǆĐĞƉƚtĂƌƌĂŶƚEƵŵďĞƌƐ͗ͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDƉĂǇŵĞŶƚƐƚŚĞƌĞŽĨ͘ͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺ^Ʃtŝůůŝ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮ>dZKE/sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEdWzDEdEhDZWzDEddϬϭϭ͘ϭϬϰϳ͘ϱϰϬϬϬϬ Ψ Ϯϭϳ͘ϱϳ hŶŝĨŽƌŵƐ ϰϭϭϭϲϳϲϲϲϳ/Ed^KZWKZd/KEϬϬϱϰϵϬͲΨ Ϯϭϳ͘ϱϳϬϯͬϬϭͬϮϬϮϮ ϭϮϱϲϭϬϭϭ͘ϭϬϬϯ͘ϱϱϬϬϬϬ Ψ ϴϱ͘ϬϬ WƵďůŝĐĂƟŽŶ^ĞƌǀŝĐĞƐ ϯϱϱϳϰϳϴ/>z:KhZE>KZWKZd/KEϬϬϬϵϰϳͲΨ ϴϱ͘ϬϬϬϯͬϬϭͬϮϬϮϮ ϭϮϱϲϮϬϱϱ͘ϵϮϬϬ͘ϱϵϲϮϬϬ Ψ ϴϵϯ͘Ϭϭ ůĞĐƚƌŽŶŝĐdĂŐŐŝŶŐΕ ϭϲϴϯϵϱ Ϭϱϱ͘ϬϬϬϮϴϵϭKWE^^d,EK>K'z/Ed>͕/ϬϬϬϲϮϵͲΨ ϴϵϯ͘ϬϭϬϯͬϬϭͬϮϬϮϮ ϭϮϱϲϯϬϱϱ͘ϵϮϬϬ͘ϱϱϬϬϮϮ Ψ ϭϴϯ͕ϱϱϴ͘Ϭϳ ZĞƐĞƌǀĂƟŽŶΘdƌĂŶƐŵŝƐƐŝŽŶŚĂƌŐĞƐΕ ϬϮϭϭϮϮd,'^KDWEzϬϬϭϱϴϭͲΨ ϭϴϯ͕ϱϱϴ͘ϬϳϬϯͬϬϭͬϮϬϮϮ ϭϮϱϲϰϬϭϭ͘ϭϬϮϲ͘ϱϵϰϮϬϬ Ψ ϲ͕ϯϬϯ͘ϳϱ dW&ĞĞƐϬϯͬϮϮ /sϮϳϰϳϬd,E^/E^hZE^Zs/^͕/EϬϬϰϯϬϯͲΨ ϲ͕ϯϬϯ͘ϳϱϬϯͬϬϯͬϮϬϮϮ ϭϮϱϲϱϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϲϬ Ψ ϭϮ͕ϰϱϭ͘Ϯϱ EĂƚƵƌĂů'ĂƐϬϭͬϮϮ Ϯϲϯϵϲϳ/dzK&W^EϬϬϮϭϰϯͲΨ ϭϮ͕ϰϱϭ͘ϮϱϬϯͬϬϯͬϮϬϮϮ ϭϮϱϲϲϬϭϭ͘ϭϬϰϵ͘ϱϵϬϬϬϬ Ψ ϯ͕ϵϬϬ͘ϬϬ WĂŝŶƟŶŐ^ĞƌǀŝĐĞΕ ϯϮϮ>DEdW/Ed/E'ΘKZϬϬϲϴϱϳͲΨ ϯ͕ϵϬϬ͘ϬϬϬϯͬϬϯͬϮϬϮϮ ϭϮϱϲϳϬϭϭ͘ϭϬϰϵ͘ϱϵϬϬϬϬ Ψ ϯ͕ϲϮϳ͘ϱϰ >ĂŶĚƐĐĂƉĞDĂŝŶƚĞŶĂŶĐĞϬϮͬϮϮ ϵϲϳϳϲDZ/WK^>E^W^͕/EϬϬϲϰϮϮͲΨ ϯ͕ϲϮϳ͘ϱϰϬϯͬϬϯͬϮϬϮϮ ϭϮϱϲϴWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϭŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮ>dZKE/sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEdWzDEdEhDZWzDEddϬϭϭ͘ϭϬϰϵ͘ϵϬϬϬϬϬ Ψ ϰϭ͕ϭϭϯ͘ϯϵ ϮϬϮϮŚĞǀƌŽůĞƚ^ŝůǀĞƌĂĚŽΕ tϴϱϱϳ Ϭϭϭ͘ϬϬϭϰϵϵϬEd/KE>hdK&>d'ZKhWϬϬϱϲϯϮͲϬϭϭ͘ϭϬϰϵ͘ϵϬϬϬϬϬ Ψ ϯϬϬ͘ϬϬ ϮǆƚƌĂ<ĞǇƐ tϴϱϱϳ Ϭϭϭ͘ϬϬϭϰϵϵϬϬϭϭ͘ϭϬϰϵ͘ϵϬϬϬϬϬ Ψ ϴ͘ϳϱ dŝƌĞ&ĞĞ tϴϱϱϳ Ϭϭϭ͘ϬϬϭϰϵϵϬϬϭϭ͘ϭϬϰϵ͘ϵϬϬϬϬϬ Ψ ϰ͕Ϯϰϰ͘ϴϳ ^ĂůĞƐdĂǆϭϬ͘Ϯϱ tϴϱϱϳϬϭϭ͘ϭϬϰϲ͘ϵϬϬϬϬϬ Ψ ϰϭ͕ϭϭϯ͘ϯϵ ϮϬϮϮŚĞǀƌŽůĞƚ^ŝůǀĞƌĂĚŽΕ tϴϱϱϴ Ϭϭϭ͘ϬϬϭϰϵϵϬϬϭϭ͘ϭϬϰϲ͘ϵϬϬϬϬϬ Ψ ϯϬϬ͘ϬϬ ϮǆƚƌĂ<ĞǇƐ tϴϱϱϴ Ϭϭϭ͘ϬϬϭϰϵϵϬϬϭϭ͘ϭϬϰϲ͘ϵϬϬϬϬϬ Ψ ϴ͘ϳϱ dŝƌĞ&ĞĞ tϴϱϱϴ Ϭϭϭ͘ϬϬϭϰϵϵϬϬϭϭ͘ϭϬϰϲ͘ϵϬϬϬϬϬ Ψ ϰ͕Ϯϰϰ͘ϴϳ ^ĂůĞƐdĂǆϭϬ͘Ϯϱ tϴϱϱϴϬϭϭ͘ϭϬϰϯ͘ϵϬϬϬϬϬ Ψ ϰϭ͕ϰϰϵ͘ϱϬ ϮϬϮϮ&ŽƌĚ^ƵƉĞƌƵƚǇ&ͲϱϱϬZt;&ϱ'Ϳy> t&Ϯϱϳϯ Ϭϭϭ͘ϬϬϭϰϳϱϮϬϭϭ͘ϭϬϰϯ͘ϵϬϬϬϬϬ Ψ ϭϳ͕ϴϵϴ͘ϬϬ <ŶĂƉŚĞŝĚĞĞĚ t&Ϯϱϳϯ Ϭϭϭ͘ϬϬϭϰϳϱϮϬϭϭ͘ϭϬϰϯ͘ϵϬϬϬϬϬ Ψ ϭϬ͘ϱϬ dŝƌĞ&ĞĞ t&Ϯϱϳϯ Ϭϭϭ͘ϬϬϭϰϳϱϮϬϭϭ͘ϭϬϰϯ͘ϵϬϬϬϬϬ Ψ ϲ͕Ϭϴϯ͘ϭϮ ^ĂůĞƐdĂǆϭϬ͘Ϯϱ t&ϮϱϳϯϬϭϭ͘ϭϬϰϯ͘ϵϬϬϬϬϬ Ψ ϰϭ͕ϳϴϴ͘ϭϰ ϮϬϮϮ&ŽƌĚ^ƵƉĞƌƵƚǇ&ͲϱϱϬZt;&ϱ'Ϳy> t&Ϯϳϯϳ Ϭϭϭ͘ϬϬϭϰϳϱϮϬϭϭ͘ϭϬϰϯ͘ϵϬϬϬϬϬ Ψ Ϯϳ͕ϳϱϭ͘ϬϬ <ŶĂƉŚĞŝĚĞŽǆĞĚ t&Ϯϳϯϳ Ϭϭϭ͘ϬϬϭϰϳϱϮϬϭϭ͘ϭϬϰϯ͘ϵϬϬϬϬϬ Ψ ϭϬ͘ϱϬ dŝƌĞ&ĞĞ t&Ϯϳϯϳ Ϭϭϭ͘ϬϬϭϰϳϱϮϬϭϭ͘ϭϬϰϯ͘ϵϬϬϬϬϬ Ψ ϳ͕ϭϮϳ͘ϳϲ ^ĂůĞƐdĂǆϭϬ͘Ϯϱ t&ϮϳϯϳΨ Ϯϯϯ͕ϰϱϮ͘ϱϰϬϯͬϬϯͬϮϬϮϮ ϭϮϱϲϵϬϭϭ͘ϭϬϮϰ͘ϱϵϯϮϬϬ Ψ Ϯϯϰ͘ϳϳ ZĞ͗>ŽƐŶŐĞůĞƐD^ϰWĞƌŵŝƚWĞƟƟŽŶ ϮϯϱϳϵϭZ/,Z^͕td^KEΘ'Z^,KEϬϬϯϵϬϬͲΨ Ϯϯϰ͘ϳϳϬϯͬϬϯͬϮϬϮϮ ϭϮϱϳϬWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϮŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮ>dZKE/sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEdWzDEdEhDZWzDEddϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϳϬ Ψ Ϯϰ͕ϲϲϵ͘ϬϬ >ĂŐƵŶĂĞůůϬϮͬϮϮ ϳϱϬϭϯϳϱϰϱϰ^K>/^KEϬϬϬϬϱϵͲϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϳϬ Ψ ϭϴϳ͕ϮϬϬ͘ϬϬ DĞĂĚ>ĂŐƵŶĂĞůůϬϮͬϮϮ ϳϱϬϭϯϳϱϰϱϱϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϳϬ Ψ ϳϵ͕ϮϬϬ͘ϬϬ sŝĐƚŽƌǀŝůůĞ>ƵŐŽsĞƌŶŽŶϬϮͬϮϮ ϳϱϬϭϯϳϱϰϵϯΨ Ϯϵϭ͕Ϭϲϵ͘ϬϬϬϯͬϬϯͬϮϬϮϮ ϭϮϱϳϭϬϭϭ͘ϭϬϰϭ͘ϱϵϱϮϬϬ Ψ Ϯϳ͕ϲϰϲ͘ϭϱ tĞƐƚͲ^ŝĚĞWƌŽũĞĐƚ^ƉĞĐŝĮĐWůĂŶ ϵϵϴϵϭϰd,ZZKzK'ZKhWϬϬϲϵϳϱͲΨ Ϯϳ͕ϲϰϲ͘ϭϱϬϯͬϬϯͬϮϬϮϮ ϭϮϱϳϮϬϭϭ͘ϭϬϰϵ͘ϱϵϬϬϬϬ Ψ ϭϬ͕ϮϱϬ͘ϬϬ ^ƚƌĞĞƚ^ǁĞĞƉŝŶŐ^ĞƌǀŝĐĞƐϬϮͬϮϮ >ϲϮϱϵtK>͕>>ϬϬϱϲϵϵͲΨ ϭϬ͕ϮϱϬ͘ϬϬϬϯͬϬϯͬϮϬϮϮ ϭϮϱϳϯϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϲϯ Ψ ϰϳϮ͕ϴϬϬ͘ϬϬ t/ƵĐƟŽŶ ϬϮϮϰϮϮhd^,E<dZh^dK͘ϬϬϮϴϬϴͲϬϱϲ͘ϱϲϭϬ͘ϱϵϲϳϭϬ Ψ ϵϬϯ͕ϲϱϬ͘ϬϬ t/ƵĐƟŽŶ ϬϮϮϰϮϮΨ ϭ͕ϯϳϲ͕ϰϱϬ͘ϬϬϬϯͬϬϯͬϮϬϮϮ ϭϮϱϳϰWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϯŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮ>dZKE/sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEdWzDEdEhDZWzDEddϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϱϬ Ψ ϭϱ͕Ϯϵϴ͘ϯϰ ZĞĐĂůĐƵůĂƟŽŶŚĂƌŐĞƐϬϭͬϭϵ ϮϬϮϮϬϮϬϭϯϮϱϯϮϬϴϴϮϱ>/&KZE//^KϬϬϮϰϭϮͲϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϱϬ Ψ Ͳϭϲ͕ϱϲϯ͘ϭϰ ZĞĐĂůĐƵůĂƟŽŶŚĂƌŐĞƐϭϭͬϮϭ ϮϬϮϮϬϯϬϭϯϭϱϯϲϲϭϳϴϮϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϳϬ Ψ Ͳϴϴ͘ϳϱ ZĞĐĂůĐƵůĂƟŽŶŚĂƌŐĞƐϭϭͬϮϭ ϮϬϮϮϬϯϬϭϯϭϱϯϲϲϭϳϴϮϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϵϬ Ψ Ͳϲ͕ϭϰϮ͘Ϭϰ ZĞĐĂůĐƵůĂƟŽŶŚĂƌŐĞƐϭϭͬϮϭ ϮϬϮϮϬϯϬϭϯϭϱϯϲϲϭϳϴϮϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϱϬ Ψ Ϯϱϳ͕ϵϲϳ͘ϵϲ /ŶŝƟĂůŚĂƌŐĞƐϬϮͬϮϮ ϮϬϮϮϬϯϬϭϯϭϱϯϲϲϭϳϴϮϬϱϱ͘ϵϮϬϬ͘ϱϬϬϮϭϬ Ψ ϭϰ͕ϳϳϲ͘ϴϴ /ŶŝƟĂůŚĂƌŐĞƐϬϮͬϮϮ ϮϬϮϮϬϯϬϭϯϭϱϯϲϲϭϳϴϮϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϳϬ Ψ Ͳϵ͕ϱϳϯ͘ϴϱ /ŶŝƟĂůŚĂƌŐĞƐϬϮͬϮϮ ϮϬϮϮϬϯϬϭϯϭϱϯϲϲϭϳϴϮϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϵϬ Ψ Ͳϭ͕ϱϲϯ͘Ϯϵ /ŶŝƟĂůŚĂƌŐĞƐϬϮͬϮϮ ϮϬϮϮϬϯϬϭϯϭϱϯϲϲϭϳϴϮϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϱϬ Ψ ϵ͕ϬϮϮ͘ϵϳ ZĞĐĂůĐƵůĂƟŽŶŚĂƌŐĞƐϭϭͬϮϭ ϮϬϮϮϬϯϬϭϯϭϱϯϲϲϭϳϴϮϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϳϬ Ψ Ͳϰϵ͘ϲϴ ZĞĐĂůĐƵůĂƟŽŶŚĂƌŐĞƐϭϭͬϮϭ ϮϬϮϮϬϯϬϭϯϭϱϯϲϲϭϳϴϮϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϵϬ Ψ ͲϮϯϰ͘ϳϴ ZĞĐĂůĐƵůĂƟŽŶŚĂƌŐĞƐϭϭͬϮϭ ϮϬϮϮϬϯϬϭϯϭϱϯϲϲϭϳϴϮΨ ϮϲϮ͕ϴϱϬ͘ϲϮϬϯͬϬϰͬϮϬϮϮ ϭϮϱϳϱϬϮϬ͘ϭϬϴϰ͘ϱϬϬϭϯϬ Ψ ϯϮ͕ϯϵϱ͘ϳϭ WŽƚĂďůĞΘZĞĐǇĐůĞĚtĂƚĞƌ sZ:EϮϮEdZ>^/EDtϬϬϭϰϬϭͲΨ ϯϮ͕ϯϵϱ͘ϳϭϬϯͬϬϰͬϮϬϮϮ ϭϮϱϳϲWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϰŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮ>dZKE/sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEdWzDEdEhDZWzDEddϬϭϭ͘ϭϭϬϬϮϭ Ψ Ϯ͕ϵϲϮ͘Ϭϯ ŵƉůŽǇĞĞŽŵƉƵƚĞƌ>ŽĂŶ ϬϮϮϴϮϮZ/,Zs/>>'^ϬϬϬϴϲϴͲΨ Ϯ͕ϵϲϮ͘ϬϯϬϯͬϬϰͬϮϬϮϮ ϭϮϱϳϳϬϮϬ͘ϭϬϴϰ͘ϱϬϬϭϭϬ Ψ ϭϵϲ͕ϱϱϬ͘ϴϰ 'ƌŽƵŶĚǁĂƚĞƌWƌŽĚƵĐƟŽŶΘƐƐĞƐƐŵĞŶƚ ϬϯϭϭϮϮtdZZW>E/^,DEd/^dZ/dϬϬϭϲϱϴͲΨ ϭϵϲ͕ϱϱϬ͘ϴϰϬϯͬϬϰͬϮϬϮϮ ϭϮϱϳϴϬϭϭ͘ϭϬϰϵ͘ϱϲϬϬϬϬ Ψ ϵϴ͘ϬϮ WĞƌŝŽĚ͗ϬϭͬϭϰͬϮϮͲϬϮͬϭϯͬϮϮ ϬϮϭϰϮϮ^K>/^KEϬϬϬϬϱϵͲΨ ϵϴ͘ϬϮϬϮͬϮϰͬϮϬϮϮ ϭϮϱϳϵϬϱϲ͘ϱϲϬϬ͘ϱϮϬϬϬϬ Ψ Ϯϲϴ͘ϯϳ ^ŵĂůůdŽŽůƐΘWůƵŵďŝŶŐ,ĂƌĚǁĂƌĞΕ ϵϯϲϬϯϰϵ Ϭϱϲ͘ϬϬϬϬϲϰϬ,KDWKdZ/d^Zs/^ϬϬϭϱϱϮͲΨ Ϯϲϴ͘ϯϳϬϯͬϬϭͬϮϬϮϮ ϭϮϱϴϬϬϭϭ͘ϭϬϬϯ͘ϱϮϬϬϬϬ Ψ Ϯϭ͘ϯϵ ^ƵƉƉůŝĞƐ ϮϭϳϳϵϴϳϲϯϬϬϭK&&/WKdϬϬϮϭϵϬͲϬϭϭ͘ϭϬϬϯ͘ϱϮϬϬϬϬ Ψ ϯϰ͘Ϭϵ ^ƵƉƉůŝĞƐ ϮϮϬϴϴϭϰϴϬϬϬϭΨ ϱϱ͘ϰϴϬϮͬϮϴͬϮϬϮϮ ϭϮϱϴϭϬϭϭ͘ϭϬϯϯ͘ϱϲϬϬϬϬ Ψ ϭϳ͘ϳϯ WĞƌŝŽĚ͗ϬϭͬϭϭͬϮϮͲϬϮͬϭϬͬϮϮ ϬϮϭϰϮϮd,'^KDWEzϬϬϭϱϴϭͲΨ ϭϳ͘ϳϯϬϯͬϬϭͬϮϬϮϮ ϭϮϱϴϮϬϭϭ͘ϭϬϰϭ͘ϱϮϬϬϬϬ Ψ ϭϭϬ͘ϴϳ WĞƌŝŽĚ͗ϬϮͬϮϮ ϵϯϯϯϭϮϬϴϮ;ϮͿhW^ϬϬϭϲϭϳͲϬϭϭ͘ϭϬϰϭ͘ϱϮϬϬϬϬ Ψ ϲϱ͘ϰϯ WĞƌŝŽĚ͗ϬϮͬϮϮ ϵϯϯϯϭϮϬϵϮ;ϮͿΨ ϭϳϲ͘ϯϬϬϯͬϬϯͬϮϬϮϮ ϭϮϱϴϯϬϮϬ͘ϭϬϴϰ͘ϵϬϬϬϬϬ Ψ ϮϮ͕ϰϭϮ͘ϱϬ tĞůůΘŽŽƐƚĞƌWƵŵƉDĂŝŶƚĞŶĂŶĐĞ Ϯϵϭϲϵ'EZ>WhDWKDWEz͕/EϬϬϬϭϰϳͲΨ ϮϮ͕ϰϭϮ͘ϱϬϬϯͬϬϴͬϮϬϮϮ ϭϮϱϴϰWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϱŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮ>dZKE/sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEdWzDEdEhDZWzDEddϬϮϬ͘ϭϬϴϰ͘ϵϬϬϬϬϬ Ψ Ϯ͕ϱϲϱ͘ϬϬ dĞĐŚŶŝĐĂůĞƐŝŐŶ^ĞƌǀŝĐĞƐ ϭϴϭϮEKZd,t^d>dZ/>^Zs/^͕ϬϬϱϲϭϰͲϬϮϬ͘ϭϬϴϰ͘ϱϵϬϬϬϬ Ψ Ϯ͕ϮϴϬ͘ϬϬ dĞĐŚŶŝĐĂůĞƐŝŐŶ^ĞƌǀŝĐĞƐ ϭϴϭϮϬϮϬ͘ϭϬϴϰ͘ϵϬϬϬϬϬ Ψ ϱϭ͕ϵϰϭ͘Ϯϱ dĞĐŚŶŝĐĂůĞƐŝŐŶ^ĞƌǀŝĐĞƐ ϭϴϭϮΨ ϱϲ͕ϳϴϲ͘ϮϱϬϯͬϬϴͬϮϬϮϮ ϭϮϱϴϱϬϱϱ͘ϴϰϬϬ͘ϱϵϲϮϬϬ Ψ ϭ͕Ϭϰϴ͘ϬϬ ŝƌŽŶĚŝƟŽŶĞƌDĂŝŶƚĞŶĂŶĐĞ DϭϬϰϳϭZh^,Z/ZKE/d/KE/E'ϬϬϲϲϯϳͲΨ ϭ͕Ϭϰϴ͘ϬϬϬϯͬϬϴͬϮϬϮϮ ϭϮϱϴϲϬϭϭ͘ϭϬϮϲ͘ϱϬϮϬϯϭ Ψ ϭϯ͕ϱϲϬ͘ϴϭ DĞĚŝĐĂůZĞƟƌĞĞƐΕ ϮϮϰϱϮϬϵϭϬEd,D>hZK^^ϬϬϱϭϴϮͲΨ ϭϯ͕ϱϲϬ͘ϴϭϬϯͬϭϬͬϮϬϮϮ ϭϮϱϴϳϬϭϭ͘ϵϬϭϵ͘ϴϲϬϬϬϬ Ψ Ϯ͕ϲϲϲ͘ϲϲ tĞďƉƉůŝĐĂƟŽŶWƌŽƚĞĐƚŽƌ͗ĂƐĞ&ĞĞ͕ /EϭϬϵϴϮϭϴ Ϭϭϭ͘ϬϬϭϱϬϬϳZ,^K&dd,EK>K'zKZWKZd/ϬϬϲϱϭϴͲϬϭϭ͘ϵϬϭϵ͘ϴϲϬϬϬϬ Ψ ϲ͕ϴϬϬ͘ϬϬ tW͗DĂŶĂŐĞĚ/ŶƚĞŐƌĂƟŽŶ͕KŶĞdŝŵĞΕ /EϭϬϵϴϮϭϴ Ϭϭϭ͘ϬϬϭϱϬϬϳΨ ϵ͕ϰϲϲ͘ϲϲϬϯͬϭϬͬϮϬϮϮ ϭϮϱϴϴϬϭϭ͘ϵϬϭϵ͘ϱϮϬϬϭϬ Ψ ϴϬϳ͘ϴϵ WƌŝŶƚĞƌ^ĐĂŶŶĞƌΕ YϰϴϬϭϳϭ Ϭϭϭ͘ϬϬϭϱϬϬϮt'KsZEDEd͕/EϬϬϬϰϰϳͲϬϭϭ͘ϵϬϭϵ͘ϱϮϬϬϭϬ Ψ ϴϮ͘ϴϭ ^ĂůĞƐdĂǆϭϬ͘Ϯϱ YϰϴϬϭϳϭΨ ϴϵϬ͘ϳϬϬϯͬϭϬͬϮϬϮϮ ϭϮϱϴϵWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϲŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮ>dZKE/sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEdWzDEdEhDZWzDEddϬϱϲ͘ϱϲϬϬ͘ϱϰϬϬϬϬ Ψ ϴϴϵ͘ϭϳ hŶŝĨŽƌŵƐ ϰϭϬϯϱϬϱϭϴϬ/Ed^KZWKZd/KEϬϬϱϰϵϬͲϬϮϬ͘ϭϬϴϰ͘ϱϰϬϬϬϬ Ψ ϭϯϳ͘ϳϲ hŶŝĨŽƌŵƐ ϰϭϬϯϱϬϱϭϴϬϬϱϱ͘ϴϬϬϬ͘ϱϰϬϬϬϬ Ψ Ϯϳ͘ϱϴ hŶŝĨŽƌŵƐ ϰϭϬϯϱϬϱϭϴϬϬϱϱ͘ϴϭϬϬ͘ϱϰϬϬϬϬ Ψ ϭϱϯ͘ϵϳ hŶŝĨŽƌŵƐ ϰϭϬϯϱϬϱϭϴϬϬϱϲ͘ϱϲϬϬ͘ϱϰϬϬϬϬ Ψ ϲϵ͘ϭϳ hŶŝĨŽƌŵƐ ϰϭϬϴϮϱϭϭϱϰϬϮϬ͘ϭϬϴϰ͘ϱϰϬϬϬϬ Ψ ϭϯϳ͘ϳϲ hŶŝĨŽƌŵƐ ϰϭϬϴϮϱϭϭϱϰϬϱϱ͘ϴϬϬϬ͘ϱϰϬϬϬϬ Ψ Ϯϳ͘ϱϴ hŶŝĨŽƌŵƐ ϰϭϬϴϮϱϭϭϱϰϬϱϱ͘ϴϭϬϬ͘ϱϰϬϬϬϬ Ψ ϭϱϯ͘ϵϳ hŶŝĨŽƌŵƐ ϰϭϬϴϮϱϭϭϱϰϬϱϲ͘ϱϲϬϬ͘ϱϰϬϬϬϬ Ψ ϲϵ͘ϭϳ hŶŝĨŽƌŵƐ ϰϭϬϴϵϮϵϱϲϯϬϮϬ͘ϭϬϴϰ͘ϱϰϬϬϬϬ Ψ ϭϯϳ͘ϳϲ hŶŝĨŽƌŵƐ ϰϭϬϴϵϮϵϱϲϯϬϱϱ͘ϴϬϬϬ͘ϱϰϬϬϬϬ Ψ Ϯϳ͘ϱϴ hŶŝĨŽƌŵƐ ϰϭϬϴϵϮϵϱϲϯϬϱϱ͘ϴϭϬϬ͘ϱϰϬϬϬϬ Ψ ϭϱϯ͘ϵϳ hŶŝĨŽƌŵƐ ϰϭϬϴϵϮϵϱϲϯϬϱϱ͘ϵϭϵϬ͘ϱϰϬϬϬϬ Ψ ϰϯϵ͘ϵϭ hŶŝĨŽƌŵƐ ϰϭϬϵϲϮϭϲϵϯϬϱϲ͘ϱϲϬϬ͘ϱϰϬϬϬϬ Ψ ϲϴ͘ϲϲ hŶŝĨŽƌŵƐ ϰϭϬϵϲϮϭϲϵϯϬϮϬ͘ϭϬϴϰ͘ϱϰϬϬϬϬ Ψ ϭϯϳ͘Ϯϱ hŶŝĨŽƌŵƐ ϰϭϬϵϲϮϭϲϵϯϬϱϱ͘ϴϬϬϬ͘ϱϰϬϬϬϬ Ψ Ϯϳ͘Ϭϳ hŶŝĨŽƌŵƐ ϰϭϬϵϲϮϭϲϵϯϬϱϱ͘ϴϭϬϬ͘ϱϰϬϬϬϬ Ψ ϭϱϯ͘ϰϱ hŶŝĨŽƌŵƐ ϰϭϬϵϲϮϭϲϵϯϬϱϱ͘ϵϭϵϬ͘ϱϰϬϬϬϬ Ψ ϭϳϮ͘ϯϱ hŶŝĨŽƌŵƐ ϰϭϭϬϯϬϳϯϬϬϬϱϲ͘ϱϲϬϬ͘ϱϰϬϬϬϬ Ψ ϲϴ͘ϲϲ hŶŝĨŽƌŵƐ ϰϭϭϬϯϬϳϯϬϬϬϮϬ͘ϭϬϴϰ͘ϱϰϬϬϬϬ Ψ ϭϯϳ͘Ϯϱ hŶŝĨŽƌŵƐ ϰϭϭϬϯϬϳϯϬϬϬϱϱ͘ϴϬϬϬ͘ϱϰϬϬϬϬ Ψ Ϯϳ͘Ϭϳ hŶŝĨŽƌŵƐ ϰϭϭϬϯϬϳϯϬϬϬϱϱ͘ϴϭϬϬ͘ϱϰϬϬϬϬ Ψ ϭϱϯ͘ϰϱ hŶŝĨŽƌŵƐ ϰϭϭϬϯϬϳϯϬϬϬϱϱ͘ϵϭϵϬ͘ϱϰϬϬϬϬ Ψ ϭϳϮ͘ϯϱ hŶŝĨŽƌŵƐ ϰϭϭϬϵϵϬϴϯϵWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϳŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮ>dZKE/sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEdWzDEdEhDZWzDEddϬϱϲ͘ϱϲϬϬ͘ϱϰϬϬϬϬ Ψ ϲϴ͘ϲϲ hŶŝĨŽƌŵƐ ϰϭϭϬϵϵϬϴϯϵ/Ed^KZWKZd/KEϬϬϱϰϵϬͲϬϮϬ͘ϭϬϴϰ͘ϱϰϬϬϬϬ Ψ ϭϯϴ͘Ϯϴ hŶŝĨŽƌŵƐ ϰϭϭϬϵϵϬϴϯϵϬϱϱ͘ϴϬϬϬ͘ϱϰϬϬϬϬ Ψ Ϯϳ͘Ϭϳ hŶŝĨŽƌŵƐ ϰϭϭϬϵϵϬϴϯϵϬϱϱ͘ϴϭϬϬ͘ϱϰϬϬϬϬ Ψ ϭϱϯ͘ϰϱ hŶŝĨŽƌŵƐ ϰϭϭϬϵϵϬϴϯϵϬϱϱ͘ϵϭϵϬ͘ϱϰϬϬϬϬ Ψ ϭϳϮ͘ϯϱ hŶŝĨŽƌŵƐ ϰϭϭϭϲϳϲϴϯϴϬϱϲ͘ϱϲϬϬ͘ϱϰϬϬϬϬ Ψ ϲϴ͘ϲϲ hŶŝĨŽƌŵƐ ϰϭϭϭϲϳϲϴϯϴϬϮϬ͘ϭϬϴϰ͘ϱϰϬϬϬϬ Ψ ϭϯϳ͘Ϯϱ hŶŝĨŽƌŵƐ ϰϭϭϭϲϳϲϴϯϴϬϱϱ͘ϴϬϬϬ͘ϱϰϬϬϬϬ Ψ Ϯϳ͘Ϭϳ hŶŝĨŽƌŵƐ ϰϭϭϭϲϳϲϴϯϴϬϱϱ͘ϴϭϬϬ͘ϱϰϬϬϬϬ Ψ ϭϱϯ͘ϰϱ hŶŝĨŽƌŵƐ ϰϭϭϭϲϳϲϴϯϴϬϭϭ͘ϭϬϰϲ͘ϱϰϬϬϬϬ Ψ ϮϮϴ͘Ϯϰ hŶŝĨŽƌŵƐ ϰϭϭϮϯϳϲϬϮϴϬϱϲ͘ϱϲϬϬ͘ϱϰϬϬϬϬ Ψ ͲϴϮϬ͘ϬϬ hŶŝĨŽƌŵƐ ϵϭϲϰϲϱϮϰϭϰΨ ϯ͕ϴϵϳ͘ϯϵϬϯͬϭϬͬϮϬϮϮ ϭϮϱϵϬϬϱϱ͘ϵϬϬϬ͘ϱϵϱϮϬϬ Ψ ϵ͕ϭϮϭ͘ϴϴ EĂƚƵƌĂů'ĂƐŽŵƉůŝĂŶĐĞ^ĞƌǀŝĐĞƐ ϭϭϮϲϬϬ'Ϯ/Ed'Zd^K>hd/KE^͕>>ϬϬϲϴϵϵͲΨ ϵ͕ϭϮϭ͘ϴϴϬϯͬϭϬͬϮϬϮϮ ϭϮϱϵϭϬϭϭ͘ϭϬϮϭ͘ϳϵϳϬϬϬ Ψ ϴ͕ϭϬϬ͘ϬϬ WƌŽĨĞƐƐŝŽŶĂů^ĞƌǀŝĐĞƐΕ DZϮϮ:DDKddZK>>/E^'ZKhW͕/EϬϬϱϭϬϴͲΨ ϴ͕ϭϬϬ͘ϬϬϬϯͬϭϬͬϮϬϮϮ ϭϮϱϵϮϬϭϭ͘ϵϬϭϵ͘ϴϲϬϬϬϬ Ψ ϯ͕Ϭϴϳ͘ϬϬ ZW^ǇƐƚĞŵ;DƵŶŝƐͿhƉŐƌĂĚĞ ϬϰϱϯϲϳϮϵϲdz>Zd,EK>K'/^͕/EϬϬϭϰϰϳͲΨ ϯ͕Ϭϴϳ͘ϬϬϬϯͬϭϬͬϮϬϮϮ ϭϮϱϵϯWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϴŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮ>dZKE/sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEdWzDEdEhDZWzDEddϬϮϬ͘ϮϳϮϬϭϬ Ψ ϯϰ͕ϴϴϯ͘ϳϮ YƵĂƌƚĞƌůǇWĂǇŵĞŶƚEŽ͘ϳΕ ϮϬϮϮϬϳtdZZW>E/^,DEd/^dZ/dϬϬϭϲϱϴͲΨ ϯϰ͕ϴϴϯ͘ϳϮϬϯͬϭϬͬϮϬϮϮ ϭϮϱϵϰϬϭϭ͘ϭϬϬϯ͘ϱϵϲϮϬϬ Ψ ϯϳϱ͘ϬϬ ^ƚŽƌĂŐĞ^ĞƌǀŝĐĞƐ ϱϳϯϲϱϮt/>>/D^dDE'DEdϬϬϯϱϴϰͲϬϭϭ͘ϭϬϬϯ͘ϱϵϲϮϬϬ Ψ ϭ͕ϯϵϯ͘ϵϯ ^ƚŽƌĂŐĞ^ĞƌǀŝĐĞƐ ϱϳϰϭϱϮΨ ϭ͕ϳϲϴ͘ϵϯϬϯͬϭϬͬϮϬϮϮ ϭϮϱϵϱϬϭϭ͘ϵϬϭϵ͘ϱϮϬϬϭϬ Ψ ϰ͕ϭϱϲ͘ϲϰ ϬϬϯϰϯϵϮϴϵͲEtͲYhEdhDΕ <ϭϴϲϲϵϰϮϬϭϬϭ Ϭϭϭ͘ϬϬϭϱϭϭϵKE^͕>>ϬϬϱϳϴϰͲϬϭϭ͘ϵϬϭϵ͘ϱϮϬϬϭϬ Ψ ϰϮϲ͘Ϭϲ ^ĂůĞƐdĂǆϭϬ͘Ϯϱ <ϭϴϲϲϵϰϮϬϭϬϭΨ ϰ͕ϱϴϮ͘ϳϬϬϯͬϭϬͬϮϬϮϮ ϭϮϱϵϲϬϭϭ͘ϭϬϮϲ͘ϱϬϮϬϵϲ Ψ ϭ͕ϱϯϴ͕ϲϵϯ͘ϬϬ WƌĞĨƵŶĚKW ϬϯϭϬϮϮ>WZ^ϬϬϬϳϭϰͲΨ ϭ͕ϱϯϴ͕ϲϵϯ͘ϬϬϬϯͬϭϬͬϮϬϮϮ ϭϮϱϵϳWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϵŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮ>dZKE/sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEdWzDEdEhDZWzDEddϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϱϬ Ψ Ϯ͕ϵϱϰ͘ϯϮ ZĞĐĂůĐƵůĂƟŽŶŚĂƌŐĞƐϬϱͬϭϵ ϮϬϮϮϬϯϬϴϯϭϱϯϴϭϲϰϲϴ>/&KZE//^KϬϬϮϰϭϮͲϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϳϬ Ψ ϱ͘Ϯϲ ZĞĐĂůĐƵůĂƟŽŶŚĂƌŐĞƐϬϱͬϭϵ ϮϬϮϮϬϯϬϴϯϭϱϯϴϭϲϰϲϴϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϵϬ Ψ ϳϱ͘ϰϴ ZĞĐĂůĐƵůĂƟŽŶŚĂƌŐĞƐϬϱͬϭϵ ϮϬϮϮϬϯϬϴϯϭϱϯϴϭϲϰϲϴϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϱϬ Ψ ϭ͕ϭϵϯ͘ϵϬ ZĞĐĂůĐƵůĂƟŽŶŚĂƌŐĞƐϭϭͬϮϭ ϮϬϮϮϬϯϬϴϯϭϱϯϴϭϲϰϲϴϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϳϬ Ψ ϳϱ͘ϲϬ ZĞĐĂůĐƵůĂƟŽŶŚĂƌŐĞƐϭϭͬϮϭ ϮϬϮϮϬϯϬϴϯϭϱϯϴϭϲϰϲϴϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϵϬ Ψ Ͳϲϵϱ͘ϲϴ ZĞĐĂůĐƵůĂƟŽŶŚĂƌŐĞƐϭϭͬϮϭ ϮϬϮϮϬϯϬϴϯϭϱϯϴϭϲϰϲϴϬϱϱ͘ϵϮϬϬ͘ϰϱϬϬϭϱ Ψ Ͳϳ͘ϭϮ ZĞĐĂůĐƵůĂƟŽŶŚĂƌŐĞƐϬϮͬϭϵ ϮϬϮϮϬϯϬϴϯϭϱϯϴϭϲϰϲϴϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϳϬ Ψ ϭϯ͘ϲϲ ZĞĐĂůĐƵůĂƟŽŶŚĂƌŐĞƐϬϮͬϭϵ ϮϬϮϮϬϯϬϴϯϭϱϯϴϭϲϰϲϴϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϱϬ Ψ Ϯϴϱ͕ϮϲϮ͘ϰϯ /ŶŝƟĂůŚĂƌŐĞƐϬϮͬϮϮ ϮϬϮϮϬϯϬϴϯϭϱϯϴϭϲϰϲϴϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϳϬ Ψ ϵ͕ϮϲϮ͘ϳϮ /ŶŝƟĂůŚĂƌŐĞƐϬϮͬϮϮ ϮϬϮϮϬϯϬϴϯϭϱϯϴϭϲϰϲϴϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϵϬ Ψ ϭϳ͕ϲϰϮ͘Ϭϳ /ŶŝƟĂůŚĂƌŐĞƐϬϮͬϮϮ ϮϬϮϮϬϯϬϴϯϭϱϯϴϭϲϰϲϴϬϱϱ͘ϵϮϬϬ͘ϱϬϬϮϭϬ Ψ ϭϲ͕ϮϬϲ͘ϭϬ /ŶŝƟĂůŚĂƌŐĞƐϬϮͬϮϮ ϮϬϮϮϬϯϬϴϯϭϱϯϴϭϲϰϲϴϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϱϬ Ψ ͲϮ͕Ϯϰϭ͘ϴϳ ZĞĐĂůĐƵůĂƟŽŶŚĂƌŐĞƐϬϯͬϮϭ ϮϬϮϮϬϯϬϴϯϭϱϯϴϭϲϰϲϴϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϳϬ Ψ ϭ͕Ϭϵϰ͘ϰϰ ZĞĐĂůĐƵůĂƟŽŶŚĂƌŐĞƐϬϯͬϮϭ ϮϬϮϮϬϯϬϴϯϭϱϯϴϭϲϰϲϴWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϭϬŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮ>dZKE/sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEdWzDEdEhDZWzDEddϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϴϬ Ψ ϰ͘Ϯϱ ZĞĐĂůĐƵůĂƟŽŶŚĂƌŐĞƐϬϯͬϮϭ ϮϬϮϮϬϯϬϴϯϭϱϯϴϭϲϰϲϴ>/&KZE//^KϬϬϮϰϭϮͲϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϵϬ Ψ ϰ͕ϭϲϬ͘Ϭϱ ZĞĐĂůĐƵůĂƟŽŶŚĂƌŐĞƐϬϯͬϮϭ ϮϬϮϮϬϯϬϴϯϭϱϯϴϭϲϰϲϴΨ ϯϯϱ͕ϬϬϱ͘ϲϭϬϯͬϭϬͬϮϬϮϮ ϭϮϱϵϴϬϱϱ͘ϵϭϬϬ͘ϵϬϬϬϬϬ Ψ ϭϵϳ͕ϴϵϴ͘ϰϵ ůĞĐƚƌŝĐ^ĞƌǀŝĐĞDĂŝŶƚĞŶĂŶĐĞϬϮͬϮϮ ϮϮϬϬϲϯWdZ>>/>dZ/͕/EϬϬϯϬϰϵͲϬϱϳ͘ϭϬϱϳ͘ϵϬϬϬϬϬ Ψ ϭϯ͕Ϭϲϯ͘Ϭϰ ůĞĐƚƌŝĐ^ĞƌǀŝĐĞDĂŝŶƚĞŶĂŶĐĞϬϮͬϮϮ ϮϮϬϬϲϯϬϱϱ͘ϴϯϬϬ͘ϱϵϬϬϬϬ Ψ ϲϳϳ͕ϳϵϲ͘ϲϬ ůĞĐƚƌŝĐ^ĞƌǀŝĐĞDĂŝŶƚĞŶĂŶĐĞϬϮͬϮϮ ϮϮϬϬϲϯϬϱϱ͘ϴϬϬϬ͘ϱϵϬϬϬϬ Ψ ϳϲ͕ϴϯϰ͘ϲϬ ůĞĐƚƌŝĐ^ĞƌǀŝĐĞDĂŝŶƚĞŶĂŶĐĞϬϮͬϮϮ ϮϮϬϬϲϯϬϱϳ͘ϭϬϱϳ͘ϱϵϬϬϬϬ Ψ Ϯϰ͕ϬϮϴ͘ϰϳ ůĞĐƚƌŝĐ^ĞƌǀŝĐĞDĂŝŶƚĞŶĂŶĐĞϬϮͬϮϮ ϮϮϬϬϲϯϬϮϬ͘ϭϬϴϰ͘ϵϬϬϬϬϬ Ψ ϭϳ͕ϵϱϵ͘ϭϳ ůĞĐƚƌŝĐ^ĞƌǀŝĐĞDĂŝŶƚĞŶĂŶĐĞϬϮͬϮϮ ϮϮϬϬϲϯϬϱϱ͘ϵϭϬϬ͘ϵϬϬϬϬϬ Ψ ϳϱϯ͕ϯϮϭ͘ϱϮ ŽŶĚWƌŽũĞĐƚƐ ϮϮϬϬϲϯΨ ϭ͕ϳϲϬ͕ϵϬϭ͘ϴϵϬϯͬϭϬͬϮϬϮϮ ϭϮϱϵϵϬϱϱ͘ϴϰϬϬ͘ϱϵϬϬϬϬ Ψ Ϯ͕ϵϮϭ͘Ϭϯ ^ŵĂůůdŽŽůƐΘWůƵŵďŝŶŐ,ĂƌĚǁĂƌĞΕ ϬϯϭϭϮϮͺDh>d/W> Ϭϱϱ͘ϬϬϬϮϵϬϮ,KDWKdZ/d^Zs/^ϬϬϭϱϱϮͲΨ Ϯ͕ϵϮϭ͘ϬϯϬϯͬϭϭͬϮϬϮϮ ϭϮϲϬϬϬϱϱ͘ϭϳϬϮϬϬ Ψ Ϯ͕ϮϴϬ͘ϬϬ YƵĂƌƚĞƌůǇ/ŶƐƉĞĐƟŽŶϭϭͬϮϭ ϭϱϰϱϴϲϵϬϳ<KEZE^͕/EϬϬϮϭϲϵͲΨ Ϯ͕ϮϴϬ͘ϬϬϬϯͬϭϭͬϮϬϮϮ ϭϮϲϬϭϬϱϱ͘ϭϳϬϮϬϬ Ψ ϮϬ͕ϰϳϬ͘ϵϵ DWƵŵƉWĂƌƚƐ ϵϬϱϵϬϳϰϮ^h>ZWhDW^Zs/^;h^Ϳ͕/EϬϬϳϮϱϬͲΨ ϮϬ͕ϰϳϬ͘ϵϵϬϯͬϭϭͬϮϬϮϮ ϭϮϲϬϮWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϭϭŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮ>dZKE/sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEdWzDEdEhDZWzDEddϬϱϱ͘ϭϳϬϮϬϬ Ψ ϳϮϵ͘ϵϬ WŽƌƚĂďůĞZĞƐƚƌŽŽŵ^ĞƌǀŝĐĞ /EsϬϬϰϲϴϲϬϯhE/d^/d^Zs/^K&ϬϬϯϲϬϭͲΨ ϳϮϵ͘ϵϬϬϯͬϭϭͬϮϬϮϮ ϭϮϲϬϯϬϭϭ͘ϭϬϰϯ͘ϱϵϬϬϬϬ Ψ ϯ͕ϳϮϰ͘ϬϬ dƌĂĸĐ^ŝŐŶĂůDĂŝŶƚĞŶĂŶĐĞ ϭϱϬϭϱZ>dZ/>^K>hd/KE^͕/EϬϬϳϬϮϲͲϬϭϭ͘ϭϬϰϯ͘ϱϵϬϬϬϬ Ψ ϯ͕ϲϵϲ͘ϬϬ dƌĂĸĐ^ŝŐŶĂůDĂŝŶƚĞŶĂŶĐĞ ϭϱϬϭϲΨ ϳ͕ϰϮϬ͘ϬϬϬϯͬϭϲͬϮϬϮϮ ϭϮϲϬϰϬϮϬ͘ϭϬϴϰ͘ϵϬϬϬϬϬ Ψ ϯϵ͕ϵϵϱ͘ϬϬ ZĞŚĂďŝůŝƚĂƟŽŶŽĨZĞƐĞƌǀŽŝƌƐΕ ϬϮϮϴϮϮW/d>/Eh^dZ/>Kd/E'^ϬϬϳϬϴϵͲΨ ϯϵ͕ϵϵϱ͘ϬϬϬϯͬϭϲͬϮϬϮϮ ϭϮϲϬϱϬϮϬ͘ϭϬϴϰ͘ϱϱϬϬϬϬ Ψ ϭϬϱ͘ϬϬ WƵďůŝĐĂƟŽŶ^ĞƌǀŝĐĞƐ ϯϱϱϯϴϵϳ/>z:KhZE>KZWKZd/KEϬϬϬϵϰϳͲΨ ϭϬϱ͘ϬϬϬϯͬϭϲͬϮϬϮϮ ϭϮϲϬϲϬϭϭ͘ϵϬϭϵ͘ϱϮϬϬϭϬ Ψ ϭϬ͕ϭϭϯ͘ϯϬ >ĂƉƚŽƉƐΕ ϭϬϱϯϳϮϱϳϬϭϬ Ϭϭϭ͘ϬϬϭϱϬϴϴ>>DZ<d/E'>WϬϬϭϮϬϲͲϬϭϭ͘ϵϬϭϵ͘ϱϮϬϬϭϬ Ψ ϯ͕ϲϳϯ͘ϳϬ EŽŶͲdĂǆĂďůĞĨƌŽŵďŽǀĞ>ŝŶĞ/ƚĞŵ ϭϬϱϯϳϮϱϳϬϭϬ Ϭϭϭ͘ϬϬϭϱϬϴϴϬϭϭ͘ϵϬϭϵ͘ϱϮϬϬϭϬ Ψ ϴϱ͘ϬϬ ŶǀŝƌŽŶŵĞŶƚĂů&ĞĞ ϭϬϱϯϳϮϱϳϬϭϬ Ϭϭϭ͘ϬϬϭϱϬϴϴϬϭϭ͘ϵϬϭϵ͘ϱϮϬϬϭϬ Ψ ϭ͕Ϭϰϱ͘ϯϰ ^ĂůĞƐdĂǆϭϬ͘Ϯϱ ϭϬϱϯϳϮϱϳϬϭϬΨ ϭϰ͕ϵϭϳ͘ϯϰϬϯͬϭϲͬϮϬϮϮ ϭϮϲϬϳϬϭϭ͘ϵϬϭϵ͘ϱϮϬϬϭϬ Ψ ϯ͕ϴϬϬ͘ϬϬ ƌĐ'/^KŶůŝŶĞ'/^WƌŽĨĞƐƐŝŽŶĂůĚǀĂŶĐĞĚϵϰϭϲϴϮϭϮ Ϭϭϭ͘ϬϬϭϱϭϬϲ^Z/͕/EϬϬϯϵϴϮͲΨ ϯ͕ϴϬϬ͘ϬϬϬϯͬϭϲͬϮϬϮϮ ϭϮϲϬϴWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϭϮŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮ>dZKE/sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEdWzDEdEhDZWzDEddϬϱϱ͘ϴϰϬϬ͘ϱϵϲϮϬϬ Ψ ϭϬϮ͘ϬϬ ŝƐƉŽƐĂůΘZĞĐǇĐůŝŶŐ^ĞƌǀŝĐĞƐ ϮϭyϬϴϮϮϯ,h>tzZh/^,^Zs/K͕ϬϬϱϯϱϬͲϬϱϱ͘ϴϰϬϬ͘ϱϵϲϮϬϬ Ψ ϮϬϮ͘ϬϬ ŝƐƉŽƐĂůΘZĞĐǇĐůŝŶŐ^ĞƌǀŝĐĞƐ ϮϭyϬϴϮϯϭϬϱϱ͘ϴϰϬϬ͘ϱϵϲϮϬϬ Ψ ϭϬϮ͘ϬϬ ŝƐƉŽƐĂůΘZĞĐǇĐůŝŶŐ^ĞƌǀŝĐĞƐ ϮϮyϬϴϰϳϱϬϱϱ͘ϴϰϬϬ͘ϱϵϲϮϬϬ Ψ ϮϮϳ͘ϬϬ ŝƐƉŽƐĂůΘZĞĐǇĐůŝŶŐ^ĞƌǀŝĐĞƐ ϮϮyϬϴϰϴϮΨ ϲϯϯ͘ϬϬϬϯͬϭϲͬϮϬϮϮ ϭϮϲϬϵϬϭϭ͘ϵϬϭϵ͘ϱϮϬϬϭϬ Ψ ϴϭϯ͘ϮϬ DŝĐƌŽƐŽŌKĸĐĞϯϲϱ^ƵďƐĐƌŝƉƟŽŶΕ ϭϭϬϬϵϬϱϰϲϮ Ϭϭϭ͘ϬϬϭϱϭϭϮ/E^/',dWh>/^dKZ͕/EϬϬϯϲϬϲͲΨ ϴϭϯ͘ϮϬϬϯͬϭϲͬϮϬϮϮ ϭϮϲϭϬϬϱϱ͘ϵϬϬϬ͘ϱϵϲϮϬϬ Ψ ϯϬ͕Ϭϳϱ͘ϱϬ ŶǀŽŵƉůŝĂŶĐĞ^ƵƉƉŽƌƚ^ĞƌǀŝĐĞƐ ϯϰϬϰϱϬϬϬϭϴ:K^E'/EZ/E''ZKhW͕/EϬϬϲϴϴϲͲϬϱϱ͘ϵϭϵϬ͘ϱϵϲϮϬϬ Ψ ϭϬϮ͕ϴϲϴ͘Ϭϭ ŶǀŽŵƉůŝĂŶĐĞ^ƵƉƉŽƌƚ^ĞƌǀŝĐĞƐ ϯϰϬϰϱϬϬϬϭϴΨ ϭϯϮ͕ϵϰϯ͘ϱϭϬϯͬϭϲͬϮϬϮϮ ϭϮϲϭϭϬϱϱ͘ϵϬϬϬ͘ϱϵϲϱϱϬ Ψ ϲ͕ϬϬϬ͘ϬϬ DĞŵďĞƌƐŚŝƉƵĞƐΕ ϰϰϳϲ>KhEdzh^/E^^&Zd/KEϬϬϲϱϳϬͲΨ ϲ͕ϬϬϬ͘ϬϬϬϯͬϭϲͬϮϬϮϮ ϭϮϲϭϮWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϭϯŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮ>dZKE/sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEdWzDEdEhDZWzDEddϬϮϬ͘ϭϬϴϰ͘ϱϮϬϬϬϬ Ψ Ϯϲ͘Ϯϲ ^ŵĂůůdŽŽůƐ͕WůƵŵďŝŶŐΘƵŝůĚŝŶŐ ϭϭϳϲϯϯ Ϭϭϭ͘ϬϬϭϰϴϵϭ>:K,E^KE,ZtZKηϭϬϬϬϴϬϰͲϬϱϱ͘ϴϰϬϬ͘ϱϵϬϬϬϬ Ψ Ϯϳϴ͘Ϭϴ ^ŵĂůůdŽŽůƐ͕WůƵŵďŝŶŐΘƵŝůĚŝŶŐ ϭϭϳϳϳϳ Ϭϱϱ͘ϬϬϬϮϵϬϯϬϮϬ͘ϭϬϴϰ͘ϵϬϬϬϬϬ Ψ ϭϵϳ͘Ϭϱ ^ŵĂůůdŽŽůƐ͕WůƵŵďŝŶŐΘƵŝůĚŝŶŐ ϭϭϳϳϴϮ Ϭϭϭ͘ϬϬϭϰϴϵϭϬϮϬ͘ϭϬϴϰ͘ϵϬϬϬϬϬ Ψ ϯϱ͘Ϭϯ ^ŵĂůůdŽŽůƐ͕WůƵŵďŝŶŐΘƵŝůĚŝŶŐ ϭϭϳϳϴϴ Ϭϭϭ͘ϬϬϭϰϴϵϭϬϮϬ͘ϭϬϴϰ͘ϵϬϬϬϬϬ Ψ ϯϭϮ͘ϵϵ ^ŵĂůůdŽŽůƐ͕WůƵŵďŝŶŐΘƵŝůĚŝŶŐ ϭϭϳϳϵϲ Ϭϭϭ͘ϬϬϭϰϴϵϭϬϱϱ͘ϴϬϬϬ͘ϱϵϬϬϬϬ Ψ ϭϲ͘ϯϳ ^ŵĂůůdŽŽůƐ͕WůƵŵďŝŶŐΘƵŝůĚŝŶŐ ϭϭϳϳϵϳ Ϭϱϱ͘ϬϬϬϮϵϬϯϬϮϬ͘ϭϬϴϰ͘ϵϬϬϬϬϬ Ψ ϱϲ͘ϴϵ WůƵŵďŝŶŐĂŶĚďƵŝůĚŝŶŐŚĂƌĚǁĂƌĞΕ ϭϭϳϴϬϵ Ϭϭϭ͘ϬϬϭϰϴϵϭϬϮϬ͘ϭϬϴϰ͘ϱϮϬϬϬϬ Ψ ϯϮ͘ϳϰ ^ŵĂůůdŽŽůƐ͕WůƵŵďŝŶŐΘƵŝůĚŝŶŐ ϭϭϴϬϱϲ Ϭϭϭ͘ϬϬϭϰϴϵϭϬϮϬ͘ϭϬϴϰ͘ϱϮϬϬϬϬ Ψ ϯϯ͘ϲϲ ^ŵĂůůdŽŽůƐ͕WůƵŵďŝŶŐΘƵŝůĚŝŶŐ ϭϭϴϬϲϴ Ϭϭϭ͘ϬϬϭϰϴϵϭϬϱϱ͘ϴϰϬϬ͘ϱϵϬϬϬϬ Ψ ϭϴϲ͘ϭϰ ^ŵĂůůdŽŽůƐ͕WůƵŵďŝŶŐΘƵŝůĚŝŶŐ ϭϭϴϬϴϭ Ϭϱϱ͘ϬϬϬϮϵϬϯϬϮϬ͘ϭϬϴϰ͘ϵϬϬϬϬϬ Ψ ϭϭϲ͘ϲϯ ^ŵĂůůdŽŽůƐ͕WůƵŵďŝŶŐΘƵŝůĚŝŶŐ ϭϭϴϭϮϲ Ϭϭϭ͘ϬϬϭϰϴϵϭϬϮϬ͘ϭϬϴϰ͘ϵϬϬϬϬϬ Ψ Ϯϴ͘Ϯϱ ^ŵĂůůdŽŽůƐ͕WůƵŵďŝŶŐΘƵŝůĚŝŶŐ ϭϭϴϭϰϵ Ϭϭϭ͘ϬϬϭϰϴϵϭϬϱϱ͘ϴϰϬϬ͘ϱϮϬϬϬϬ Ψ ϮϲϮ͘ϳϯ ^ŵĂůůdŽŽůƐ͕WůƵŵďŝŶŐΘƵŝůĚŝŶŐ ϭϭϴϭϳϵ Ϭϱϱ͘ϬϬϬϮϵϬϯϬϮϬ͘ϭϬϴϰ͘ϱϮϬϬϬϬ Ψ ϵϰ͘Ϭϴ ^ŵĂůůdŽŽůƐ͕WůƵŵďŝŶŐΘƵŝůĚŝŶŐ ϭϭϴϭϴϰ Ϭϭϭ͘ϬϬϭϰϴϵϭϬϱϱ͘ϵϬϬϬ͘ϱϵϲϳϬϬ Ψ ϵϭϱ͘Ϭϵ ^ŵĂůůdŽŽůƐ͕WůƵŵďŝŶŐΘƵŝůĚŝŶŐ ϭϭϴϮϴϳ Ϭϱϱ͘ϬϬϬϮϵϬϯϬϱϱ͘ϴϰϬϬ͘ϱϵϬϬϬϬ Ψ ϱϴ͘Ϭϭ ^ŵĂůůdŽŽůƐ͕WůƵŵďŝŶŐΘƵŝůĚŝŶŐ ϭϭϴϯϭϰ Ϭϱϱ͘ϬϬϬϮϵϬϯϬϮϬ͘ϭϬϴϰ͘ϱϮϬϬϬϬ Ψ Ϯϴϲ͘ϲϯ ^ŵĂůůdŽŽůƐ͕WůƵŵďŝŶŐΘƵŝůĚŝŶŐ ϭϭϴϰϬϵ Ϭϭϭ͘ϬϬϭϰϴϵϭϬϮϬ͘ϭϬϴϰ͘ϵϬϬϬϬϬ Ψ ϭϰϮ͘ϮϬ ^ŵĂůůdŽŽůƐ͕WůƵŵďŝŶŐΘƵŝůĚŝŶŐ ϭϭϴϱϯϳ Ϭϭϭ͘ϬϬϭϰϴϵϭϬϱϱ͘ϴϰϬϬ͘ϱϵϬϬϬϬ Ψ ϲϭ͘Ϯϱ ^ŵĂůůdŽŽůƐ͕WůƵŵďŝŶŐΘƵŝůĚŝŶŐ ϭϭϴϱϳϳ Ϭϱϱ͘ϬϬϬϮϵϬϯϬϮϬ͘ϭϬϴϰ͘ϵϬϬϬϬϬ Ψ ϰϰ͘ϭϬ ^ŵĂůůdŽŽůƐ͕WůƵŵďŝŶŐΘƵŝůĚŝŶŐ ϭϭϴϳϯϲ Ϭϭϭ͘ϬϬϭϰϴϵϭϬϱϱ͘ϴϰϬϬ͘ϱϵϬϬϬϬ Ψ ϭϳ͘ϰϴ ^ŵĂůůdŽŽůƐ͕WůƵŵďŝŶŐΘƵŝůĚŝŶŐ ϭϭϴϳϰϳ Ϭϱϱ͘ϬϬϬϮϵϬϯϬϱϱ͘ϴϰϬϬ͘ϱϵϬϬϬϬ Ψ Ͳϭϳ͘ϰϴ ^ŵĂůůdŽŽůƐ͕WůƵŵďŝŶŐΘƵŝůĚŝŶŐ ϭϭϴϳϰϵ Ϭϱϱ͘ϬϬϬϮϵϬϯWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϭϰŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮ>dZKE/sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEdWzDEdEhDZWzDEddϬϮϬ͘ϭϬϴϰ͘ϵϬϬϬϬϬ Ψ ϭϯ͘ϭϬ ^ŵĂůůdŽŽůƐ͕WůƵŵďŝŶŐΘƵŝůĚŝŶŐ ϭϭϴϳϱϬ Ϭϭϭ͘ϬϬϭϰϴϵϭ>:K,E^KE,ZtZKηϭϬϬϬϴϬϰͲϬϱϱ͘ϴϰϬϬ͘ϱϵϬϬϬϬ Ψ ϰϰ͘ϴϱ ^ŵĂůůdŽŽůƐ͕WůƵŵďŝŶŐΘƵŝůĚŝŶŐ ϭϭϴϴϰϬ Ϭϱϱ͘ϬϬϬϮϵϬϯϬϮϬ͘ϭϬϴϰ͘ϵϬϬϬϬϬ Ψ ϯϬ͘ϱϱ ^ŵĂůůdŽŽůƐ͕WůƵŵďŝŶŐΘƵŝůĚŝŶŐ ϭϭϵϬϬϰ Ϭϭϭ͘ϬϬϭϰϴϵϭϬϮϬ͘ϭϬϴϰ͘ϵϬϬϬϬϬ Ψ Ϯϵ͘ϱϯ ^ŵĂůůdŽŽůƐ͕WůƵŵďŝŶŐΘƵŝůĚŝŶŐ ϭϭϵϬϯϲ Ϭϭϭ͘ϬϬϭϰϴϵϭϬϮϬ͘ϭϬϴϰ͘ϵϬϬϬϬϬ Ψ ϵϵ͘ϯϰ ^ŵĂůůdŽŽůƐ͕WůƵŵďŝŶŐΘƵŝůĚŝŶŐ ϭϭϵϬϳϭ Ϭϭϭ͘ϬϬϭϰϴϵϭϬϮϬ͘ϭϬϴϰ͘ϵϬϬϬϬϬ Ψ ϰϬϲ͘ϰϲ ^ŵĂůůdŽŽůƐ͕WůƵŵďŝŶŐΘƵŝůĚŝŶŐ ϭϭϵϬϴϲ Ϭϭϭ͘ϬϬϭϰϴϵϭϬϱϱ͘ϴϰϬϬ͘ϱϵϬϬϬϬ Ψ Ϯϴϯ͘ϱϰ ^ŵĂůůdŽŽůƐ͕WůƵŵďŝŶŐΘƵŝůĚŝŶŐ ϭϭϵϭϭϬ Ϭϱϱ͘ϬϬϬϮϵϬϯϬϱϱ͘ϴϰϬϬ͘ϱϵϬϬϬϬ Ψ ϯϯϵ͘ϲϳ ^ŵĂůůdŽŽůƐ͕WůƵŵďŝŶŐΘƵŝůĚŝŶŐ ϭϭϵϮϬϳ Ϭϱϱ͘ϬϬϬϮϵϬϯϬϱϱ͘ϴϬϬϬ͘ϱϵϬϬϬϬ Ψ ϮϮϵ͘ϵϯ ^ŵĂůůdŽŽůƐ͕WůƵŵďŝŶŐΘƵŝůĚŝŶŐ ϭϭϵϰϮϳ Ϭϱϱ͘ϬϬϬϮϵϬϯϬϱϱ͘ϴϰϬϬ͘ϱϵϬϬϬϬ Ψ ϭϵϳ͘Ϭϴ ^ŵĂůůdŽŽůƐ͕WůƵŵďŝŶŐΘƵŝůĚŝŶŐ ϭϭϵϰϱϯ Ϭϱϱ͘ϬϬϬϮϵϬϯϬϱϱ͘ϴϰϬϬ͘ϱϵϬϬϬϬ Ψ ϳϴ͘ϳϱ ^ŵĂůůdŽŽůƐ͕WůƵŵďŝŶŐΘƵŝůĚŝŶŐ ϭϭϵϱϲϰ Ϭϱϱ͘ϬϬϬϮϵϬϯϬϮϬ͘ϭϬϴϰ͘ϱϮϬϬϬϬ Ψ ϭϯϭ͘ϲϱ ^ŵĂůůdŽŽůƐ͕WůƵŵďŝŶŐΘƵŝůĚŝŶŐ ϭϮϮϮϮϭ Ϭϭϭ͘ϬϬϭϰϴϵϭΨ ϱ͕Ϭϲϴ͘ϲϯϬϯͬϭϲͬϮϬϮϮ ϭϮϲϭϯϬϮϬ͘ϭϬϴϰ͘ϵϬϬϬϬϬ Ψ ϯ͕ϳϮϬ͘ϳϴ ^ƚĞĞů^ŚĞĞƚƐΘ&ĂďƌŝĐĂƟŽŶ ϭϬϮϵϬ>EKZΖ^h^dKD&Z/d/KEϬϬϱϬϬϰͲΨ ϯ͕ϳϮϬ͘ϳϴϬϯͬϭϲͬϮϬϮϮ ϭϮϲϭϰϬϱϱ͘ϴϰϬϬ͘ϱϵϬϬϬϬ Ψ ϯϰϱ͘ϭϮ ,ĂƌĚǁĂƌĞ^ƵƉƉůŝĞƐΕ ϲϵϲϯϬϲϴϯ Ϭϱϱ͘ϬϬϬϮϴϵϳDD^dZͲZZ^hWW>zKDWEzϬϬϭϭϱϬͲϬϱϱ͘ϴϰϬϬ͘ϱϵϬϬϬϬ Ψ ϱϯϲ͘ϱϵ ,ĂƌĚǁĂƌĞ^ƵƉƉůŝĞƐΕ ϳϮϮϵϱϭϰϵ Ϭϱϱ͘ϬϬϬϮϴϵϳϬϱϱ͘ϴϰϬϬ͘ϱϵϬϬϬϬ Ψ ϲϬϲ͘ϱϴ ,ĂƌĚǁĂƌĞ^ƵƉƉůŝĞƐΕ ϳϮϱϬϮϵϵϬ Ϭϱϱ͘ϬϬϬϮϴϵϳΨ ϭ͕ϰϴϴ͘ϮϵϬϯͬϭϲͬϮϬϮϮ ϭϮϲϭϱWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϭϱŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮ>dZKE/sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEdWzDEdEhDZWzDEddϬϭϭ͘ϵϬϭϵ͘ϱϵϬϭϭϬ Ψ Ϯ͕ϯϰϲ͘ϰϬ sD^ŽŌǁĂƌĞΕ ϭϰϱϱϱϮϳϱ Ϭϭϭ͘ϬϬϭϱϭϭϭ^,//EdZEd/KE>KZWϬϬϱϵϮϱͲϬϭϭ͘ϵϬϭϵ͘ϱϵϬϭϭϬ Ψ ϲ͕ϳϲϲ͘ϬϬ sDǀĂŝůĂďŝůŝƚǇ^ƵŝƚĞΕ ϭϰϱϱϱϮϳϱ Ϭϭϭ͘ϬϬϭϱϭϭϭϬϭϭ͘ϵϬϭϵ͘ϱϵϬϭϭϬ Ψ ϯϯϱ͘ϮϬ sDh&ŽƌD^KĸĐĞϯϲϱΕ ϭϰϱϱϱϮϳϱ Ϭϭϭ͘ϬϬϭϱϭϭϭϬϭϭ͘ϵϬϭϵ͘ϱϵϬϭϭϬ Ψ ϰ͕ϯϬϵ͘ϱϮ ŶŶƵĂůĂƐŝĐDŝŶƚZĞŶĞǁĂůΕ ϭϰϱϱϱϮϳϱ Ϭϭϭ͘ϬϬϭϱϭϭϭϬϭϭ͘ϵϬϭϵ͘ϱϵϬϭϭϬ Ψ ϯϱϵ͘Ϭϰ DŽŶƚŚůǇĂƐŝĐDŽŶŝƚŽƌZĞŶĞǁĂůΕ ϭϰϱϱϱϮϳϱ Ϭϭϭ͘ϬϬϭϱϭϭϭϬϭϭ͘ϵϬϭϵ͘ϱϮϬϬϭϬ Ψ ϭϭ͕ϴϰϵ͘Ϯϴ DĞƌĂŬŝD^ϭϮϱͲϰϴ&WϭϬ'>ϮůĚͲDŶŐĚϰϴǆ ϭϰϱϲϲϵϲϵ Ϭϭϭ͘ϬϬϭϱϬϰϳϬϭϭ͘ϵϬϭϵ͘ϱϮϬϬϭϬ Ψ ϲϯϱ͘ϱϴ DĞƌĂŬŝD^ϭϮϱͲϰϴ&WŶƚĞƌƉƌŝƐĞ>ŝĐĞŶƐĞ ϭϰϱϲϲϵϲϵ Ϭϭϭ͘ϬϬϭϱϬϰϳϬϭϭ͘ϵϬϭϵ͘ϱϮϬϬϭϬ Ψ ϭ͕Ϯϭϰ͘ϱϱ ^ĂůĞƐdĂǆϭϬ͘Ϯϱ ϭϰϱϲϲϵϲϵΨ Ϯϳ͕ϴϭϱ͘ϱϳϬϯͬϭϲͬϮϬϮϮ ϭϮϲϭϲϬϭϭ͘ϵϬϭϵ͘ϴϲϬϬϬϬ Ψ ϭ͕ϰϬϬ͘ϬϬ ZW^ǇƐƚĞŵ;DƵŶŝƐͿhƉŐƌĂĚĞ ϬϰϱϯϲϭϲϴϮdz>Zd,EK>K'/^͕/EϬϬϭϰϰϳͲϬϭϭ͘ϵϬϭϵ͘ϴϲϬϬϬϬ Ψ ϰ͕ϵϬϬ͘ϬϬ ZW^ǇƐƚĞŵ;DƵŶŝƐͿhƉŐƌĂĚĞ ϬϰϱϯϲϯϯϳϬϬϭϭ͘ϵϬϭϵ͘ϴϲϬϬϬϬ Ψ ϭ͕ϰϬϬ͘ϬϬ ZW^ǇƐƚĞŵ;DƵŶŝƐͿhƉŐƌĂĚĞ ϬϰϱϯϲϱϱϭϲϬϭϭ͘ϵϬϭϵ͘ϴϲϬϬϬϬ Ψ Ϯ͕ϴϬϬ͘ϬϬ ZW^ǇƐƚĞŵ;DƵŶŝƐͿhƉŐƌĂĚĞ ϬϰϱϯϲϲϯϲϲΨ ϭϬ͕ϱϬϬ͘ϬϬϬϯͬϭϲͬϮϬϮϮ ϭϮϲϭϳWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϭϲŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮ>dZKE/sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEdWzDEdEhDZWzDEddϬϮϬ͘ϭϬϴϰ͘ϱϬϬϭϰϬ Ψ ϳϭϬ͘Ϭϭ ^ŽĚŝƵŵ,ǇƉŽĐŚůŽƌŝƚĞ^ŽůƵƟŽŶ ϱϱϲϰϲϴϬtdZ>/Ed,EK>K'/^͕/EϬϬϳϭϭϬͲϬϮϬ͘ϭϬϴϰ͘ϱϬϬϭϰϬ Ψ ϯϱϱ͘Ϭϭ ^ŽĚŝƵŵ,ǇƉŽĐŚůŽƌŝƚĞ^ŽůƵƟŽŶ ϱϱϲϱϭϭϭϬϮϬ͘ϭϬϴϰ͘ϱϬϬϭϰϬ Ψ ϮϮϵ͘ϲϳ ^ŽĚŝƵŵ,ǇƉŽĐŚůŽƌŝƚĞ^ŽůƵƟŽŶ ϱϱϲϱϭϵϰϬϮϬ͘ϭϬϴϰ͘ϱϬϬϭϰϬ Ψ ϭϰϴ͘ϭϴ ^ŽĚŝƵŵ,ǇƉŽĐŚůŽƌŝƚĞ^ŽůƵƟŽŶ ϱϱϲϱϭϵϱϬϮϬ͘ϭϬϴϰ͘ϱϬϬϭϰϬ Ψ ϭϯϴ͘ϵϮ ^ŽĚŝƵŵ,ǇƉŽĐŚůŽƌŝƚĞ^ŽůƵƟŽŶ ϱϱϲϱϭϵϲϬϮϬ͘ϭϬϴϰ͘ϱϬϬϭϰϬ Ψ ϭϵϲ͘ϯϯ ^ŽĚŝƵŵ,ǇƉŽĐŚůŽƌŝƚĞ^ŽůƵƟŽŶ ϱϱϲϱϮϬϭϬϮϬ͘ϭϬϴϰ͘ϱϬϬϭϰϬ Ψ Ϯϱϵ͘ϯϭ ^ŽĚŝƵŵ,ǇƉŽĐŚůŽƌŝƚĞ^ŽůƵƟŽŶ ϱϱϲϱϮϬϮϬϮϬ͘ϭϬϴϰ͘ϱϬϬϭϰϬ Ψ Ϯϲϲ͘ϳϮ ^ŽĚŝƵŵ,ǇƉŽĐŚůŽƌŝƚĞ^ŽůƵƟŽŶ ϱϱϲϱϮϬϱϬϮϬ͘ϭϬϴϰ͘ϱϬϬϭϰϬ Ψ ϭ͕Ϭϲϱ͘ϬϮ ^ŽĚŝƵŵ,ǇƉŽĐŚůŽƌŝƚĞ^ŽůƵƟŽŶ ϱϱϲϱϴϳϯϬϮϬ͘ϭϬϴϰ͘ϱϬϬϭϰϬ Ψ ϮϮϮ͘Ϯϲ ^ŽĚŝƵŵ,ǇƉŽĐŚůŽƌŝƚĞ^ŽůƵƟŽŶ ϱϱϲϲϱϱϯϬϮϬ͘ϭϬϴϰ͘ϱϬϬϭϰϬ Ψ ϭϴϱ͘ϮϮ ^ŽĚŝƵŵ,ǇƉŽĐŚůŽƌŝƚĞ^ŽůƵƟŽŶ ϱϱϲϲϱϱϱϬϮϬ͘ϭϬϴϰ͘ϱϬϬϭϰϬ Ψ ϮϮϮ͘Ϯϲ ^ŽĚŝƵŵ,ǇƉŽĐŚůŽƌŝƚĞ^ŽůƵƟŽŶ ϱϱϲϲϱϱϲϬϮϬ͘ϭϬϴϰ͘ϱϬϬϭϰϬ Ψ ϮϰϬ͘ϳϵ ^ŽĚŝƵŵ,ǇƉŽĐŚůŽƌŝƚĞ^ŽůƵƟŽŶ ϱϱϲϲϱϱϳϬϮϬ͘ϭϬϴϰ͘ϱϬϬϭϰϬ Ψ ϮϰϬ͘ϳϵ ^ŽĚŝƵŵ,ǇƉŽĐŚůŽƌŝƚĞ^ŽůƵƟŽŶ ϱϱϲϲϱϱϴϬϮϬ͘ϭϬϴϰ͘ϱϬϬϭϰϬ Ψ Ϯϴϳ͘Ϭϵ ^ŽĚŝƵŵ,ǇƉŽĐŚůŽƌŝƚĞ^ŽůƵƟŽŶ ϱϱϲϲϱϱϵΨ ϰ͕ϳϲϳ͘ϱϴϬϯͬϭϲͬϮϬϮϮ ϭϮϲϭϴϬϱϲ͘ϱϲϬϬ͘ϱϮϬϬϬϬ Ψ ϳϮϲ͘ϵϳ ^ĞƌǀŝĐĞŽŶŶĞĐƟŽŶDĂƚĞƌŝĂůƐΕ /EϭϱϯϮϴ Ϭϱϲ͘ϬϬϬϬϲϯϱͲ^d/Eh^dZ/>͕/EϬϬϰϯϭϴͲΨ ϳϮϲ͘ϵϳϬϯͬϭϳͬϮϬϮϮ ϭϮϲϭϵϬϭϭ͘ϭϬϳϬ͘ϱϵϲϮϬϬ Ψ Ϯ͕ϮϵϮ͘ϯϬ ^ĐŚŽŽůƌŽƐƐŝŶŐ'ƵĂƌĚ^ĞƌǀŝĐĞƐ ϳϱϲϮϲ>>/dzDE'DEd^Zs/^ϬϬϭϰϵϬͲΨ Ϯ͕ϮϵϮ͘ϯϬϬϯͬϭϳͬϮϬϮϮ ϭϮϲϮϬWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϭϳŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮ>dZKE/sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEdWzDEdEhDZWzDEddϬϭϭ͘ϭϬϮϰ͘ϱϵϯϮϬϬ Ψ ϭ͕ϱϮϭ͘ϬϬ ZĞ͗ϱϭϮϮ^͘ƚůĂŶƟĐŽƵůĞǀĂƌĚ ϵϮϵϲϭϲ^d^dΘ<Z/'Z͕>>WϬϬϱϱϬϲͲΨ ϭ͕ϱϮϭ͘ϬϬϬϯͬϭϳͬϮϬϮϮ ϭϮϲϮϭϬϭϭ͘ϭϬϰϯ͘ϱϰϬϬϬϬ Ψ ϮϮϱ͘ϰϯ hŶŝĨŽƌŵƐ ϰϭϭϯϬϴϮϰϵϬ/Ed^KZWKZd/KEϬϬϱϰϵϬͲΨ ϮϮϱ͘ϰϯϬϯͬϭϳͬϮϬϮϮ ϭϮϲϮϮϬϱϱ͘ϴϬϬϬ͘ϱϵϬϬϬϬ Ψ ϯ͕ϯϵϲ͘ϭϲ ,ĂǌĂƌĚŽƵƐtĂƐƚĞŝƐƉŽƐĂů^ĞƌǀŝĐĞƐ ϭϬϬϯϵϴϴϭϲϵ>E,ZKZ^Es/ZKEDEd>^ϬϬϱϬϯϭͲΨ ϯ͕ϯϵϲ͘ϭϲϬϯͬϭϲͬϮϬϮϮ ϭϮϲϮϯϬϭϭ͘ϭϬϰϵ͘ϱϵϬϬϬϬ Ψ ϲϱϬ͘ϬϬ h^dŽŵƉůŝĂŶĐĞ^ĞƌǀŝĐĞƐ ϭϴϯϲϵ&>D/E'Es/ZKEDEd>͕/EϬϬϰϰϯϴͲϬϭϭ͘ϭϬϰϵ͘ϱϵϬϬϬϬ Ψ Ϯ͕ϬϮϴ͘ϰϵ h^dŽŵƉůŝĂŶĐĞ^ĞƌǀŝĐĞƐ ϭϴϯϴϱΨ Ϯ͕ϲϳϴ͘ϰϵϬϯͬϭϳͬϮϬϮϮ ϭϮϲϮϰϬϭϭ͘ϭϬϰϴ͘ϱϵϲϮϬϬ Ψ ϭϬϬ͘ϬϬ ƩĞŶĚĂŶĐĞ^ƟƉĞŶĚΕ ϬϯϭϬϮϮ^dsE&ZKZ'ϬϬϱϭϱϱͲΨ ϭϬϬ͘ϬϬϬϯͬϭϳͬϮϬϮϮ ϭϮϲϮϱϬϮϬ͘ϭϬϴϰ͘ϵϬϬϬϬϬ Ψ ϲ͕ϵϯϰ͘ϬϬ tĞůůΘŽŽƐƚĞƌWƵŵƉDĂŝŶƚĞŶĂŶĐĞ ϮϵϮϯϵ'EZ>WhDWKDWEz͕/EϬϬϬϭϰϳͲΨ ϲ͕ϵϯϰ͘ϬϬϬϯͬϭϳͬϮϬϮϮ ϭϮϲϮϲWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϭϴŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮ>dZKE/sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEdWzDEdEhDZWzDEddϬϱϲ͘ϱϲϬϬ͘ϱϵϬϬϬϬ Ψ ϴϵϵ͘ϬϬ /ŶǀĞŶƚŽƌǇΕ ϮϮϲϯϬϮ Ϭϱϲ͘ϬϬϬϬϲϱϲD^hZDEdKEdZK>^z^dD^͕/ϬϬϬϴϯϵͲϬϱϲ͘ϱϲϬϬ͘ϱϵϬϬϬϬ Ψ ϴϵ͘ϰϬ &ƌĞŝŐŚƚ ϮϮϲϯϬϮϬϱϲ͘ϱϲϬϬ͘ϱϵϬϬϬϬ Ψ ϵϮ͘ϭϱ ^ĂůĞƐdĂǆϭϬ͘Ϯϱ ϮϮϲϯϬϮϬϱϲ͘ϱϲϬϬ͘ϱϵϬϬϬϬ Ψ ϴϵϵ͘ϬϬ /ŶǀĞŶƚŽƌǇΕ ϮϮϳϬϬϲ Ϭϱϲ͘ϬϬϬϬϲϱϲϬϱϲ͘ϱϲϬϬ͘ϱϵϬϬϬϬ Ψ ϵϱ͘ϴϬ &ƌĞŝŐŚƚ ϮϮϳϬϬϲϬϱϲ͘ϱϲϬϬ͘ϱϵϬϬϬϬ Ψ ϵϮ͘ϭϱ ^ĂůĞƐdĂǆϭϬ͘Ϯϱ ϮϮϳϬϬϲΨ Ϯ͕ϭϲϳ͘ϱϬϬϯͬϭϳͬϮϬϮϮ ϭϮϲϮϳϬϱϲ͘ϱϲϬϬ͘ϱϮϬϬϬϬ Ψ Ͳϯ͕ϱϱϬ͘ϬϬ WĞƌŵĂͲWĂƚĐŚƐƉŚĂůƚ WDϮϬϬϬϱϴϯϱdZE,^,KZ/E'KDWEzϬϬϭϴϰϳͲϬϱϲ͘ϱϲϬϬ͘ϱϮϬϬϬϬ Ψ ϯ͕ϱϱϬ͘ϬϬ WĞƌŵĂͲWĂƚĐŚƐƉŚĂůƚ Z/ϮϬϭϰϰϬϭϮϬϱϲ͘ϱϲϬϬ͘ϱϮϬϬϬϬ Ψ ϯ͕ϰϬϬ͘ϬϬ WĞƌŵĂͲWĂƚĐŚƐƉŚĂůƚΕ Z/ϮϬϭϱϭϮϳϭ Ϭϱϲ͘ϬϬϬϬϲϱϱϬϱϲ͘ϱϲϬϬ͘ϱϮϬϬϬϬ Ψ ϭϱϬ͘ϬϬ &ƌĞŝŐŚƚ Z/ϮϬϭϱϭϮϳϭ Ϭϱϲ͘ϬϬϬϬϲϱϱϬϱϲ͘ϱϲϬϬ͘ϱϮϬϬϬϬ Ψ ϯϰϴ͘ϱϬ ^ĂůĞƐdĂǆϭϬ͘Ϯϱ Z/ϮϬϭϱϭϮϳϭΨ ϯ͕ϴϵϴ͘ϱϬϬϯͬϭϳͬϮϬϮϮ ϭϮϲϮϴϬϮϬ͘ϭϬϴϰ͘ϱϮϬϬϬϬ Ψ ϯϳϯ͘ϯϱ WĂǀŝŶŐDĂƚĞƌŝĂůƐΕ ϳϯϮϬϯϯϱϭ Ϭϭϭ͘ϬϬϭϰϵϭϮsh>EDdZ/>^KϬϬϭϲϵϱͲΨ ϯϳϯ͘ϯϱϬϯͬϭϳͬϮϬϮϮ ϭϮϲϮϵWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϭϵŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮ>dZKE/sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEdWzDEdEhDZWzDEddϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϱϬ Ψ ϭϲϰ͕ϴϳϴ͘ϳϴ /ŶŝƟĂůŚĂƌŐĞƐϬϯͬϮϮ ϮϬϮϮϬϯϭϱϯϭϱϰϬϰϰϬϭϮ>/&KZE//^KϬϬϮϰϭϮͲϬϱϱ͘ϵϮϬϬ͘ϱϬϬϮϭϬ Ψ ϲ͕ϲϭϴ͘Ϯϳ /ŶŝƟĂůŚĂƌŐĞƐϬϯͬϮϮ ϮϬϮϮϬϯϭϱϯϭϱϰϬϰϰϬϭϮϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϳϬ Ψ Ͳϭ͕ϭϳϬ͘ϴϭ /ŶŝƟĂůŚĂƌŐĞƐϬϯͬϮϮ ϮϬϮϮϬϯϭϱϯϭϱϰϬϰϰϬϭϮϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϵϬ Ψ Ͳϯ͕ϭϳϲ͘ϴϲ /ŶŝƟĂůŚĂƌŐĞƐϬϯͬϮϮ ϮϬϮϮϬϯϭϱϯϭϱϰϬϰϰϬϭϮϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϱϬ Ψ ͲϴϮ͘ϲϯ ZĞĐĂůĐƵůĂƟŽŶŚĂƌŐĞƐϬϴͬϮϬ ϮϬϮϮϬϯϭϱϯϭϱϰϬϰϰϬϭϮϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϳϬ Ψ Ͳϳϴϯ͘ϴϱ ZĞĐĂůĐƵůĂƟŽŶŚĂƌŐĞƐϬϴͬϮϬ ϮϬϮϮϬϯϭϱϯϭϱϰϬϰϰϬϭϮϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϴϬ Ψ Ͳϲ͘ϴϵ ZĞĐĂůĐƵůĂƟŽŶŚĂƌŐĞƐϬϴͬϮϬ ϮϬϮϮϬϯϭϱϯϭϱϰϬϰϰϬϭϮϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϵϬ Ψ Ͳϱϯ͘ϱϰ ZĞĐĂůĐƵůĂƟŽŶŚĂƌŐĞƐϬϴͬϮϬ ϮϬϮϮϬϯϭϱϯϭϱϰϬϰϰϬϭϮϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϱϬ Ψ Ͳϭϭ͕Ϯϵϭ͘ϵϬ ZĞĐĂůĐƵůĂƟŽŶŚĂƌŐĞƐϭϮͬϮϭ ϮϬϮϮϬϯϭϱϯϭϱϰϬϰϰϬϭϮϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϵϬ Ψ ͲϮϮϰ͘Ϯϯ ZĞĐĂůĐƵůĂƟŽŶŚĂƌŐĞƐϭϮͬϮϭ ϮϬϮϮϬϯϭϱϯϭϱϰϬϰϰϬϭϮϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϳϬ Ψ ϰ͕ϲϱϮ͘ϬϬ ZĞĐĂůĐƵůĂƟŽŶŚĂƌŐĞƐϭϮͬϮϭ ϮϬϮϮϬϯϭϱϯϭϱϰϬϰϰϬϭϮϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϱϬ Ψ ϭϱϲ͕ϳϬϱ͘ϴϱ /ŶŝƟĂůŚĂƌŐĞƐϬϮͬϮϮ ϮϬϮϮϬϯϭϱϯϭϱϰϬϰϰϬϭϮϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϳϬ Ψ ϭ͕ϱϬϴ͕Ϯϵϴ͘ϭϬ /ŶŝƟĂůŚĂƌŐĞƐϬϮͬϮϮ ϮϬϮϮϬϯϭϱϯϭϱϰϬϰϰϬϭϮϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϵϬ Ψ ϰϬϱ͘ϴϴ /ŶŝƟĂůŚĂƌŐĞƐϬϮͬϮϮ ϮϬϮϮϬϯϭϱϯϭϱϰϬϰϰϬϭϮWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϮϬŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮ>dZKE/sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEdWzDEdEhDZWzDEddϬϱϱ͘ϵϮϬϬ͘ϱϬϬϮϭϬ Ψ ϵ͕ϳϵϰ͘ϬϮ /ŶŝƟĂůŚĂƌŐĞƐϬϮͬϮϮ ϮϬϮϮϬϯϭϱϯϭϱϰϬϰϰϬϭϮ>/&KZE//^KϬϬϮϰϭϮͲϬϱϱ͘ϵϮϬϬ͘ϱϬϬϮϰϬ Ψ ϴ͕Ϯϯϳ͘ϳϭ /ŶŝƟĂůŚĂƌŐĞƐϬϮͬϮϮ ϮϬϮϮϬϯϭϱϯϭϱϰϬϰϰϬϭϮϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϴϬ Ψ Ͳϭ͕ϯϴϬ͘ϭϳ /ŶŝƟĂůŚĂƌŐĞƐϬϮͬϮϮ ϮϬϮϮϬϯϭϱϯϭϱϰϬϰϰϬϭϮϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϱϬ Ψ ϱ͕Ϭϰϯ͘ϴϵ ZĞĐĂůĐƵůĂƟŽŶŚĂƌŐĞƐϭϭͬϮϭ ϮϬϮϮϬϯϭϱϯϭϱϰϬϰϰϬϭϮϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϳϬ Ψ ϭ͕Ϯϴϳ͘ϴϰ ZĞĐĂůĐƵůĂƟŽŶŚĂƌŐĞƐϭϭͬϮϭ ϮϬϮϮϬϯϭϱϯϭϱϰϬϰϰϬϭϮϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϵϬ Ψ Ͳϳϳ͘ϭϰ ZĞĐĂůĐƵůĂƟŽŶŚĂƌŐĞƐϭϭͬϮϭ ϮϬϮϮϬϯϭϱϯϭϱϰϬϰϰϬϭϮΨ ϭ͕ϴϰϳ͕ϲϳϰ͘ϯϮϬϯͬϭϴͬϮϬϮϮ ϭϮϲϯϬϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϱϰ Ψ ϮϱϬ͕ϬϬϬ͘ϬϬ ŶĞƌŐǇWƵƌĐŚĂƐĞϬϮͬϮϮ ϱϭϭϳϮϲϲϴWKtZyKZWϬϬϮϱϭϱͲΨ ϮϱϬ͕ϬϬϬ͘ϬϬϬϯͬϭϴͬϮϬϮϮ ϭϮϲϯϭϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϱϰ Ψ Ϯϳϯ͕Ϭϳϱ͘ϲϱ ƐƚŽƌŝĂϮ^ŽůĂƌWƌŽũĞĐƚ d^WϬϯϮϮ^K>Wh>/WKtZhd,KZ/dzϬϬϮϱϭϳͲΨ Ϯϳϯ͕Ϭϳϱ͘ϲϱϬϯͬϭϴͬϮϬϮϮ ϭϮϲϯϮϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϱϰ Ψ ϭϵϮ͕ϳϲϰ͘ϯϲ ŶƚĞůŽƉĞ^Zϭ^ŽůĂƌWƌŽũĞĐƚ ^ZϭϬϯϮϮ^K>Wh>/WKtZhd,KZ/dzϬϬϮϱϭϳͲΨ ϭϵϮ͕ϳϲϰ͘ϯϲϬϯͬϭϴͬϮϬϮϮ ϭϮϲϯϯϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϴϬ Ψ ϯϬ͕Ϭϲϱ͘ϵϰ ŽƵůĚĞƌĂŶǇŽŶWƌŽũĞĐƚŚĂƌŐĞƐϬϮͬϮϮ ''ϭϳϲϲtϬϮϮϮh^WZdDEdK&EZ'zϬϬϮϮϮϳͲϬϱϱ͘ϵϮϬϬ͘ϱϬϬϭϱϬ Ψ ϭϳ͕ϯϲϯ͘ϵϰ ŽƵůĚĞƌĂŶǇŽŶWƌŽũĞĐƚŚĂƌŐĞƐϬϮͬϮϮ ''ϭϳϲϲtϬϮϮϮΨ ϰϳ͕ϰϮϵ͘ϴϴϬϯͬϭϴͬϮϬϮϮ ϭϮϲϯϰWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϮϭŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮ>dZKE/sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEdWzDEdEhDZWzDEddϬϮϬ͘ϭϬϴϰ͘ϱϬϬϭϭϬ Ψ ϭϵϯ͕ϰϬϮ͘ϳϴ 'ƌŽƵŶĚǁĂƚĞƌWƌŽĚƵĐƟŽŶΘƐƐĞƐƐŵĞŶƚ ϬϰϭϭϮϮtdZZW>E/^,DEd/^dZ/dϬϬϭϲϱϴͲΨ ϭϵϯ͕ϰϬϮ͘ϳϴϬϯͬϭϴͬϮϬϮϮ ϭϮϲϯϱϬϮϬ͘ϭϬϴϰ͘ϱϬϬϭϰϬ Ψ ϵϲϱ͘ϬϮ ^ŽĚŝƵŵ,ǇƉŽĐŚůŽƌŝƚĞ^ŽůƵƟŽŶ ϱϱϲϳϰϭϭtdZ>/Ed,EK>K'/^͕/EϬϬϳϭϭϬͲϬϮϬ͘ϭϬϴϰ͘ϱϬϬϭϰϬ Ψ Ϯϯϭ͘ϱϯ ^ŽĚŝƵŵ,ǇƉŽĐŚůŽƌŝƚĞ^ŽůƵƟŽŶ ϱϱϲϳϵϬϲϬϮϬ͘ϭϬϴϰ͘ϱϬϬϭϰϬ Ψ Ϯϴϳ͘Ϭϵ ^ŽĚŝƵŵ,ǇƉŽĐŚůŽƌŝƚĞ^ŽůƵƟŽŶ ϱϱϲϳϵϬϴϬϮϬ͘ϭϬϴϰ͘ϱϬϬϭϰϬ Ψ ϮϱϬ͘Ϭϱ ^ŽĚŝƵŵ,ǇƉŽĐŚůŽƌŝƚĞ^ŽůƵƟŽŶ ϱϱϲϳϵϬϵϬϮϬ͘ϭϬϴϰ͘ϱϬϬϭϰϬ Ψ ϭϴϱ͘ϮϮ ^ŽĚŝƵŵ,ǇƉŽĐŚůŽƌŝƚĞ^ŽůƵƟŽŶ ϱϱϲϳϵϭϬϬϮϬ͘ϭϬϴϰ͘ϱϬϬϭϰϬ Ψ ϭϴϱ͘ϮϮ ^ŽĚŝƵŵ,ǇƉŽĐŚůŽƌŝƚĞ^ŽůƵƟŽŶ ϱϱϲϳϵϭϭϬϮϬ͘ϭϬϴϰ͘ϱϬϬϭϰϬ Ψ Ϯϳϳ͘ϴϯ ^ŽĚŝƵŵ,ǇƉŽĐŚůŽƌŝƚĞ^ŽůƵƟŽŶ ϱϱϲϳϵϭϮϬϮϬ͘ϭϬϴϰ͘ϱϬϬϭϰϬ Ψ ϭ͕ϭϭϱ͘ϬϮ ^ŽĚŝƵŵ,ǇƉŽĐŚůŽƌŝƚĞ^ŽůƵƟŽŶ ϱϱϲϴϳϰϯΨ ϯ͕ϰϵϲ͘ϵϴϬϯͬϭϴͬϮϬϮϮ ϭϮϲϯϲWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϮϮŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮ>dZKE/sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEdWzDEdEhDZWzDEddϬϱϱ͘ϵϬϬϬ͘ϱϲϬϬϭϬ Ψ ϭ͕ϵϵϲ͘ϵϬ WĞƌŝŽĚ͗ϭϮͬϬϴͬϮϭͲϬϭͬϬϳͬϮϮ ϬϭϬϳϮϮͺDh>d/W>sZ/KEt/Z>^^ϬϬϭϰϴϭͲϬϱϱ͘ϴϬϬϬ͘ϱϲϬϬϭϬ Ψ ϭ͕ϲϲϮ͘ϰϵ WĞƌŝŽĚ͗ϭϮͬϬϴͬϮϭͲϬϭͬϬϳͬϮϮ ϬϭϬϳϮϮͺDh>d/W>Ϭϱϱ͘ϴϮϬϬ͘ϱϲϬϬϭϬ Ψ ϭ͕Ϯϯϰ͘ϳϲ WĞƌŝŽĚ͗ϭϮͬϬϴͬϮϭͲϬϭͬϬϳͬϮϮ ϬϭϬϳϮϮͺDh>d/W>Ϭϱϲ͘ϱϲϬϬ͘ϱϲϬϬϭϬ Ψ Ϯϲϯ͘Ϯϱ WĞƌŝŽĚ͗ϭϮͬϬϴͬϮϭͲϬϭͬϬϳͬϮϮ ϬϭϬϳϮϮͺDh>d/W>Ϭϱϱ͘ϵϬϬϬ͘ϱϲϬϬϭϬ Ψ ϭ͕ϱϵϮ͘ϵϰ WĞƌŝŽĚ͗ϭϬͬϬϴͬϮϭͲϭϭͬϬϳͬϮϭ ϭϭϬϳϮϭͺDh>d/W>;ϮͿϬϱϱ͘ϴϬϬϬ͘ϱϲϬϬϭϬ Ψ ϭ͕ϰϲϰ͘Ϭϲ WĞƌŝŽĚ͗ϭϬͬϬϴͬϮϭͲϭϭͬϬϳͬϮϭ ϭϭϬϳϮϭͺDh>d/W>;ϮͿϬϱϱ͘ϴϮϬϬ͘ϱϲϬϬϭϬ Ψ Ϯ͕ϭϯϳ͘ϯϵ WĞƌŝŽĚ͗ϭϬͬϬϴͬϮϭͲϭϭͬϬϳͬϮϭ ϭϭϬϳϮϭͺDh>d/W>;ϮͿϬϱϲ͘ϱϲϬϬ͘ϱϲϬϬϭϬ Ψ ϮϲϮ͘ϴϯ WĞƌŝŽĚ͗ϭϬͬϬϴͬϮϭͲϭϭͬϬϳͬϮϭ ϭϭϬϳϮϭͺDh>d/W>;ϮͿϬϱϱ͘ϵϬϬϬ͘ϱϲϬϬϭϬ Ψ ϭ͕ϱϰϳ͘ϯϳ WĞƌŝŽĚ͗ϭϭͬϬϴͬϮϭͲϭϮͬϬϳͬϮϭ ϭϮϬϳϮϭͺDh>d/W>;ϮͿϬϱϱ͘ϴϬϬϬ͘ϱϲϬϬϭϬ Ψ Ϯ͕ϳϵϭ͘ϱϳ WĞƌŝŽĚ͗ϭϭͬϬϴͬϮϭͲϭϮͬϬϳͬϮϭ ϭϮϬϳϮϭͺDh>d/W>;ϮͿϬϱϱ͘ϴϮϬϬ͘ϱϲϬϬϭϬ Ψ ϭ͕ϴϭϳ͘ϴϴ WĞƌŝŽĚ͗ϭϭͬϬϴͬϮϭͲϭϮͬϬϳͬϮϭ ϭϮϬϳϮϭͺDh>d/W>;ϮͿϬϱϲ͘ϱϲϬϬ͘ϱϲϬϬϭϬ Ψ Ϯϱϴ͘ϱϬ WĞƌŝŽĚ͗ϭϭͬϬϴͬϮϭͲϭϮͬϬϳͬϮϭ ϭϮϬϳϮϭͺDh>d/W>;ϮͿΨ ϭϳ͕ϬϮϵ͘ϵϰϬϯͬϭϳͬϮϬϮϮ ϭϮϲϯϳWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϮϯŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮ>dZKE/sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEdWzDEdEhDZWzDEddϬϭϭ͘ϭϬϮϲ͘ϱϵϲϵϬϬ Ψ ϭϮϯ͘ϯϭ ŵƉůŽǇĞĞKƵƚƌĞĂĐŚǀĞŶƚ ϬϵϮϮϮϭh^E<KZWKZdϬϬϱϱϵϰͲϬϭϭ͘ϭϬϮϲ͘ϱϵϲϵϬϱ Ψ ϲϰ͘ϱϭ DĞĂůƐͬ/ŶƚĞƌǀŝĞǁWĂŶĞů ϬϵϮϮϮϭϬϭϭ͘ϭϬϮϲ͘ϱϵϲϵϬϬ Ψ ϴϮ͘ϱϰ DĞĂůƐͬE&><ŝĐŬŽī>ƵŶĐŚĞŽŶ ϬϵϮϮϮϭϬϭϭ͘ϭϬϰϵ͘ϱϮϬϬϬϬ Ψ ϭ͕ϰϲϳ͘ϰϯ ^ƵƉƉůŝĞƐ ϬϵϮϮϮϭ;ϭϬͿϬϭϭ͘ϵϬϭϵ͘ϱϮϬϬϭϬ Ψ ϮϬϱ͘ϵϬ ĚŽďĞ>ŝĐĞŶƐĞ ϬϵϮϮϮϭ;ϭϭͿϬϭϭ͘ϵϬϭϵ͘ϱϵϬϭϭϬ Ψ ϭ͕ϰϮϰ͘ϱϬ 'ŽŽŐůĞ^ƵŝƚĞĨŽƌWt ϬϵϮϮϮϭ;ϭϭͿϬϭϭ͘ϵϬϭϵ͘ϱϮϬϬϭϬ Ψ ϰϲϲ͘ϳϱ 'ŽdŽƐƐŝƐƚ>ŝĐĞŶƐĞ ϬϵϮϮϮϭ;ϭϭͿϬϭϭ͘ϵϬϭϵ͘ϱϵϬϭϭϬ Ψ ϭϰ͘ϬϬ 'ŽdŽDĞĞƟŶŐ>ŝĐĞŶƐĞ ϬϵϮϮϮϭ;ϭϭͿϬϭϭ͘ϵϬϭϵ͘ϱϮϬϬϭϬ Ψ ϱϬϳ͘ϬϬ ,ĞůƉĚĞƐŬ^ƵƉƉŽƌƚ^ŽŌǁĂƌĞ ϬϵϮϮϮϭ;ϭϭͿϬϭϭ͘ϵϬϭϵ͘ϱϮϬϬϭϬ Ψ Ϯϳϱ͘ϱϴ ,ĞůƉĚĞƐŬ^ƵƉƉŽƌƚ^ŽŌǁĂƌĞ ϬϵϮϮϮϭ;ϭϭͿϬϭϭ͘ϵϬϭϵ͘ϱϮϬϬϭϬ Ψ ϳϲϳ͘ϭϲ /d^ƵƉƉůŝĞƐ ϬϵϮϮϮϭ;ϭϭͿϬϭϭ͘ϵϬϭϵ͘ϱϵϬϭϭϬ Ψ ϰϬ͘ϬϬ DŝĐƌŽƐŽŌƉƉ^ĞƌǀŝĐĞƐ ϬϵϮϮϮϭ;ϭϭͿϬϭϭ͘ϵϬϭϵ͘ϱϵϬϭϭϬ Ψ ϯϲ͘ϬϬ DŝĐƌŽƐŽŌƵƐŝŶĞƐƐĂƐŝĐ ϬϵϮϮϮϭ;ϭϭͿϬϭϭ͘ϵϬϭϵ͘ϱϮϬϬϭϬ Ψ ϲϱϬ͘ϬϬ D/^ŽŶĨĞƌĞŶĐĞ ϬϵϮϮϮϭ;ϭϭͿϬϭϭ͘ϵϬϭϵ͘ϱϮϬϬϭϬ Ψ ϭϯϬ͘ϬϬ D/^DĞŵďĞƌƐŚŝƉ&ĞĞ ϬϵϮϮϮϭ;ϭϭͿϬϭϭ͘ϵϬϭϵ͘ϱϮϬϬϭϬ Ψ ϭϰϯ͘ϴϮ ĚŽďĞWƌŽ>ŝĐĞŶƐĞ ϬϵϮϮϮϭ;ϭϭͿϬϭϭ͘ϵϬϭϵ͘ϱϵϬϭϭϬ Ψ ϭϳϬ͘ϬϬ KŶĞƌŝǀĞ ϬϵϮϮϮϭ;ϭϭͿϬϭϭ͘ϵϬϭϵ͘ϱϵϬϭϭϬ Ψ ϭϵ͘ϵϴ WŽǁĞƌ/ ϬϵϮϮϮϭ;ϭϭͿϬϭϭ͘ϵϬϭϵ͘ϱϮϬϬϭϬ Ψ ϯϯϬ͘Ϭϯ ^ƉĂƌĞ/WWŚŽŶĞƐ ϬϵϮϮϮϭ;ϭϭͿϬϭϭ͘ϵϬϭϵ͘ϱϮϬϬϭϬ Ψ ϭϲ͘ϵϵ sWh>dĂŵĞƌĂ ϬϵϮϮϮϭ;ϭϭͿϬϭϭ͘ϵϬϭϵ͘ϱϮϬϬϭϬ Ψ ϵ͘ϵϵ ĞŶĚĞƐŬWD^ŽŌǁĂƌĞ ϬϵϮϮϮϭ;ϭϭͿϬϭϭ͘ϵϬϭϵ͘ϱϮϬϬϭϬ Ψ ϭϳ͘ϱϬ ĞŶĚĞƐŬ^ƵƉƉŽƌƚ^ŽŌǁĂƌĞ ϬϵϮϮϮϭ;ϭϭͿϬϭϭ͘ϵϬϭϵ͘ϱϮϬϬϭϬ Ψ ϯϮϵ͘ϴϳ ŽŽŵĨŽƌWƵďůŝĐDĞĞƟŶŐƐ ϬϵϮϮϮϭ;ϭϭͿWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϮϰŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮ>dZKE/sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEdWzDEdEhDZWzDEddϬϭϭ͘ϵϬϭϵ͘ϱϮϬϬϭϬ Ψ ϭϮ͘ϵϵ ĚŽďĞ^ƵďƐĐƌŝƉƟŽŶ ϬϵϮϮϮϭ;ϭϭͿh^E<KZWKZdϬϬϱϱϵϰͲϬϭϭ͘ϵϬϭϵ͘ϱϮϬϬϭϬ Ψ ϭϰ͘ϯϮ ŵĂǌŽŶWƌŝŵĞDĞŵďĞƌƐŚŝƉ ϬϵϮϮϮϭ;ϭϭͿϬϭϭ͘ϵϬϭϵ͘ϱϮϬϬϭϬ Ψ ϵ͘ϵϵ ƌůŽĂŵĞƌĂ^ƵďƐĐƌŝƉƟŽŶ ϬϵϮϮϮϭ;ϭϭͿϬϭϭ͘ϵϬϭϵ͘ϱϮϬϬϭϬ Ψ Ϭ͘ϵϵ ƌŝĂsK/W^ŽŌǁĂƌĞ ϬϵϮϮϮϭ;ϭϭͿϬϭϭ͘ϵϬϭϵ͘ϱϮϬϬϭϬ Ψ Ϯϰϲ͘ϳϳ ĂŶŽŶWůŽƩĞƌdŽŶĞƌ ϬϵϮϮϮϭ;ϭϭͿϬϭϭ͘ϵϬϭϵ͘ϱϵϬϭϭϬ Ψ ϯϯ͘ϵϮ ĂŶǀĂWƵďůŝƐŚŝŶŐ^ŽŌǁĂƌĞĨŽƌsWh ϬϵϮϮϮϭ;ϭϭͿϬϭϭ͘ϵϬϭϵ͘ϱϮϬϬϭϬ Ψ ϰϵ͘ϲϬ ZĞƉĂŝƌ<ŝƚ ϬϵϮϮϮϭ;ϭϭͿϬϭϭ͘ϭϬϰϵ͘ϱϮϬϬϬϬ Ψ Ϯ͕ϭϵϰ͘ϱϬ ^ƵƉƉůŝĞƐ ϬϵϮϮϮϭ;ϭϮͿϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϯϭϲ͘ϲϯ ^ƵƉƉůŝĞƐ ϬϵϮϮϮϭ;ϭϯͿϬϭϭ͘ϭϬϯϭ͘ϱϳϬϬϬϬ Ψ ϭϱ͘ϬϬ ĂƌtĂƐŚ ϬϵϮϮϮϭ;ϭϰͿϬϭϭ͘ϭϬϯϭ͘ϱϵϲϳϬϬ Ψ ϭ͕Ϯϱϵ͘ϵϴ dƌĂŝŶŝŶŐ ϬϵϮϮϮϭ;ϭϰͿϬϭϭ͘ϭϬϯϭ͘ϱϵϲϱϬϬ Ψ ϮϰϮ͘ϵϲ dƌĂŝŶŝŶŐͬƐƚƌĂĚĂ ϬϵϮϮϮϭ;ϭϰͿϬϭϭ͘ϭϬϯϭ͘ϱϰϬϬϬϬ Ψ ϭϰϴ͘ϴϬ hŶŝĨŽƌŵƐ ϬϵϮϮϮϭ;ϭϰͿϬϭϭ͘ϭϬϮϲ͘ϱϵϲϮϬϬ Ψ ϭϬϲ͘ϬϬ >ŝǀĞ^ĐĂŶ ϬϵϮϮϮϭ;ϭϰͿϬϭϭ͘ϭϬϳϬ͘ϱϱϬϬϬϬ Ψ ϭϬϬ͘ϬϬ DĞĂůƐͬWĂƚƌŽůŚĞĐŬƉŽŝŶƚ ϬϵϮϮϮϭ;ϭϰͿϬϭϭ͘ϭϬϯϭ͘ϱϵϲϳϬϬ Ψ ϮϬϬ͘ϬϬ DĞŵďĞƌƐŚŝƉƵĞƐ ϬϵϮϮϮϭ;ϭϰͿϬϭϭ͘ϭϬϯϭ͘ϱϰϬϬϬϬ Ψ ϯϯϵ͘ϰϭ WŽůŝĐĞĂĚŐĞ ϬϵϮϮϮϭ;ϭϰͿϬϭϭ͘ϭϬϯϭ͘ϱϮϬϬϬϬ Ψ ϰϰ͘ϬϬ ^ƵƉƉůŝĞƐ ϬϵϮϮϮϭ;ϭϰͿϬϭϭ͘ϭϬϳϬ͘ϱϱϬϬϬϬ Ψ ϭ͕ϴϵϴ͘ϳϴ ^ƵƉƉůŝĞƐ ϬϵϮϮϮϭ;ϭϰͿϬϭϭ͘ϭϬϯϭ͘ϱϵϲϱϬϬ Ψ Ϯϳ͘ϮϬ dŽůůƐ ϬϵϮϮϮϭ;ϭϰͿϬϭϭ͘ϭϬϯϭ͘ϱϵϲϲϬϬ Ψ ϭ͕ϰϵϵ͘ϯϴ dƌĂŝŶŝŶŐ ϬϵϮϮϮϭ;ϭϰͿϬϭϭ͘ϭϬϰϵ͘ϱϮϬϬϬϬ Ψ ϯ͕ϭϲϴ͘ϭϮ ^ƵƉƉůŝĞƐ ϬϵϮϮϮϭ;ϭϱͿϬϱϱ͘ϴϭϬϬ͘ϱϮϬϬϬϬ Ψ ϭϮϳ͘ϲϲ ^ƵƉƉůŝĞƐ ϬϵϮϮϮϭ;ϭϲͿWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϮϱŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮ>dZKE/sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEdWzDEdEhDZWzDEddϬϱϱ͘ϵϬϬϬ͘ϱϮϬϬϬϬ Ψ ϭϵϱ͘ϴϱ ^ƵƉƉůŝĞƐ ϬϵϮϮϮϭ;ϭϲͿh^E<KZWKZdϬϬϱϱϵϰͲϬϱϱ͘ϵϬϬϬ͘ϱϵϲϲϬϬ Ψ Ϯϰ͘ϴϬ ^ƵƉƉůŝĞƐ ϬϵϮϮϮϭ;ϭϲͿϬϮϬ͘ϭϬϴϰ͘ϱϰϬϬϬϬ Ψ ϭϯϮ͘Ϯϳ hŶŝĨŽƌŵƐ ϬϵϮϮϮϭ;ϭϲͿϬϱϱ͘ϴϬϬϬ͘ϱϰϬϬϬϬ Ψ Ϯ͕ϲϱϰ͘ϳϯ hŶŝĨŽƌŵƐ ϬϵϮϮϮϭ;ϭϲͿϬϱϱ͘ϵϬϬϬ͘ϱϰϬϬϬϬ Ψ ϭϭϬ͘Ϯϯ hŶŝĨŽƌŵƐ ϬϵϮϮϮϭ;ϭϲͿϬϱϱ͘ϵϭϬϬ͘ϱϰϬϬϬϬ Ψ Ϯϵϱ͘ϯϲ hŶŝĨŽƌŵƐ ϬϵϮϮϮϭ;ϭϲͿϬϭϭ͘ϭϬϬϯ͘ϱϵϲϯϬϬ Ψ ϭϵϭ͘ϲϳ DĞĂůƐͬĂŶǀĂƐƐŝŶŐŽĂƌĚ ϬϵϮϮϮϭ;ϭϳͿϬϭϭ͘ϭϬϬϯ͘ϱϮϬϬϬϬ Ψ ϮϴϮ͘ϴϬ ^ƵƉƉůŝĞƐ ϬϵϮϮϮϭ;ϭϳͿϬϭϭ͘ϭϬϮϲ͘ϱϵϲϵϬϬ Ψ ϭϱ͘ϭϴ DĞĂůƐͬ,ĂůůŽǁĞĞŶWƌŝǌĞ ϬϵϮϮϮϭ;ϭϴͿϬϭϭ͘ϭϬϮϲ͘ϱϵϲϵϬϱ Ψ Ϯϭϯ͘Ϭϱ DĞĂůƐͬ/ŶƚĞƌǀŝĞǁWĂŶĞů ϬϵϮϮϮϭ;ϭϴͿϬϭϭ͘ϭϬϯϭ͘ϱϳϬϬϬϬ Ψ ϴϬ͘ϭϰ &ƵĞů ϬϵϮϮϮϭ;ϭϵͿϬϱϱ͘ϵϬϬϬ͘ϱϵϲϲϬϬ Ψ ϭϱϵ͘ϵϵ ^ĂĐƌĂŵĞŶƚŽĞĞ^ƵďƐĐƌŝƉƟŽŶ ϬϵϮϮϮϭ;ϮͿϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϭ͕ϴϳϵ͘ϯϵ ^ƵƉƉůŝĞƐ ϬϵϮϮϮϭ;ϮϬͿϬϭϭ͘ϭϬϰϵ͘ϱϮϬϬϬϬ Ψ ϲϮ͘ϵϬ ^ƵƉƉůŝĞƐ ϬϵϮϮϮϭ;ϮϭͿϬϭϭ͘ϭϬϬϰ͘ϱϵϲϲϬϬ Ψ ϯϲ͘ϲϲ &ŝŶĂŶĐŝĂůdŝŵĞƐWƌŝŶƚ^ƵďƐĐƌŝƉƟŽŶ ϬϵϮϮϮϭ;ϮϮͿϬϭϭ͘ϭϬϬϰ͘ϱϵϲϲϬϬ Ψ ϰϬ͘ϬϬ &ŝŶĂŶĐŝĂůdŝŵĞƐ^ƵďƐĐƌŝƉƟŽŶ ϬϵϮϮϮϭ;ϮϮͿϬϭϭ͘ϭϬϬϰ͘ϱϵϲϱϬϬ Ψ ϱϴϬ͘ϵϲ dƌĂǀĞůǆƉĞŶƐĞ ϬϵϮϮϮϭ;ϮϮͿϬϭϭ͘ϱϬϯϭ͘ϱϲϬϬϬϬ Ψ ϲϲ͘ϲϵ ĂďůĞ^ĞƌǀŝĐĞ ϬϵϮϮϮϭ;ϮϯͿϬϭϭ͘ϭϬϯϭ͘ϱϮϬϬϬϬ Ψ ϭϮϭ͘Ϯϲ ^ƵƉƉůŝĞƐ ϬϵϮϮϮϭ;ϮϯͿϬϭϭ͘ϭϬϯϭ͘ϱϰϬϬϬϬ Ψ ϳϳϰ͘ϲϲ ^ƵƉƉůŝĞƐ ϬϵϮϮϮϭ;ϮϯͿϬϭϭ͘ϭϬϯϭ͘ϱϵϲϱϱϬ Ψ ϭϰ͘ϯϮ ^ƵƉƉůŝĞƐ ϬϵϮϮϮϭ;ϮϯͿϬϱϳ͘ϭϬϱϳ͘ϱϵϲϱϱϬ Ψ ϱϬϬ͘ϬϬ ZĞŐŝƐƚƌĂƟŽŶ&ĞĞƐ ϬϵϮϮϮϭ;ϮϰͿϬϱϱ͘ϴϰϬϬ͘ϱϵϬϬϬϬ Ψ Ϯϳϱ͘ϲϮ >ŝŌŝŶŐƋƵŝƉŵĞŶƚ ϬϵϮϮϮϭ;ϮϱͿWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϮϲŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮ>dZKE/sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEdWzDEdEhDZWzDEddϬϱϱ͘ϴϬϬϬ͘ϱϵϲϳϬϬ Ψ ϮϬϬ͘ϬϬ DĞŵďĞƌƐŚŝƉƵĞƐ ϬϵϮϮϮϭ;ϮϱͿh^E<KZWKZdϬϬϱϱϵϰͲϬϱϱ͘ϵϬϬϬ͘ϱϮϬϬϬϬ Ψ ϴϬϳ͘ϰϬ ^ƵƉƉůŝĞƐ ϬϵϮϮϮϭ;ϮϱͿϬϮϬ͘ϭϬϴϰ͘ϵϬϬϬϬϬ Ψ Ϯ͕ϵϮϬ͘ϲϭ tĞůůϮϬZĞŚĂďŝůŝƚĂƟŽŶ ϬϵϮϮϮϭ;ϮϱͿϬϭϭ͘ϭϬϲϬ͘ϱϵϲϳϬϬ Ψ ϵϬ͘ϬϬ /ǆĂŵ&ĞĞ ϬϵϮϮϮϭ;ϮϲͿϬϭϭ͘ϭϬϲϬ͘ϱϮϬϬϬϬ Ψ ϰϲ͘ϭϴ ^ƵƉƉůŝĞƐ ϬϵϮϮϮϭ;ϮϲͿϬϭϭ͘ϭϬϲϬ͘ϱϵϲϳϬϬ Ψ ϭϵϳ͘ϭϬ dƌĂŝŶŝŶŐͬZ͘ĂŵŽƌĂ ϬϵϮϮϮϭ;ϮϲͿϬϭϭ͘ϭϬϲϬ͘ϱϵϲϳϬϬ Ψ ϰϬ͘ϬϬ dƌĂŝŶŝŶŐͬs͘WĞƚƌŽƐǇĂŶ ϬϵϮϮϮϭ;ϮϲͿϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϱϱϬ͘ϬϬ ƵƚŽŵŽƟǀĞWĂƌƚƐ ϬϵϮϮϮϭ;ϮϳͿϬϭϭ͘ϭϬϮϰ͘ϱϵϲϱϱϬ Ψ Ϯϱ͘ϬϬ DĞŵďĞƌƐŚŝƉƵĞƐ ϬϵϮϮϮϭ;ϮϴͿϬϮϬ͘ϭϬϴϰ͘ϱϵϬϬϬϬ Ψ ϭ͕Ϯϱϲ͘ϵϳ ŽǁŶĞǇ^ƵŵƉZĞƉĂŝƌƐ ϬϵϮϮϮϭ;ϯͿϬϭϭ͘ϭϬϳϬ͘ϱϱϬϬϬϬ Ψ ϭ͕Ϯϯϭ͘ϰϬ ŽŵŵƵŶŝƚǇKƵƚƌĞĂĐŚǀĞŶƚ ϬϵϮϮϮϭ;ϰͿϬϭϭ͘ϭϬϬϮ͘ϱϵϲϱϬϬ Ψ ϱϬ͘ϬϬ DĞŵďĞƌƐŚŝƉƵĞƐ ϬϵϮϮϮϭ;ϰͿϬϭϭ͘ϭϬϰϵ͘ϱϮϬϬϬϬ Ψ ϰϬ͘ϳϴ ^ƵƉƉůŝĞƐ ϬϵϮϮϮϭ;ϰͿϬϭϭ͘ϭϬϰϭ͘ϱϵϲϱϱϬ Ψ ϭϰϱ͘ϬϬ DĞŵďĞƌƐŚŝƉƵĞƐ ϬϵϮϮϮϭ;ϱͿϬϭϭ͘ϭϬϰϬ͘ϱϮϬϬϬϬ Ψ ϭϭ͘ϴϴ ^ƵƉƉůŝĞƐ ϬϵϮϮϮϭ;ϱͿϬϭϭ͘ϭϬϰϭ͘ϱϵϲϲϬϬ Ψ ϭϯϴ͘Ϯϲ ^ƵƉƉůŝĞƐ ϬϵϮϮϮϭ;ϱͿϬϭϭ͘ϭϵϵϵϵϵ Ψ ϭϵϳ͘ϮϮ ŚĂƌŐĞƐŝŶZĞǀŝĞǁ ϬϵϮϮϮϭ;ϲͿϬϱϲ͘ϱϲϬϬ͘ϱϮϬϬϬϬ Ψ ϭϭϬ͘ϮϬ ^ƵƉƉůŝĞƐ ϬϵϮϮϮϭ;ϲͿϬϭϭ͘ϭϬϬϮ͘ϱϵϲϱϬϬ Ψ ϮϬϱ͘Ϯϯ DĞĂůƐͬ'ĂƚĞǁĂǇK'ŝƚǇDĂŶĂŐĞƌΖƐ ϬϵϮϮϮϭ;ϳͿϬϭϭ͘ϭϬϮϯ͘ϱϵϲϲϬϬ Ψ ϲϳ͘ϵϲ ^ƵďƐĐƌŝƉƟŽŶƵĞƐ ϬϵϮϮϮϭ;ϳͿϬϱϱ͘ϴϰϬϬ͘ϱϮϬϬϬϬ Ψ ϮϮ͘Ϭϭ <ĞǇZĞƉĂŝƌ ϬϵϮϮϮϭ;ϴͿϬϱϱ͘ϴϭϬϬ͘ϱϵϲϳϬϬ Ψ ϮϮϵ͘ϬϬ ZĞŐŝƐƚƌĂƟŽŶ&ĞĞƐͬ͘,ŝŶŽũŽƐ ϬϵϮϮϮϭ;ϴͿϬϱϱ͘ϴϭϬϬ͘ϱϵϲϳϬϬ Ψ ϮϮϵ͘ϬϬ ZĞŐŝƐƚƌĂƟŽŶ&ĞĞƐͬ&͘&ůŽƌĞƐ ϬϵϮϮϮϭ;ϴͿWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϮϳŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮ>dZKE/sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEdWzDEdEhDZWzDEddϬϱϱ͘ϴϭϬϬ͘ϱϵϲϳϬϬ Ψ ϮϮϵ͘ϬϬ ZĞŐŝƐƚƌĂƟŽŶ&ĞĞƐͬ:͘ĂĐĞǇ ϬϵϮϮϮϭ;ϴͿh^E<KZWKZdϬϬϱϱϵϰͲϬϱϱ͘ϴϭϬϬ͘ϱϵϲϳϬϬ Ψ ϮϮϵ͘ϬϬ ZĞŐŝƐƚƌĂƟŽŶ&ĞĞƐͬt͘ĂƌƌĂŵ ϬϵϮϮϮϭ;ϴͿϬϮϬ͘ϭϬϴϰ͘ϵϬϬϬϬϬ Ψ Ϯ͕ϵϮϬ͘ϯϵ ^ͬůĞĐƚƌŝĐĂůhƉŐƌĂĚĞƐ ϬϵϮϮϮϭ;ϴͿϬϮϬ͘ϭϬϴϰ͘ϵϬϬϬϬϬ Ψ ϭ͕Ϯϱϰ͘ϴϳ tĞůůƋƵŝƉŵĞŶƚ ϬϵϮϮϮϭ;ϴͿϬϭϭ͘ϭϬϰϵ͘ϱϮϬϬϬϬ Ψ ϯϴϱ͘ϴϬ ^ƵƉƉůŝĞƐ ϬϵϮϮϮϭ;ϵͿΨ ϰϭ͕ϴϴϴ͘ϲϱϭϮͬϬϭͬϮϬϮϭ ϭϮϲϯϴϬϱϱ͘ϵϭϵϬ͘ϵϬϬϬϬϬ Ψ ϯϭ͕ϵϮϬ͘ϬϬ ^ŽŌǁĂƌĞ^ƵďƐĐƌŝƉƟŽŶΕ ϭϬϬϰϬϯh^Ϭ,y Ϭϭϭ͘ϬϬϭϱϬϵϵ,y'KED,K>/E'^>>ϬϬϳϯϬϭͲΨ ϯϭ͕ϵϮϬ͘ϬϬϬϯͬϭϴͬϮϬϮϮ ϭϮϲϯϵWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϮϴŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮ>dZKE/sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEdWzDEdEhDZWzDEddϬϭϭ͘ϭϬϮϲ͘ϱϵϲϵϬϱ Ψ ϴϲ͘ϭϳ DĞĂůƐ ϭϬϮϮϮϭh^E<KZWKZdϬϬϱϱϵϰͲϬϭϭ͘ϭϬϰϯ͘ϱϮϬϬϬϬ Ψ ϰϮϮ͘ϭϲ ^ƵƉƉůŝĞƐ ϭϬϮϮϮϭ;ϭϬͿϬϭϭ͘ϵϬϭϵ͘ϱϵϬϭϭϬ Ψ ϱϵϭ͘Ϯϲ ĚŽďĞ>ŝĐĞŶƐĞ ϭϬϮϮϮϭ;ϭϭͿϬϭϭ͘ϵϬϭϵ͘ϱϵϬϭϭϬ Ψ ϭϬϵ͘ϮϬ WD^ŽŌǁĂƌĞ ϭϬϮϮϮϭ;ϭϭͿϬϭϭ͘ϵϬϭϵ͘ϱϵϬϭϭϬ Ψ ϭϬϯ͘ϬϬ ZĞŵŽƚĞDĞĞƟŶŐ^ŽŌǁĂƌĞ ϭϬϮϮϮϭ;ϭϭͿϬϭϭ͘ϵϬϭϵ͘ϱϮϬϬϭϬ Ψ Ϯϳ͘ϬϬ ZŽƵƚĞƌ^ŽŌǁĂƌĞ ϭϬϮϮϮϭ;ϭϭͿϬϭϭ͘ϵϬϭϵ͘ϱϮϬϬϭϬ Ψ Ϯ͕ϰϯϭ͘ϵϮ ^ƵƉƉůŝĞƐ ϭϬϮϮϮϭ;ϭϭͿϬϭϭ͘ϵϬϭϵ͘ϱϮϬϬϭϬ Ψ ϭϳ͘ϲϯ ^ƵƉƉůŝĞƐ ϭϬϮϮϮϭ;ϭϭͿϬϭϭ͘ϵϬϭϵ͘ϱϮϬϬϭϬ Ψ Ϯϭϴ͘ϲϰ ^ƵƉƉůŝĞƐ ϭϬϮϮϮϭ;ϭϭͿϬϭϭ͘ϵϬϭϵ͘ϱϮϬϬϭϬ Ψ ϯϬϬ͘ϯϳ ^ƵƉƉůŝĞƐ ϭϬϮϮϮϭ;ϭϭͿϬϭϭ͘ϵϬϭϵ͘ϱϵϬϭϭϬ Ψ ϵ͘ϵϵ sWh>dĂŵĞƌĂ ϭϬϮϮϮϭ;ϭϭͿϬϭϭ͘ϵϬϭϵ͘ϱϵϬϭϭϬ Ψ ϯϯ͘ϵϮ sWhWƵďůŝƐŚŝŶŐ^ŽŌǁĂƌĞ ϭϬϮϮϮϭ;ϭϭͿϬϭϭ͘ϵϬϭϵ͘ϱϮϬϬϭϬ Ψ ϭϳ͘ϱϬ ĞŶĚĞƐŬ^ƵƉƉŽƌƚ^ŽŌǁĂƌĞ ϭϬϮϮϮϭ;ϭϭͿϬϭϭ͘ϵϬϭϵ͘ϱϵϬϭϭϬ Ψ ϭϲ͘ϵϵ ĚŽďĞ^ƵďƐĐƌŝƉƟŽŶ ϭϬϮϮϮϭ;ϭϭͿϬϭϭ͘ϵϬϭϵ͘ϱϮϬϬϭϬ Ψ ϭϬ͘ϬϬ ĞŶĚĞƐŬ^ƵƉƉŽƌƚ^ŽŌǁĂƌĞ ϭϬϮϮϮϭ;ϭϭͿϬϭϭ͘ϵϬϭϵ͘ϱϵϬϭϭϬ Ψ ϯϮϵ͘ϴϳ ŽŽŵĨŽƌWƵďůŝĐDĞĞƟŶŐƐ ϭϬϮϮϮϭ;ϭϭͿϬϭϭ͘ϵϬϭϵ͘ϱϵϬϭϭϬ Ψ Ϭ͘ϵϵ ƌŝĂsK/W^ŽŌǁĂƌĞ ϭϬϮϮϮϭ;ϭϭͿϬϭϭ͘ϵϬϭϵ͘ϱϮϬϬϭϬ Ψ ϵϱ͘ϬϬ ĂƚĂZĞĐŽǀĞƌǇ^ŽŌǁĂƌĞ ϭϬϮϮϮϭ;ϭϭͿϬϭϭ͘ϵϬϭϵ͘ϱϵϬϭϭϬ Ψ ϭ͕ϰϰϳ͘ϮϬ 'ŽŽŐůĞ^ƵŝƚĞĨŽƌWt ϭϬϮϮϮϭ;ϭϭͿϬϭϭ͘ϵϬϭϵ͘ϱϵϬϭϭϬ Ψ ϯϳϳ͘ϳϱ 'ŽdŽƐƐŝƐƚ>ŝĐĞŶƐĞ ϭϬϮϮϮϭ;ϭϭͿϬϭϭ͘ϵϬϭϵ͘ϱϵϬϭϭϬ Ψ ϰϵϳ͘ϬϬ ,ĞůƉĚĞƐŬ^ƵƉƉŽƌƚ^ŽŌǁĂƌĞ ϭϬϮϮϮϭ;ϭϭͿϬϭϭ͘ϵϬϭϵ͘ϱϵϲϱϬϬ Ψ ϰϴϵ͘Ϯϳ >ŽĚŐŝŶŐ ϭϬϮϮϮϭ;ϭϭͿϬϭϭ͘ϵϬϭϵ͘ϱϵϬϭϭϬ Ψ Ϯϲϱ͘ϵϴ KĸĐĞϯϲϱ^ƵďƐĐƌŝƉƟŽŶ ϭϬϮϮϮϭ;ϭϭͿWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϮϵŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮ>dZKE/sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEdWzDEdEhDZWzDEddϬϭϭ͘ϭϬϮϰ͘ϱϵϲϲϬϬ Ψ ϴϳϬ͘ϬϬ ^ƵďƐĐƌŝƉƟŽŶƵĞƐ ϭϬϮϮϮϭ;ϭϮͿh^E<KZWKZdϬϬϱϱϵϰͲϬϭϭ͘ϭϬϰϵ͘ϱϮϬϬϬϬ Ψ ϰϭϴ͘ϬϬ ^ƵƉƉůŝĞƐ ϭϬϮϮϮϭ;ϭϯͿϬϭϭ͘ϭϬϯϭ͘ϱϰϬϬϬϬ Ψ ϭϭϱ͘ϰϵ ĂĚŐĞtĂůůĞƚƐ ϭϬϮϮϮϭ;ϭϰͿϬϭϭ͘ϭϬϳϬ͘ϱϱϬϬϬϬ Ψ Ϯϵϲ͘ϴϵ ,ĂůůŽǁĞĞŶŽŵŵƵŶŝƚǇǀĞŶƚ ϭϬϮϮϮϭ;ϭϰͿϬϭϭ͘ϭϬϯϭ͘ϱϮϬϬϬϬ Ψ ϲϰϰ͘ϵϲ ,ŽůŝĚĂǇ'ƌĞĞƟŶŐĂƌĚƐ ϭϬϮϮϮϭ;ϭϰͿϬϭϭ͘ϭϬϳϬ͘ϱϱϬϬϬϬ Ψ Ϯϲ͘ϰϲ DĞĂůƐͬWĂŶĞů/ŶƚĞƌǀŝĞǁ ϭϬϮϮϮϭ;ϭϰͿϬϭϭ͘ϭϬϯϭ͘ϱϵϲϳϬϬ Ψ ϮϮ͘ϴϱ DĞŵďĞƌƐŚŝƉƵĞƐ ϭϬϮϮϮϭ;ϭϰͿϬϭϭ͘ϭϬϯϭ͘ϱϰϬϬϬϬ Ψ ϵϵ͘ϮϬ WŽůŽ^ŚŝƌƚƐ ϭϬϮϮϮϭ;ϭϰͿϬϭϭ͘ϭϬϯϭ͘ϱϵϲϱϬϬ Ψ ϭ͕ϭϮϲ͘ϰϰ dƌĂŝŶŝŶŐͬE͘WĞƌĞǌ ϭϬϮϮϮϭ;ϭϰͿϬϭϭ͘ϭϬϯϭ͘ϱϵϲϳϬϬ Ψ ϮϮϲ͘ϬϬ dƌĂŝŶŝŶŐͬE͘WĞƌĞǌ ϭϬϮϮϮϭ;ϭϰͿϬϭϭ͘ϭϬϯϭ͘ϱϰϬϬϬϬ Ψ ϭϲϭ͘ϵϮ hŶŝĨŽƌŵƐ ϭϬϮϮϮϭ;ϭϰͿϬϭϭ͘ϭϬϳϬ͘ϱϱϬϬϬϬ Ψ ϵϰϲ͘ϴϱ ,ĂůůŽǁĞĞŶŽŵŵƵŶŝƚǇǀĞŶƚ ϭϬϮϮϮϭ;ϭϱͿϬϭϭ͘ϭϬϰϵ͘ϱϮϬϬϬϬ Ψ Ϯ͕ϲϵϬ͘ϳϮ ^ƵƉƉůŝĞƐ ϭϬϮϮϮϭ;ϭϱͿϬϱϱ͘ϵϬϬϬ͘ϱϱϬϬϬϬ Ψ ϲϬϬ͘ϬϬ ĚǀĞƌƟƐŝŶŐ ϭϬϮϮϮϭ;ϭϲͿϬϱϱ͘ϵϬϬϬ͘ϱϵϲϲϬϬ Ψ ϭϵϳ͘ϱϳ ŽŽŬƐΘWƵďůŝĐĂƟŽŶƐ ϭϬϮϮϮϭ;ϭϲͿϬϱϱ͘ϴϬϬϬ͘ϱϵϲϳϬϬ Ψ ϯϭϬ͘ϬϬ dƌĂŝŶŝŶŐͬ͘DŽŶƚŽǇĂ ϭϬϮϮϮϭ;ϭϲͿϬϱϱ͘ϴϭϬϬ͘ϱϵϲϳϬϬ Ψ ϯϲϱ͘ϬϬ dƌĂŝŶŝŶŐͬ͘DŽŶƚŽǇĂ ϭϬϮϮϮϭ;ϭϲͿϬϮϬ͘ϭϬϴϰ͘ϱϰϬϬϬϬ Ψ ϭϲϳ͘ϰϵ hŶŝĨŽƌŵƐ ϭϬϮϮϮϭ;ϭϲͿϬϱϱ͘ϴϬϬϬ͘ϱϰϬϬϬϬ Ψ ϯϱϮ͘ϳϲ hŶŝĨŽƌŵƐ ϭϬϮϮϮϭ;ϭϲͿϬϭϭ͘ϭϬϬϯ͘ϱϮϬϬϬϬ Ψ ϴϱ͘ϯϮ ^ƵƉƉůŝĞƐ ϭϬϮϮϮϭ;ϭϳͿϬϭϭ͘ϭϬϮϲ͘ϱϵϲϵϬϬ Ψ Ϯϲϰ͘ϴϮ ,ĂůůŽǁĞĞŶĞƉĂƌƚŵĞŶƚWƌŝǌĞ ϭϬϮϮϮϭ;ϭϴͿϬϭϭ͘ϭϬϮϲ͘ϱϵϲϵϬϬ Ψ ϰϱϳ͘ϯϮ ,ŽůŝĚĂǇ'ƌĞĞƟŶŐĂƌĚƐ ϭϬϮϮϮϭ;ϭϴͿϬϭϭ͘ϭϬϮϲ͘ϱϵϲϵϬϱ Ψ ϭϯϳ͘ϭϬ DĞĂůƐͬWĂŶĞů/ŶƚĞƌǀŝĞǁ ϭϬϮϮϮϭ;ϭϴͿWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϯϬŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮ>dZKE/sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEdWzDEdEhDZWzDEddϬϭϭ͘ϭϬϳϬ͘ϱϱϬϬϬϬ Ψ ϯϰϳ͘Ϯϱ ŽŵŵƵŶŝƚǇKƵƚƌĞĂĐŚǀĞŶƚ ϭϬϮϮϮϭ;ϭϵͿh^E<KZWKZdϬϬϱϱϵϰͲϬϮϬ͘ϭϬϴϰ͘ϵϬϬϬϬϬ Ψ ϭ͕ϵϳϬ͘ϴϬ ^ͬůĞĐƚƌŝĐĂůhƉŐƌĂĚĞƐ ϭϬϮϮϮϭ;ϭϵͿϬϱϱ͘ϳϭϬϬ͘ϱϮϬϬϬϬ Ψ ϳϴϭ͘ϴϳ ^ƵƉƉůŝĞƐ ϭϬϮϮϮϭ;ϭϵͿϬϱϱ͘ϵϬϬϬ͘ϱϵϲϱϱϬ Ψ ϴϭ͘ϵϵ ĂďůĞ^ĞƌǀŝĐĞ ϭϬϮϮϮϭ;ϮͿϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϯϴϰ͘ϳϭ ^ƵƉƉůŝĞƐ ϭϬϮϮϮϭ;ϮϬͿϬϭϭ͘ϭϬϰϯ͘ϱϮϬϬϬϬ Ψ ϲϳϵ͘ϯϮ ^ƵƉƉůŝĞƐ ϭϬϮϮϮϭ;ϮϭͿϬϭϭ͘ϭϬϰϵ͘ϱϮϬϬϬϬ Ψ ϰϯϳ͘ϵϴ ^ƵƉƉůŝĞƐ ϭϬϮϮϮϭ;ϮϭͿϬϭϭ͘ϭϬϬϰ͘ϱϵϲϱϬϬ Ψ ϰϳϬ͘ϬϬ ^D&KŽŶĨĞƌĞŶĐĞ ϭϬϮϮϮϭ;ϮϮͿϬϭϭ͘ϭϬϬϰ͘ϱϵϲϲϬϬ Ψ ϰϬ͘ϬϬ &ŝŶĂŶĐŝĂůdŝŵĞƐ^ƵďƐĐƌŝƉƟŽŶ ϭϬϮϮϮϭ;ϮϮͿϬϭϭ͘ϭϬϬϰ͘ϱϵϲϱϬϬ Ψ Ϯϱϴ͘ϯϭ ,ŽƚĞůƐ ϭϬϮϮϮϭ;ϮϮͿϬϭϭ͘ϭϬϬϰ͘ϱϵϲϱϬϬ Ψ ϯϬ͘ϲϳ DĞĂůƐͬŽŶĨĞƌĞŶĐĞ ϭϬϮϮϮϭ;ϮϮͿϬϭϭ͘ϱϬϯϭ͘ϱϲϬϬϬϬ Ψ ϲϲ͘ϲϵ ĂďůĞ^ĞƌǀŝĐĞ ϭϬϮϮϮϭ;ϮϯͿϬϭϭ͘ϭϬϯϭ͘ϱϵϲϱϱϬ Ψ ϭϰ͘ϯϮ DĞŵďĞƌƐŚŝƉƵĞƐ ϭϬϮϮϮϭ;ϮϯͿϬϭϭ͘ϭϬϯϭ͘ϱϮϬϬϬϬ Ψ ϭϭ͘ϱϬ ^ƵƉƉůŝĞƐ ϭϬϮϮϮϭ;ϮϯͿϬϱϱ͘ϵϬϬϬ͘ϱϵϲϳϬϬ Ψ ϰϲϬ͘ϬϬ W/KŽŶĨĞƌĞŶĐĞͬD͘KƩŽ ϭϬϮϮϮϭ;ϮϰͿϬϱϱ͘ϵϬϬϬ͘ϱϵϲϳϬϬ Ψ ϯϴ͘ϱϵ ŵƉůŽǇĞĞĞǀĞůŽƉŵĞŶƚΘdƌĂŝŶŝŶŐ ϭϬϮϮϮϭ;ϮϰͿϬϱϱ͘ϴϬϬϬ͘ϱϵϲϳϬϬ Ψ Ϯϲϱ͘ϲϴ h^ZDĞĞƟŶŐͬ͘DŽŶƚŽǇĂ ϭϬϮϮϮϭ;ϮϰͿϬϱϱ͘ϴϬϬϬ͘ϱϵϬϬϬϬ Ψ ϯϲϮ͘ϰϯ ZĞƉĂŝƌƐΘDĂŝŶƚĞŶĂŶĐĞ ϭϬϮϮϮϭ;ϮϰͿϬϱϱ͘ϵϬϬϬ͘ϱϮϬϬϬϬ Ψ ϭϵϱ͘ϭϬ ^ƵƉƉůŝĞƐ ϭϬϮϮϮϭ;ϮϰͿϬϱϱ͘ϴϬϬϬ͘ϱϵϲϳϬϬ Ψ ϯϲϱ͘ϬϬ dƌĂŝŶŝŶŐͬ:͘ƐƚƌĂĚĂ ϭϬϮϮϮϭ;ϮϰͿϬϱϱ͘ϴϭϬϬ͘ϱϵϲϳϬϬ Ψ ϮϮϵ͘ϬϬ dƌĂŝŶŝŶŐͬ^͘^ŚĂƌŝĨǌĂĚĞŚ ϭϬϮϮϮϭ;ϮϰͿϬϭϭ͘ϭϬϲϬ͘ϱϮϬϬϬϬ Ψ ϵϬ͘ϯϯ ^ƵƉƉůŝĞƐ ϭϬϮϮϮϭ;ϮϱͿϬϭϭ͘ϭϬϲϬ͘ϱϵϲϳϬϬ Ψ ϯϳϵ͘ϬϬ dƌĂŝŶŝŶŐ ϭϬϮϮϮϭ;ϮϱͿWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϯϭŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮ>dZKE/sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEdWzDEdEhDZWzDEddϬϮϬ͘ϭϬϴϰ͘ϱϮϬϬϬϬ Ψ ϴϬϰ͘ϵϯ ^ƵƉƉůŝĞƐ ϭϬϮϮϮϭ;ϮϲͿh^E<KZWKZdϬϬϱϱϵϰͲϬϭϭ͘ϭϬϳϬ͘ϱϱϬϬϬϬ Ψ ϳϯϵ͘ϲϴ ,ĂůůŽǁĞĞŶŽŵŵƵŶŝƚǇǀĞŶƚ ϭϬϮϮϮϭ;ϯͿϬϭϭ͘ϭϬϯϭ͘ϱϵϲϳϬϬ Ψ ϮϱϬ͘ϬϬ dƌĂŝŶŝŶŐͬE͘WĞƌĞǌ ϭϬϮϮϮϭ;ϯͿϬϭϭ͘ϭϬϳϬ͘ϱϱϬϬϬϬ Ψ ϭϭ͘Ϭϱ ĂƌĞĞƌĂǇǀĞŶƚ ϭϬϮϮϮϭ;ϰͿϬϭϭ͘ϭϬϬϮ͘ϱϵϲϱϬϬ Ψ ϲϱ͘ϬϬ ŝƚǇDĂŶĂŐĞƌƐ^Ƶŵŵŝƚ ϭϬϮϮϮϭ;ϰͿϬϭϭ͘ϭϬϳϬ͘ϱϱϬϬϬϬ Ψ Ϯ͕ϳϰϳ͘ϲϲ ,ĂůůŽǁĞĞŶŽŵŵƵŶŝƚǇǀĞŶƚ ϭϬϮϮϮϭ;ϰͿϬϭϭ͘ϭϬϬϮ͘ϱϮϬϬϬϬ Ψ ϭϬϬ͘ϳϰ WŽůŽ^ŚŝƌƚƐ ϭϬϮϮϮϭ;ϰͿϬϭϭ͘ϭϬϬϮ͘ϱϵϲϱϬϬ Ψ ϵϬϮ͘ϲϳ >ŽĚŐŝŶŐ ϭϬϮϮϮϭ;ϱͿϬϭϭ͘ϭϵϵϵϵϵ Ψ ϯϴϮ͘ϭϲ ^ƵƉƉůŝĞƐ ϭϬϮϮϮϭ;ϱͿϬϭϭ͘ϭϬϬϮ͘ϱϵϲϱϬϬ Ψ ϲϳϮ͘ϰϲ dƌĂǀĞů ϭϬϮϮϮϭ;ϱͿϬϭϭ͘ϭϬϰϬ͘ϱϵϲϳϬϬ Ψ ϮϰϬ͘ϬϬ ŶŶƵĂůDĞŵďĞƌƐŚŝƉƵĞƐ ϭϬϮϮϮϭ;ϲͿϬϭϭ͘ϭϬϰϭ͘ϱϵϲϳϬϬ Ψ ϱϴϱ͘ϬϬ dƌĂŝŶŝŶŐͬ͘ZŝǀĂƐ ϭϬϮϮϮϭ;ϲͿϬϭϭ͘ϭϬϰϭ͘ϱϵϲϳϬϬ Ψ Ϯϲϱ͘ϬϬ dƌĂŝŶŝŶŐͬ͘ĂŶŽ ϭϬϮϮϮϭ;ϲͿϬϭϭ͘ϭϬϰϭ͘ϱϵϲϳϬϬ Ψ ϭϵϱ͘ϬϬ dƌĂŝŶŝŶŐͬ:͘DŽŽƌĞ ϭϬϮϮϮϭ;ϲͿϬϭϭ͘ϭϬϰϭ͘ϱϵϲϳϬϬ Ψ ϱϴϱ͘ϬϬ dƌĂŝŶŝŶŐͬW͘ZĞǇŶŽƐŽ ϭϬϮϮϮϭ;ϲͿϬϭϭ͘ϭϬϰϭ͘ϱϵϲϳϬϬ Ψ ϭϵϱ͘ϬϬ dƌĂŝŶŝŶŐͬZ͘'ĂƌŝďĂǇ ϭϬϮϮϮϭ;ϲͿϬϭϭ͘ϭϬϰϭ͘ϱϵϲϳϬϬ Ψ ϭϵϱ͘ϬϬ dƌĂŝŶŝŶŐͬ^͘ĂŶĂůĞƐ ϭϬϮϮϮϭ;ϲͿϬϭϭ͘ϭϬϰϭ͘ϱϵϲϳϬϬ Ψ ϲϯϯ͘ϳϱ dƌĂŝŶŝŶŐͬt͘ƌƵǌ ϭϬϮϮϮϭ;ϲͿϬϭϭ͘ϭϵϵϵϵϵ Ψ ϭ͕ϯϴϬ͘ϵϯ ŚĂƌŐĞƐ/ŶZĞǀŝĞǁ ϭϬϮϮϮϭ;ϳͿϬϱϲ͘ϱϲϬϬ͘ϱϮϬϬϬϬ Ψ ϵϭ͘Ϭϭ Zs^ƵƉƉůŝĞƐ ϭϬϮϮϮϭ;ϳͿϬϭϭ͘ϭϬϮϯ͘ϱϵϲϲϬϬ Ψ ϲϳ͘ϲϭ ^ƵďƐĐƌŝƉƟŽŶƵĞƐ ϭϬϮϮϮϭ;ϴͿϬϱϱ͘ϴϰϬϬ͘ϱϮϬϬϬϬ Ψ ϭϭ͘ϬϬ <ĞǇZĞƉĂŝƌ ϭϬϮϮϮϭ;ϵͿϬϱϱ͘ϴϰϬϬ͘ϱϮϬϬϬϬ Ψ ϲϭϱ͘ϮϬ ^ƵƉƉůŝĞƐ ϭϬϮϮϮϭ;ϵͿWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϯϮŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮ>dZKE/sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEdWzDEdEhDZWzDEddΨ ϯϴ͕ϭϳϴ͘ϯϲϭϮͬϬϭͬϮϬϮϭ ϭϮϲϰϬϬϭϭ͘ϭϬϯϭ͘ϱϮϬϬϬϬ Ψ ϯ͘ϵϬ KĸĐĞ^ƵƉƉůŝĞƐ ϮϮϭϭϴϵϰϰϬϬϬϯK&&/WKdϬϬϮϭϵϬͲϬϭϭ͘ϭϬϯϭ͘ϱϮϬϬϬϬ Ψ ϯϭϰ͘ϱϵ KĸĐĞ^ƵƉƉůŝĞƐ ϮϮϭϭϴϵϰϰϬϬϭϬϭϭ͘ϭϬϯϭ͘ϱϮϬϬϬϬ Ψ Ϯϳ͘ϱϱ KĸĐĞ^ƵƉƉůŝĞƐ ϮϮϭϭϵϭϮϰϳϬϬϭΨ ϯϰϲ͘ϬϰϬϯͬϭϲͬϮϬϮϮ ϭϮϲϰϭϬϭϭ͘ϭϬϰϭ͘ϱϮϬϬϬϬ Ψ ϯϲ͘ϬϬ WĞƌŝŽĚ͗ϬϯͬϮϮ ϵϯϯϯϭϮϭϬϮ;ϮͿhW^ϬϬϭϲϭϳͲϬϭϭ͘ϵϬϭϵ͘ϱϮϬϬϭϬ Ψ ϭϴ͘ϬϮ WĞƌŝŽĚ͗ϬϯͬϮϮ ϵϯϯϯϭϮϭϬϮ;ϮͿΨ ϱϰ͘ϬϮϬϯͬϭϲͬϮϬϮϮ ϭϮϲϰϮϬϱϱ͘ϵϭϵϬ͘ϱϵϱϮϬϬ Ψ ϵ͕ϭϲϬ͘ϰϴ ϮϬϮϭŶŶƵĂůŵŝƐƐŝŽŶƐZĞƉŽƌƚ͗D'^ ϬϯϭϭϮϮ^Khd,K^dYDϬϬϭϭϱϴͲΨ ϵ͕ϭϲϬ͘ϰϴϬϯͬϭϳͬϮϬϮϮ ϭϮϲϰϯdKd>>dZKE/Ψ ϵ͕ϳϬϲ͕ϴϰϱ͘ϳϳWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϯϯŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮZ>z,<^sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEd,<EhDZWzDEddϬϱϱ͘ϵϬϬϬ͘ϱϵϲϳϬϬ Ψ ϴϬ͘ϬϬ ZĞŶĞǁĂůͬKƉEŽ͘ϮϴϬϮϵ ϬϳϬϭϮϮ^tZͲtKWϬϬϬϮϴϳͲΨ ϴϬ͘ϬϬϬϯͬϬϭͬϮϬϮϮ ϲϬϴϳϵϲϬϭϭ͘ϭϬϰϬ͘ϰϬϬϵϬϬ Ψ ϳϰϲ͘Ϭϴ WĂƌƟĂůtĂƌĞŚŽƵƐĞ^ƉĞĐŝĂůWĂƌĐĞůdĂǆ ϬϮϮϴϮϮϮϵϬϲ>KE/^h/>/E'͕>>ϬϬϳϯϮϯͲΨ ϳϰϲ͘ϬϴϬϯͬϬϮͬϮϬϮϮ ϲϬϴϳϵϳϬϭϭ͘ϭϬϰϵ͘ϱϮϬϬϬϬ Ψ ϭϮ͘Ϯϳ >ŽĐŬΘ<ĞǇ^ĞƌǀŝĐĞƐ ϯϭϱϱϮ>/E>K<Θ<z^Zs/ϬϬϬϯϱϮͲΨ ϭϮ͘ϮϳϬϯͬϬϮͬϮϬϮϮ ϲϬϴϳϵϴϬϮϬ͘ϭϬϴϰ͘ϱϵϱϮϬϬ Ψ ϯ͕ϵϰϬ͘ϭϱ dŝƚůĞϮϮDŽŶŝƚŽƌŝŶŐ ϭϮϮϭϬϬϬϰEdZ>^/EtdZ^^Kd/KEϬϬϭϵϭϳͲΨ ϯ͕ϵϰϬ͘ϭϱϬϯͬϬϮͬϮϬϮϮ ϲϬϴϳϵϵϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϲϱ͘ϭϵ ^ĞŶƐŽƌΕ ϴϯϭϳϭ Ϭϭϭ͘ϬϬϭϱϭϮϯEdZ>&KZϬϬϰϭϲϯͲϬϭϭ͘ϭϬϰϲ͘ϱϵϬϬϬϬ Ψ ϭϴϱ͘ϬϬ >ĂďŽƌƚŽZĞƉůĂĐĞdWD^ΘZĞĐĂůŝďƌĂƚĞ ϴϯϭϳϭϬϭϭ͘ϬϬϭϱϭϮϯϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϲ͘ϲϴ ^ĂůĞƐdĂǆϭϬ͘Ϯϱ ϴϯϭϳϭΨ Ϯϱϲ͘ϴϳϬϯͬϬϮͬϮϬϮϮ ϲϬϴϴϬϬϬϭϭ͘ϭϬϰϵ͘ϱϵϬϬϬϬ Ψ ϯϭϰ͘ϬϬ tĂƚĞƌdƌĞĂƚŵĞŶƚ^ĞƌǀŝĐĞ ϲϴϯϱϲϭ,DWZK>͕/EϬϬϭϬϵϱͲΨ ϯϭϰ͘ϬϬϬϯͬϬϮͬϮϬϮϮ ϲϬϴϴϬϭϬϱϱ͘ϵϭϬϬ͘ϱϵϬϭϭϬ Ψ ϭ͕ϭϴϳ͘ϱϬ ϭ͘'ĞŶĞƌĂů,ĂƌĚǁĂƌĞƌƚƐͲĂƐƉͲĂĐĐΕ ϮϭϳϬ Ϭϱϱ͘ϬϬϬϮϴϳϱKE'Zh/d/sϬϬϲϭϯϭͲϬϱϱ͘ϵϭϬϬ͘ϱϵϬϭϭϬ Ψ ϭϮϭ͘ϳϮ ^ĂůĞƐdĂǆϭϬ͘Ϯϱ ϮϭϳϬΨ ϭ͕ϯϬϵ͘ϮϮϬϯͬϬϮͬϮϬϮϮ ϲϬϴϴϬϮϬϱϱ͘ϵϬϬϬ͘ϱϮϬϬϬϬ Ψ ϯϳϯ͘Ϭϲ KĸĐĞ&ƵƌŶŝƚƵƌĞ ϭϮϯϬϯϰ/EΘZK&&/tKZ<^͕/EϬϬϭϬϮϳͲΨ ϯϳϯ͘ϬϲϬϯͬϬϮͬϮϬϮϮ ϲϬϴϴϬϯWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϯϰŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮZ>z,<^sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEd,<EhDZWzDEddϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϭϳϳ͘ϬϬ tĂƚĞƌWƵŵƉΕ ϯϭϰϵϮ Ϭϭϭ͘ϬϬϭϱϭϯϬhdK'ZKhW͕>>ϬϬϬϲϲϳͲϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϭϵ͘ϵϱ ZĂĚŝĂƚŽƌǇͲWĂƐƐ,ŽƐĞ ϯϭϰϵϮ Ϭϭϭ͘ϬϬϭϱϭϯϬϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϳ͘ϳϰ EĞǁ,ŽƐĞůĂŵƉƐ ϯϭϰϵϮ Ϭϭϭ͘ϬϬϭϱϭϯϬϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϭϮϯ͘ϳϱ ŶƟ&ƌĞĞǌĞ ϯϭϰϵϮ Ϭϭϭ͘ϬϬϭϱϭϯϬϬϭϭ͘ϭϬϰϲ͘ϱϵϬϬϬϬ Ψ ϳϮϬ͘ϬϬ >ĂďŽƌƚŽ/ŶƐƚĂůůtĂƚĞƌWƵŵƉΘZĞͲƚĂƉ ϯϭϰϵϮϬϭϭ͘ϬϬϭϱϭϯϬϬϭϭ͘ϭϬϰϲ͘ϱϵϬϬϬϬ Ψ ϳ͘ϬϬ ,ĂǌĂƌĚŽƵƐDĂƚĞƌŝĂůƐ ϯϭϰϵϮ Ϭϭϭ͘ϬϬϭϱϭϯϬϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϯϯ͘ϲϳ ^ĂůĞƐdĂǆϭϬ͘Ϯϱ ϯϭϰϵϮΨ ϭ͕Ϭϴϵ͘ϭϭϬϯͬϬϮͬϮϬϮϮ ϲϬϴϴϬϰϬϱϲ͘ϱϲϬϬ͘ϱϵϲϮϬϬ Ψ Ϯ͕ϯϳϳ͘ϬϬ KYZĞŶĞǁĂůΕ ϬϬϬϬϰϴϮEZ'ztKZ>Ed͕/EϬϬϰϳϲϮͲΨ Ϯ͕ϯϳϳ͘ϬϬϬϯͬϬϮͬϮϬϮϮ ϲϬϴϴϬϱϬϭϭ͘ϭϬϰϵ͘ϱϵϬϬϬϬ Ψ ϲϬϯ͘ϬϬ WƌĞǀĞŶƚĂƟǀĞDĂŝŶƚĞŶĂŶĐĞ ϳϮϭϬϲ&/>/d/^WZKdd/KE^z^dD^ϬϬϯϰϮϯͲΨ ϲϬϯ͘ϬϬϬϯͬϬϮͬϮϬϮϮ ϲϬϴϴϬϲϬϭϭ͘ϭϬϮϲ͘ϱϬϮϬϯϭ Ψ ϯϬ͘ϬϬ DĞĚŝĐĂů^ĞƌǀŝĐĞƐͬ͘DĂůŬĞŶŚŽƌƐƚ ϭϮϭϯϮϭ,K'ϬϬϬϱϴϰͲΨ ϯϬ͘ϬϬϬϯͬϬϮͬϮϬϮϮ ϲϬϴϴϬϳϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϭϳ͘ϬϬ WĂƌƚƐ ϭϳϱϴϬ Ϭϭϭ͘ϬϬϭϱϭϮϰ:Θ,hdKKzϬϬϯϭϮϮͲϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϮϬϬ͘ϲϬ WĂŝŶƚΘDĂƚĞƌŝĂů ϭϳϱϴϬ Ϭϭϭ͘ϬϬϭϱϭϮϰϬϭϭ͘ϭϬϰϲ͘ϱϵϬϬϬϬ Ψ Ϯϴϯ͘ϮϬ WĂŝŶƚ>ĂďŽƌ ϭϳϱϴϬ Ϭϭϭ͘ϬϬϭϱϭϮϰϬϭϭ͘ϭϬϰϲ͘ϱϵϬϬϬϬ Ψ ϴϬϲ͘ϰϬ ŽĚǇ^ŚŽƉ>ĂďŽƌ ϭϳϱϴϬ Ϭϭϭ͘ϬϬϭϱϭϮϰϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϮϮ͘ϯϬ ^ĂůĞƐdĂǆϭϬ͘Ϯϱ ϭϳϱϴϬΨ ϭ͕ϯϮϵ͘ϱϬϬϯͬϬϮͬϮϬϮϮ ϲϬϴϴϬϴWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϯϱŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮZ>z,<^sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEd,<EhDZWzDEddϬϱϱ͘ϴϭϬϬ͘ϱϳϬϬϬϬ Ψ ϭϬ͘ϬϬ ĂƌΘdƌƵĐŬtĂƐŚ^ĞƌǀŝĐĞƐΕ ϭϭϲϲ Ϭϱϱ͘ϬϬϬϮϵϬϰDztKKZt^,ϬϬϬϴϳϬͲΨ ϭϬ͘ϬϬϬϯͬϬϮͬϮϬϮϮ ϲϬϴϴϬϵϬϭϭ͘ϭϬϰϴ͘ϱϵϬϬϬϬ Ψ ϯϰϮ͘ϯϬ &ŝŶŝƐŚĞĚΘ/ŶƐƚĂůůĞĚŽƵďůĞͲWĂŶĞtŝŶĚŽǁ ϭϲϳϴϰDKEd>>K'>^^ΘD/ZZKZK͘ϬϬϱϳϴϬͲΨ ϯϰϮ͘ϯϬϬϯͬϬϮͬϮϬϮϮ ϲϬϴϴϭϬϬϱϱ͘ϵϭϬϬ͘ϱϵϬϭϭϬ Ψ ϳ͕ϵϭϮ͘ϬϬ dWΕ ϲϵϱϱϬ/E Ϭϱϱ͘ϬϬϬϮϵϰϭKWZd/KEd,EK>K'z͕/EϬϬϮϲϭϳͲΨ ϳ͕ϵϭϮ͘ϬϬϬϯͬϬϮͬϮϬϮϮ ϲϬϴϴϭϭϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϮϬ͘ϴϮ WĂŝŶƚΘ,ǇĚƌŽĐůŽƌŝĐĐŝĚ ϯϬϮϰϱϲϱ Ϭϭϭ͘ϬϬϭϱϬϴϯKZKKΖ^hdK^Zs//EϬϬϳϯϬϬͲϬϭϭ͘ϭϬϰϲ͘ϱϵϬϬϬϬ Ψ ϲϳϭ͘ϬϬ >ĂďŽƌƚŽĐŝĚ&ůƵƐŚKƵƚ&ƵĞůdĂŶŬΘ ϯϬϮϰϱϲϱ Ϭϭϭ͘ϬϬϭϱϬϴϯϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ Ϯ͘ϭϯ ^ĂůĞƐdĂǆϭϬ͘Ϯϱ ϯϬϮϰϱϲϱΨ ϲϵϯ͘ϵϱϬϯͬϬϮͬϮϬϮϮ ϲϬϴϴϭϮϬϭϭ͘ϭϬϰϵ͘ϱϵϬϬϬϬ Ψ ϭϲϵ͘ϬϬ WůƵŵďŝŶŐDĂŝŶƚĞŶĂŶĐĞ^ĞƌǀŝĐĞƐ ϭϯϬϳϯYh>/dz:dZKKdZ͕/EϬϬϰϰϱϭͲΨ ϭϲϵ͘ϬϬϬϯͬϬϮͬϮϬϮϮ ϲϬϴϴϭϯϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϴϯ͘ϳϰ ĂƌďƵƌĂƚŽƌZĞďƵŝůĚ<ŝƚ ϯϵϳϮϰ Ϭϭϭ͘ϬϬϭϱϭϮϱ^ΘE'/E͕/EϬϬϭϲϴϱͲϬϭϭ͘ϭϬϰϲ͘ϱϵϬϬϬϬ Ψ ϭϳϬ͘ϬϬ >ĂďŽƌƚŽZĞďƵŝůĚĂƌďƵƌĂƚŽƌ ϯϵϳϮϰ Ϭϭϭ͘ϬϬϭϱϭϮϱϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϴ͘ϱϴ ^ĂůĞƐdĂǆϭϬ͘Ϯϱ ϯϵϳϮϰϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϮϮϱ͘ϲϰ EĞǁĂƌďƵƌĞƚŽƌΕ ϱϬϱϭϯ Ϭϭϭ͘ϬϬϭϱϭϮϲϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ Ϯϯ͘ϭϯ ^ĂůĞƐdĂǆϭϬ͘Ϯϱ ϱϬϱϭϯΨ ϱϭϭ͘ϬϵϬϯͬϬϮͬϮϬϮϮ ϲϬϴϴϭϰWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϯϲŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮZ>z,<^sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEd,<EhDZWzDEddϬϭϭ͘ϭϬϰϯ͘ϱϮϬϬϬϬ Ψ ϴϵ͘ϬϬ ƵƐŝŶĞƐƐĂƌĚƐͲǁŝŐŚƚWŝĞƌĐĞΕ Ϯϳϯϴϭ Ϭϭϭ͘ϬϬϭϱϭϲϲ^/>sΖ^WZ/Ed/E'EdtKZ<ϬϬϯϳϳϱͲϬϭϭ͘ϭϬϰϯ͘ϱϮϬϬϬϬ Ψ ϵ͘ϭϮ ^ĂůĞƐdĂǆϭϬ͘Ϯϱ ϮϳϯϴϭΨ ϵϴ͘ϭϮϬϯͬϬϮͬϮϬϮϮ ϲϬϴϴϭϱϬϱϱ͘ϵϭϬϬ͘ϵϬϬϬϬϬ Ψ ϯϬ͕ϬϬϬ͘ϬϬ ĚǀĂŶĐĞWĂǇŵĞŶƚĨŽƌ/ŵƉĂĐƚ^ƚƵĚǇΕ ϳϱϵϬϰϭϭϴϳϰ^K>/^KEϬϬϬϬϱϵͲΨ ϯϬ͕ϬϬϬ͘ϬϬϬϯͬϬϮͬϮϬϮϮ ϲϬϴϴϭϲϬϭϭ͘ϭϬϮϰ͘ϱϵϯϮϬϬ Ψ ϲ͕ϴϰϮ͘ϵϲ ZĞ͗:ĞƌƌǇŚĂǀĞǌǀ͘ŝƚǇŽĨsĞƌŶŽŶΕ Ϯϭϴϳϰ^dZD</D,/<^tZ'Θ>&ZϬϬϲϰϯϴͲΨ ϲ͕ϴϰϮ͘ϵϲϬϯͬϬϮͬϮϬϮϮ ϲϬϴϴϭϳϬϭϭ͘ϭϬϰϵ͘ϵϬϬϬϬϬ Ψ ϯ͕ϳϵϬ͘ϬϬ WƌŽĨĞƐƐŝŽŶĂů^ĞƌǀŝĐĞƐ ϱϭϴϱϮϬϱϴddZd,͕/E͘ϬϬϮϯϱϴͲΨ ϯ͕ϳϵϬ͘ϬϬϬϯͬϬϮͬϮϬϮϮ ϲϬϴϴϭϴϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ Ϯϵϱ͘ϬϬ dŝƌĞƐΕ ϮϱϭϯϬϱϵϵ Ϭϭϭ͘ϬϬϭϱϬϴϬd/Z,h͕>>ϬϬϲϯϳϭͲϬϭϭ͘ϭϬϰϲ͘ϱϵϬϬϬϬ Ψ ϴ͘ϳϱ ^ƚĂƚĞdŝƌĞ&ĞĞ ϮϱϭϯϬϱϵϵ Ϭϭϭ͘ϬϬϭϱϬϴϬϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ Ϯϴ͘Ϭϯ ^ĂůĞƐdĂǆϵ͘ϱй ϮϱϭϯϬϱϵϵΨ ϯϯϭ͘ϳϴϬϯͬϬϮͬϮϬϮϮ ϲϬϴϴϭϵϬϭϭ͘ϭϬϰϯ͘ϱϮϬϬϬϬ Ψ ϯ͕ϰϬϬ͘ϬϬ ƐƉŚĂůƚWĂƚĐŚΕ Z/ϮϬϭϲϲϵϲϲ Ϭϭϭ͘ϬϬϭϱϭϮϬdZE,^,KZ/E'KDWEzϬϬϭϴϰϳͲϬϭϭ͘ϭϬϰϯ͘ϱϮϬϬϬϬ Ψ ϭϱϬ͘ϬϬ &ƌĞŝŐŚƚ Z/ϮϬϭϲϲϵϲϲ Ϭϭϭ͘ϬϬϭϱϭϮϬϬϭϭ͘ϭϬϰϯ͘ϱϮϬϬϬϬ Ψ ϯϰϴ͘ϱϬ ^ĂůĞƐdĂǆϭϬ͘Ϯϱ Z/ϮϬϭϲϲϵϲϲΨ ϯ͕ϴϵϴ͘ϱϬϬϯͬϬϮͬϮϬϮϮ ϲϬϴϴϮϬWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϯϳŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮZ>z,<^sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEd,<EhDZWzDEddϬϭϭ͘ϭϬϬϰ͘ϱϮϬϬϬϬ Ψ ϰϲϮ͘ϲϬ DĞŶ͛ƐŶĚƵƌĂŶĐĞ:ĂĐŬĞƚKϳϮϬΕ ϯϬϱϮϱϭϵϯϵϲ Ϭϭϭ͘ϬϬϭϱϬϵϮhE/&/Z^dKZWKZd/KEϬϬϱϮϵϲͲϬϭϭ͘ϭϬϬϰ͘ϱϮϬϬϬϬ Ψ ϯϴϱ͘ϱϬ tŽŵĞŶ͛ƐŶĚƵƌĂŶĐĞ:ĂĐŬĞƚ>KϳϮϬΕ ϯϬϱϮϱϭϵϯϵϲ Ϭϭϭ͘ϬϬϭϱϬϵϮϬϭϭ͘ϭϬϬϰ͘ϱϮϬϬϬϬ Ψ ϴϲ͘ϵϯ ^ĂůĞƐdĂǆϭϬ͘Ϯϱ ϯϬϱϮϱϭϵϯϵϲΨ ϵϯϱ͘ϬϯϬϯͬϬϮͬϮϬϮϮ ϲϬϴϴϮϭϬϭϭ͘ϭϬϰϵ͘ϱϮϬϬϬϬ Ψ ϳϲϵ͘ϴϵ WĂƉĞƌƵƉƐΕ tϳϲϰϰϬϬϬ Ϭϭϭ͘ϬϬϭϱϭϱϵsZEKE^E/dZz^hWW>zKϬϬϭϯϵϵͲϬϭϭ͘ϭϬϰϵ͘ϱϮϬϬϬϬ Ψ ϳϯ͘ϭϰ ^ĂůĞƐdĂǆϭϬ͘Ϯϱ tϳϲϰϰϬϬϬΨ ϴϰϯ͘ϬϯϬϯͬϬϮͬϮϬϮϮ ϲϬϴϴϮϮϬϭϭ͘ϭϬϰϬ͘ϰϬϬϵϬϬ Ψ ϱ͕Ϭϲϱ͘ϱϬ WĂƌƟĂů^ƉĞĐŝĂůWĂƌĐĞůdĂǆZĞĨƵŶĚΕ ϬϯϬϮϮϮϰϲϮϯ,DWdKE͕>>ϬϬϳϯϮϰͲΨ ϱ͕Ϭϲϱ͘ϱϬϬϯͬϬϯͬϮϬϮϮ ϲϬϴϴϮϯϬϱϱ͘ϵϭϵϬ͘ϱϲϬϬϭϬ Ψ Ϯϯϭ͘ϰϭ WĞƌŝŽĚ͗ϭϮͬϭϭͬϮϭͲϬϭͬϭϬͬϮϮ ϬϭϭϭϮϮdΘdϬϬϭϵϰϴͲΨ Ϯϯϭ͘ϰϭϬϯͬϬϴͬϮϬϮϮ ϲϬϴϴϮϰϬϱϱ͘ϭϳϬϮϬϬ Ψ ϯ͕ϴϵϱ͘ϬϬ d/ŶůĞƚŝƌWƌĞͲ&ŝůƚĞƌ ϭϴϵϵϭsE&/>dZd/KEKEWd^ϬϬϮϬϬϬͲΨ ϯ͕ϴϵϱ͘ϬϬϬϯͬϬϴͬϮϬϮϮ ϲϬϴϴϮϱϬϱϱ͘ϭϳϬϮϬϬ Ψ ϰϲϱ͘ϬϬ ŝƐƉŽƐĂů^ĞƌǀŝĐĞƐ /ϱϬϬϬϬϳϴϭϳϬϬ^hZzEs/ZKEDEd>^Zs/^ϬϬϮϯϬϴͲϬϱϱ͘ϭϳϬϮϬϬ Ψ Ϯ͕ϮϯϮ͘ϵϬ ŝƐƉŽƐĂů^ĞƌǀŝĐĞƐ /ϱϬϬϬϬϳϴϱϱϳϱΨ Ϯ͕ϲϵϳ͘ϵϬϬϯͬϬϴͬϮϬϮϮ ϲϬϴϴϮϲϬϱϱ͘ϭϳϬϮϬϬ Ψ ϮϮϴ͘ϭϴ WĞƌŝŽĚ͗ϭϭͬϮϳͬϮϭƚŽϭϮͬϮϲͬϮϭ ϭϮϭϭϮϭdΘdϬϬϭϵϰϴͲΨ ϮϮϴ͘ϭϴϬϯͬϬϴͬϮϬϮϮ ϲϬϴϴϮϳWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϯϴŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮZ>z,<^sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEd,<EhDZWzDEddϬϱϱ͘ϭϳϬϮϬϬ Ψ ϭ͕ϳϴϲ͘ϰϵ ^ĞĂŵůĞƐƐWŝƉĞ ϭϱϳϭϯϴh>W/Wdh/E'Θ^d>͕/EϬϬϭϳϭϳͲΨ ϭ͕ϳϴϲ͘ϰϵϬϯͬϬϴͬϮϬϮϮ ϲϬϴϴϮϴϬϱϱ͘ϭϳϬϮϬϬ Ψ ϲ͕ϯϴϳ͘ϳϲ ^ĐĂīŽůĚ^ĞƌǀŝĐĞƐ ϭϰ<ϯϭϴϮϵZE^&&K>^Zs/^͕/EϬϬϳϯϭϱͲΨ ϲ͕ϯϴϳ͘ϳϲϬϯͬϬϴͬϮϬϮϮ ϲϬϴϴϮϵϬϱϱ͘ϭϳϬϮϬϬ Ψ ϵϭϭ͘ϲϲ ^ĐĂīŽůŝŶŐ ϲϬϳϮͲϭϮϲϮϮϱZE^&tz^Zs/^>>ϳϮϬϬϳϯϮϱͲϬϱϱ͘ϭϳϬϮϬϬ Ψ ϭϳϳ͘ϳϳ ^ĐĂīŽůĚŝŶŐ ϳϮZϭϮϲϭϭϮΨ ϭ͕Ϭϴϵ͘ϰϯϬϯͬϬϴͬϮϬϮϮ ϲϬϴϴϯϬϬϱϱ͘ϭϳϬϮϬϬ Ψ ϵϲ͕Ϭϯϯ͘Ϭϰ tĂƚĞƌ^ĞƌǀŝĐĞΕ ϮϵϬϮϳϯϭ/dzK&sZEKEϬϬϯϬϬϲͲϬϱϱ͘ϭϳϬϮϬϬ Ψ Ϯϰϵ͘ϮϬ tĂƚĞƌ^ĞƌǀŝĐĞƐΕ ϮϵϬϮϳϯϮϬϱϱ͘ϭϳϬϮϬϬ Ψ ϭ͕ϲϲϰ͘ϯϵ tĂƚĞƌ^ĞƌǀŝĐĞƐΕ ϮϵϬϮϴϰϱΨ ϵϳ͕ϵϰϲ͘ϲϯϬϯͬϬϴͬϮϬϮϮ ϲϬϴϴϯϭϬϱϱ͘ϭϳϬϮϬϬ Ψ ϭϮϬ͘ϬϬ YƵĂƌƚĞƌůǇDŽŶŝƚŽƌŝŶŐ ϭϬϬϬϱϰϰϳϭϲK^K&/ZWZKdd/KE͕/EϬϬϳϯϮϲͲϬϱϱ͘ϭϳϬϮϬϬ Ψ ϭ͕ϯϮϬ͘ϬϬ ^ĞŵŝͲŶŶƵĂů/ŶƐƉĞĐƟŽŶ ϭϬϬϬϱϰϱϮϲϭϬϱϱ͘ϭϳϬϮϬϬ Ψ ϭ͕ϭϴϳ͘ϱϱ ŶŶƵĂů&ŝƌĞWƵŵƉ/ŶƐƉĞĐƟŽŶZĞƉĂŝƌƐ ϭϬϬϬϱϰϱϱϳϳΨ Ϯ͕ϲϮϳ͘ϱϱϬϯͬϬϴͬϮϬϮϮ ϲϬϴϴϯϮϬϱϱ͘ϭϳϬϮϬϬ Ψ ϱϬ͘ϳϮ tĞůĚŝŶŐ^ƵƉƉůŝĞƐ ϲϰϮϵϲϭZ/'t>/E'^hWW>z͕KϬϬϬϯϭϬͲΨ ϱϬ͘ϳϮϬϯͬϬϴͬϮϬϮϮ ϲϬϴϴϯϯWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϯϵŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮZ>z,<^sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEd,<EhDZWzDEddϬϱϱ͘ϭϳϬϮϬϬ Ψ ϴ͕Ϯϳϴ͘ϬϬ ^ƚĞĂŵƌƵŵWŝƉŝŶŐ ϳϬϰϱϰϭϮ/Eh^dZ/>^Zs/^͕>>ϬϬϳϮϳϯͲΨ ϴ͕Ϯϳϴ͘ϬϬϬϯͬϬϴͬϮϬϮϮ ϲϬϴϴϯϰϬϱϱ͘ϭϳϬϮϬϬ Ψ ϳϰϱ͘ϬϬ ŝƐƉŽƐĂů^ĞƌǀŝĐĞƐ ϭϱϳϴϭϭ/Zd/^WK^>ϬϬϳϯϮϳͲΨ ϳϰϱ͘ϬϬϬϯͬϬϴͬϮϬϮϮ ϲϬϴϴϯϱϬϱϱ͘ϭϳϬϮϬϬ Ψ ϲ͕ϭϯϱ͘Ϭϭ ZĞƉůĂĐĞŵĞŶƚ&ŝƌĞǇĞ^ĐĂŶŶĞƌ^ǇƐƚĞŵ ZϭϬϳϭϬϴ'KZ'd͘,>>K͕/EϬϬϮϵϰϬͲΨ ϲ͕ϭϯϱ͘ϬϭϬϯͬϬϴͬϮϬϮϮ ϲϬϴϴϯϲϬϱϱ͘ϭϳϬϮϬϬ Ψ ϭϰϴ͘ϯϬ ^ƵƉƉůŝĞƐ ϵϭϰϲϰϴϯϵϯϵ'Z/E'Z͕KϬϬϭϳϭϮͲϬϱϱ͘ϭϳϬϮϬϬ Ψ ϭ͕Ϯϲϴ͘ϭϳ ^ƵƉƉůŝĞƐ ϵϭϰϴϯϯϳϴϳϳΨ ϭ͕ϰϭϲ͘ϰϳϬϯͬϬϴͬϮϬϮϮ ϲϬϴϴϯϳϬϱϱ͘ϭϳϬϮϬϬ Ψ Ϯϲϭ͘ϱϰ WŽĐŬĞƚŽůŽƌŝŵĞƚĞƌƐ ϭϮϳϰϬϲϴϲ,,KDWEzϬϬϭϯϱϱͲΨ Ϯϲϭ͘ϱϰϬϯͬϬϴͬϮϬϮϮ ϲϬϴϴϯϴϬϱϱ͘ϭϳϬϮϬϬ Ψ Ϯ͕ϭϵϵ͘ϱϬ ^ŵĂůůdŽŽůƐΘWůƵŵďŝŶŐ,ĂƌĚǁĂƌĞ ϭϮϭϯϮϭ,KDWKdZ/d^Zs/^ϬϬϭϱϱϮͲΨ Ϯ͕ϭϵϵ͘ϱϬϬϯͬϬϴͬϮϬϮϮ ϲϬϴϴϯϵϬϱϱ͘ϭϳϬϮϬϬ Ψ ϭ͕ϭϰϱ͘ϬϬ ƌŝǀĞZĞƉĂŝƌ ϭϭϭϰϬϱϯ&h&dKZ^ϬϬϳϯϮϴͲΨ ϭ͕ϭϰϱ͘ϬϬϬϯͬϬϴͬϮϬϮϮ ϲϬϴϴϰϬϬϱϱ͘ϭϳϬϮϬϬ Ψ Ϯϳϯ͘ϳϲ ^ƵƉƉůŝĞƐ ϴϮϳϱϲ:Θ^/Zh/dZ<Z^͕/EϬϬϳϯϮϵͲΨ Ϯϳϯ͘ϳϲϬϯͬϬϴͬϮϬϮϮ ϲϬϴϴϰϭWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϰϬŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮZ>z,<^sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEd,<EhDZWzDEddϬϱϱ͘ϭϳϬϮϬϬ Ψ ϯ͕ϯϱϵ͘ϳϱ WƌŽĨĞƐƐŝŽŶĂů^ĞƌǀŝĐĞƐ Ϯϰϭϳϱϴ<^dZ>WKtZE'/EZ/E'͕>>ϬϬϳϯϯϬͲϬϱϱ͘ϭϳϬϮϬϬ Ψ ϲ͕ϴϴϴ͘ϯϴ WƌŽĨĞƐƐŝŽŶĂů^ĞƌǀŝĐĞƐ ϮϱϬϯϱϵΨ ϭϬ͕Ϯϰϴ͘ϭϯϬϯͬϬϴͬϮϬϮϮ ϲϬϴϴϰϮϬϱϱ͘ϭϳϬϮϬϬ Ψ ϭϯϯ͘ϴϭ ,ĂƌĚǁĂƌĞ^ƵƉƉůŝĞƐ ϱϬϱϰϭϬϮϭDD^dZͲZZ^hWW>zKDWEzϬϬϭϭϱϬͲϬϱϱ͘ϭϳϬϮϬϬ Ψ ϮϮ͘Ϯϱ ,ĂƌĚǁĂƌĞ^ƵƉƉůŝĞƐ ϱϬϱϰϵϲϰϲϬϱϱ͘ϭϳϬϮϬϬ Ψ Ϯϵϲ͘ϳϭ ,ĂƌĚǁĂƌĞ^ƵƉƉůŝĞƐ ϱϬϲϲϯϰϵϵϬϱϱ͘ϭϳϬϮϬϬ Ψ ϭϭϯ͘ϳϬ ,ĂƌĚǁĂƌĞ^ƵƉƉůŝĞƐ ϱϬϲϲϵϵϰϵϬϱϱ͘ϭϳϬϮϬϬ Ψ ϲϭϱ͘ϲϭ ,ĂƌĚǁĂƌĞ^ƵƉƉůŝĞƐ ϲϳϳϰϰϭϯϲϬϱϱ͘ϭϳϬϮϬϬ Ψ ϲϱ͘ϵϳ ,ĂƌĚǁĂƌĞ^ƵƉƉůŝĞƐ ϲϵϲϯϰϰϱϳΨ ϭ͕Ϯϰϴ͘ϬϱϬϯͬϬϴͬϮϬϮϮ ϲϬϴϴϰϯϬϱϱ͘ϭϳϬϮϬϬ Ψ Ϯ͕ϲϮϰ͘ϴϲ ŝƐƉŽƐĂů^ĞƌǀŝĐĞƐ ϮϮϰϳϮD^Es/ZKEDEd>^Zs/^͕/ϬϬϳϮϴϬͲΨ Ϯ͕ϲϮϰ͘ϴϲϬϯͬϬϴͬϮϬϮϮ ϲϬϴϴϰϰϬϱϱ͘ϭϳϬϮϬϬ Ψ Ϯ͕ϯϴϴ͘ϳϬ d^d/E'^Zs/^ ϭϭϮϵϯϳϮϱD/^dZ^Ͳ/DWZKϬϬϰϲϭϮͲΨ Ϯ͕ϯϴϴ͘ϳϬϬϯͬϬϴͬϮϬϮϮ ϲϬϴϴϰϱϬϱϱ͘ϭϳϬϮϬϬ Ψ Ϯϭϰ͘ϭϵ DŽŶƚŚůǇŚĞŵŝĐĂůhƐĂŐĞ ϲϲϳϬϭϳϲϬϱϲE>KKDWEz>>ϬϬϳϯϮϭͲϬϱϱ͘ϭϳϬϮϬϬ Ψ Ϯϰ͕ϯϬϵ͘ϳϭ WŚŽƐƉŚŽƌŝĐĐŝĚ^ŽůƵƟŽŶ ϲϲϳϬϭϴϳϯϴϭΨ Ϯϰ͕ϱϮϯ͘ϵϬϬϯͬϬϴͬϮϬϮϮ ϲϬϴϴϰϲWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϰϭŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮZ>z,<^sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEd,<EhDZWzDEddϬϱϱ͘ϭϳϬϮϬϬ Ψ ϱ͕ϮϮϰ͘ϵϱ WŽůǇƉŽƉǇůĞŶĞDĞůƚůŽǁŶ&ŝůƚĞƌ ϳϯϮϭϮWhZWZK^^&/>dZd/KE͕/EϬϬϳϮϱϮͲϬϱϱ͘ϭϳϬϮϬϬ Ψ ϭ͕ϲϮϲ͘ϭϱ ,ǇƉƌŽ&ŝůƚĞƌůĞŵĞŶƚ ϳϯϳϮϯΨ ϲ͕ϴϱϭ͘ϭϬϬϯͬϬϴͬϮϬϮϮ ϲϬϴϴϰϳϬϱϱ͘ϭϳϬϮϬϬ Ψ ϳϰϲ͘ϳϭ ƌŝŶŬŝŶŐtĂƚĞƌ^ĞƌǀŝĐĞ ϭϭ>ϬϬϯϬϲϳϯϳϭϵZz&Z^,ϬϬϳϯϯϮͲΨ ϳϰϲ͘ϳϭϬϯͬϬϴͬϮϬϮϮ ϲϬϴϴϰϴϬϱϱ͘ϭϳϬϮϬϬ Ψ ϯ͕ϱϰϬ͘ϬϬ WƌĞǀĞŶƟǀĞDĂŝŶƚĞŶĂŶĐĞdĞƐƟŶŐ ϮϬϮϭϭϮϲϳZ,/EKKE^dZhd/KE^Zs/^ϬϬϮϬϱϲͲϬϱϱ͘ϭϳϬϮϬϬ Ψ ϴ͕ϮϰϬ͘ϬϬ WƌĞǀĞŶƟǀĞDĂŝŶƚĞŶĂŶĐĞdĞƐƟŶŐ ϮϬϮϭϭϮϲϴΨ ϭϭ͕ϳϴϬ͘ϬϬϬϯͬϬϴͬϮϬϮϮ ϲϬϴϴϰϵϬϱϱ͘ϭϳϬϮϬϬ Ψ ϴ͕ϴϰϰ͘ϭϯ ^ƵƉƉůŝĞƐ Ϯϯϭϭϱ^,ZKZs>sΘZW/Z/EϬϬϳϯϭϳͲϬϱϱ͘ϭϳϬϮϬϬ Ψ ϭ͕ϵϱϬ͘ϬϬ ŽŶƚƌŽůsĂůǀĞ ϮϯϭϮϲΨ ϭϬ͕ϳϵϰ͘ϭϯϬϯͬϬϴͬϮϬϮϮ ϲϬϴϴϱϬϬϱϱ͘ϭϳϬϮϬϬ Ψ ϰϬ͕ϱϬϬ͘ϬϬ /ŶƐƚĂůů/ƌŝƐWĂƌƟĂůŝƐĐŚĂƌŐĞ ϮϱϬϯϮϬϬϱϰdϬϬϳϮϵϰͲΨ ϰϬ͕ϱϬϬ͘ϬϬϬϯͬϬϴͬϮϬϮϮ ϲϬϴϴϱϭϬϱϱ͘ϭϳϬϮϬϬ Ψ ϭ͕Ϯϳϵ͘ϴϬ ,W^ƚĞĂŵƌƵŵWŝƉŝŶŐZĞƉůĂĐĞŵĞŶƚ ϯϰϯϵϬϬdKd>Ͳt^dZE͕/EϬϬϳϮϳϱͲϬϱϱ͘ϭϳϬϮϬϬ Ψ ϭϭ͕Ϯϯϰ͘ϳϬ >W^ƚĞĂŵƌƵŵWŝƉŝŶŐZĞƉůĂĐĞŵĞŶƚ ϯϰϰϭϯϲϬϱϱ͘ϭϳϬϮϬϬ Ψ ϭϭ͕ϯϵϲ͘ϮϮ ,W^ƚĞĂŵƌƵŵWŝƉŝŶŐZĞƉůĂĐĞŵĞŶƚ ϯϰϰϭϯϳϬϱϱ͘ϭϳϬϮϬϬ Ψ ϭ͕ϮϬϯ͘ϰϬ ,W^ƚĞĂŵƌƵŵWŝƉŝŶŐZĞƉůĂĐĞŵĞŶƚ ϯϰϰϮϬϭϬϱϱ͘ϭϳϬϮϬϬ Ψ ϰ͕Ϭϰϰ͘ϭϱ ,Ɖ^ƚĞĂŵƌƵŵWŝƉŝŶŐZĞƉůĂĐĞŵĞŶƚ ϯϰϰϱϳϲΨ Ϯϵ͕ϭϱϴ͘ϮϳϬϯͬϬϴͬϮϬϮϮ ϲϬϴϴϱϮWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϰϮŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮZ>z,<^sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEd,<EhDZWzDEddϬϱϱ͘ϭϳϬϮϬϬ Ψ ϯ͕ϱϵϲ͘ϰϰ dƵƌďŝŶĞsĂůǀĞZĞƉĂĐŬ ϬϬϴϲϰϵϭ/EdhZ/EZW/Z^Zs/^>>ϬϬϳϯϯϭͲΨ ϯ͕ϱϵϲ͘ϰϰϬϯͬϬϴͬϮϬϮϮ ϲϬϴϴϱϯϬϭϭ͘ϭϬϯϭ͘ϱϵϲϱϬϬ Ψ ϮϮϳ͘Ϭϰ ĞŶƚƌĂů^ƋƵĂƌĞͲE''ͲKƌůĂŶĚŽϮϬϮϮ ϬϯϬϭϮϮKEE''Z^ϬϬϳϯϯϲͲΨ ϮϮϳ͘ϬϰϬϯͬϭϬͬϮϬϮϮ ϲϬϴϴϱϰϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϱϲϬ͘ϯϳ ůůZĞůĂǇƐ͕tŝƌĞƐ͕DŽƵŶƟŶŐƌĂĐŬĞƚƐΘ ϭϯϰϭϲ Ϭϭϭ͘ϬϬϭϱϭϮϳ/ZtsKDDhE/d/KE^EdZWZϬϬϰϬϮϲͲϬϭϭ͘ϭϬϰϲ͘ϱϵϬϬϬϬ Ψ ϭ͕ϯϯϵ͘ϬϬ >ĂďŽƌƚŽ/ŶƐƚĂůů>ŝŐŚƚďĂƌΘ>ŝŐŚƚƐ ϭϯϰϭϲϬϭϭ͘ϬϬϭϱϭϮϳϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϱϲ͘Ϭϰ ^ĂůĞƐdĂǆϭϬ͘ϬϬ ϭϯϰϭϲϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϱϯϰ͘ϵϭ Ϯ&ƌŽŶƚΘZĞĂƌ&ĂĐŝŶŐ>ŝŐŚƚƐ͕^ƚƌŽďĞƐ͕ ϭϯϰϭϳ Ϭϭϭ͘ϬϬϭϱϭϮϴϬϭϭ͘ϭϬϰϲ͘ϱϵϬϬϬϬ Ψ ϭ͕ϴϳϰ͘ϲϬ >ĂďŽƌΕ ϭϯϰϭϳ Ϭϭϭ͘ϬϬϭϱϭϮϴϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϱϯ͘ϰϵ ^ĂůĞƐdĂǆϭϬ͘ϬϬ ϭϯϰϭϳΨ ϰ͕ϰϭϴ͘ϰϭϬϯͬϭϬͬϮϬϮϮ ϲϬϴϴϱϱϬϭϭ͘ϵϬϭϵ͘ϱϵϬϭϭϬ Ψ ϭ͕ϵϳϵ͘ϰϬ WĞƌŝŽĚ͗ϭϬͬϭϵͬϮϭͲϭϭͬϭϴͬϮϭ ϰϴϲϵϬϮϳϲϬϭdΘdϬϬϭϵϰϴͲϬϭϭ͘ϵϬϭϵ͘ϱϵϬϭϭϬ Ψ ϭ͕ϵϲϮ͘ϰϬ WĞƌŝŽĚ͗ϬϭͬϭϵͬϮϮͲϬϮͬϭϴͬϮϮ ϴϴϭϰϯϲϴϲϬϲϬϭϭ͘ϵϬϭϵ͘ϱϵϬϭϭϬ Ψ ϭ͕ϵϲϮ͘ϰϬ WĞƌŝŽĚ͗ϭϮͬϭϵͬϮϭͲϬϭͬϭϴͬϮϮ ϵϴϴϴϭϰϳϲϬϰΨ ϱ͕ϵϬϰ͘ϮϬϬϯͬϭϬͬϮϬϮϮ ϲϬϴϴϱϲϬϭϭ͘ϵϬϭϵ͘ϱϲϬϬϭϬ Ψ ϰϲ͘Ϯϯ WĞƌŝŽĚ͗ϭϮͬϬϵͬϮϭͲϬϭͬϬϴͬϮϮ ϴϯϮϳϳϲϰϴϬyϬϭϭϭϲϮϬϮϮdΘdDK/>/dzϬϬϮϴϴϵͲΨ ϰϲ͘ϮϯϬϯͬϭϬͬϮϬϮϮ ϲϬϴϴϱϳWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϰϯŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮZ>z,<^sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEd,<EhDZWzDEddϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ Ϯϳϵ͘ϴϯ sĞŚŝĐůĞĂƩĞƌŝĞƐΕ ϳϯϱϱϬϰϱ Ϭϭϭ͘ϬϬϭϰϴϱϲddZz^z^dD^͕/EϬϬϰϰϰϴͲϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϴϮϱ͘Ϭϳ sĞŚŝĐůĞĂƩĞƌŝĞƐΕ ϳϯϲϵϯϮϰ Ϭϭϭ͘ϬϬϭϰϴϱϲΨ ϭ͕ϭϬϰ͘ϵϬϬϯͬϭϬͬϮϬϮϮ ϲϬϴϴϱϴϬϭϭ͘ϵϬϭϵ͘ϱϮϬϬϭϬ Ψ ϱϯϱ͘ϱϳ DĂŝŶƚĞŶĂŶĐĞΘZĞƉĂŝƌ ϱϮϵϱϵϯϭZKDϬϬϲϬϱϰͲΨ ϱϯϱ͘ϱϳϬϯͬϭϬͬϮϬϮϮ ϲϬϴϴϱϵϬϭϭ͘ϭϬϯϭ͘ϱϵϰϮϬϬ Ψ ϯϭϰ͘ϬϬ ,ĂǌĂƌĚŽƵƐtĂƐƚĞůĞĂŶŝŶŐ ϭϮϭϵ/KͲKE>KE',ϬϬϳϭϳϬͲΨ ϯϭϰ͘ϬϬϬϯͬϭϬͬϮϬϮϮ ϲϬϴϴϲϬϬϭϭ͘ϭϬϯϭ͘ϴϱϬϬϬϬ Ψ ϭϬ͕ϵϳϵ͘ϯϳ ŽŵƉůĞƚĞWĂƚƌŽůhŶŝƚŵĞƌŐĞŶĐǇ ϰϯϳϵ Ϭϭϭ͘ϬϬϭϱϬϴϲ><Θt,/dDZ'Ezs,/>ϬϬϱϯϲϲͲϬϭϭ͘ϭϬϯϭ͘ϴϱϬϬϬϬ Ψ ϯ͕ϯϲϬ͘ϬϬ >ĂďŽƌŚĂƌŐĞΕ ϰϯϳϵ Ϭϭϭ͘ϬϬϭϱϬϴϲϬϭϭ͘ϭϬϯϭ͘ϴϱϬϬϬϬ Ψ Ϯϵϴ͘ϯϱ &ƌĞŝŐŚƚ ϰϯϳϵ Ϭϭϭ͘ϬϬϭϱϬϴϲϬϭϭ͘ϭϬϯϭ͘ϴϱϬϬϬϬ Ψ ϭ͕ϭϮϱ͘ϯϵ ^ĂůĞƐdĂǆϭϬ͘Ϯϱ ϰϯϳϵΨ ϭϱ͕ϳϲϯ͘ϭϭϬϯͬϭϬͬϮϬϮϮ ϲϬϴϴϲϭϬϭϭ͘ϭϬϯϯ͘ϰϲϳϭϬϬ Ψ ϱϮ͘ϵϬ ŽůůĞĐƟŽŶ^ĞƌǀŝĐĞƐ ϲϲϳϱϯϳ/EΘt/EZKDWEz͕/EϬϬϰϵϯϱͲϬϭϭ͘ϭϬϯϯ͘ϰϲϳϭϬϬ Ψ ϯϬϲ͘ϵϬ ŽůůĞĐƟŽŶ^ĞƌǀŝĐĞƐ ϲϳϱϰϳϱΨ ϯϱϵ͘ϴϬϬϯͬϭϬͬϮϬϮϮ ϲϬϴϴϲϮWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϰϰŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮZ>z,<^sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEd,<EhDZWzDEddϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϭϵϭ͘ϴϰ ƵƚŽWĂƌƚƐΕ ϯϴϱϬϲϱ Ϭϭϭ͘ϬϬϭϰϴϱϵEdZ>&KZϬϬϰϭϲϯͲϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϰϱ͘ϰϬ ƵƚŽWĂƌƚƐΕ ϯϴϱϮϯϭ Ϭϭϭ͘ϬϬϭϰϴϱϵϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϯϰϵ͘ϰϬ ƵƚŽWĂƌƚƐΕ ϯϴϱϯϬϱ Ϭϭϭ͘ϬϬϭϰϴϱϵϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϯϬϯ͘ϰϲ ƵƚŽWĂƌƚƐΕ ϯϴϱϯϬϳ Ϭϭϭ͘ϬϬϭϰϴϱϵϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ Ϯϲϳ͘Ϯϱ ƵƚŽWĂƌƚƐΕ ϯϴϱϯϯϭ Ϭϭϭ͘ϬϬϭϰϴϱϵϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ Ͳϯϰϵ͘ϰϬ ƵƚŽWĂƌƚƐΕ ϯϴϱϯϱϭ Ϭϭϭ͘ϬϬϭϰϴϱϵϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϮϬϮ͘ϱϵ ƵƚŽWĂƌƚƐΕ ϯϴϱϯϳϮ Ϭϭϭ͘ϬϬϭϰϴϱϵϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϴϵ͘ϴϴ ƵƚŽWĂƌƚƐΕ ϯϴϱϰϬϴ Ϭϭϭ͘ϬϬϭϰϴϱϵϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϭϯϮ͘ϵϵ ƵƚŽWĂƌƚƐΕ ϯϴϱϰϮϯ Ϭϭϭ͘ϬϬϭϰϴϱϵϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϯϱϳ͘Ϯϭ ƵƚŽWĂƌƚƐΕ ϯϴϱϰϯϲ Ϭϭϭ͘ϬϬϭϰϴϱϵϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϭϴϬ͘ϰϲ ƵƚŽWĂƌƚƐΕ ϯϴϱϲϰϱ Ϭϭϭ͘ϬϬϭϰϴϱϵϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϰϭϭ͘ϰϲ ƵƚŽWĂƌƚƐΕ ϯϴϱϲϱϮ Ϭϭϭ͘ϬϬϭϰϴϱϵϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ Ϯϱϴ͘ϭϳ ƵƚŽWĂƌƚƐΕ ϯϴϲϬϮϮ Ϭϭϭ͘ϬϬϭϰϴϱϵϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϳϳ͘ϰϵ ƵƚŽWĂƌƚƐΕ ϯϴϲϬϯϯ Ϭϭϭ͘ϬϬϭϰϴϱϵϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ Ϯϰϯ͘ϯϵ ƵƚŽWĂƌƚƐΕ ϯϴϲϬϵϮ Ϭϭϭ͘ϬϬϭϰϴϱϵΨ Ϯ͕ϳϲϭ͘ϱϵϬϯͬϭϬͬϮϬϮϮ ϲϬϴϴϲϯϬϭϭ͘ϭϬϯϭ͘ϱϵϲϱϬϬ Ψ ϴϱ͘ϵϲ >ĞƐƐ>ĞƚŚĂů/ŶƐƚƌƵĐƚŽƌΖƐŽƵƌƐĞ ϬϮϬϵϮϮZK^^͕:ZDzϬϬϬϬϯϴͲΨ ϴϱ͘ϵϲϬϯͬϭϬͬϮϬϮϮ ϲϬϴϴϲϰϬϭϭ͘ϭϬϯϭ͘ϱϵϰϮϬϬ Ψ ϰϬϲ͘ϭϯ WĂƌŬŝŶŐŝƚĂƟŽŶWƌŽĐĞƐƐŝŶŐ^ĞƌǀŝĐĞƐ ϭϯϰϱϱϮdd/<d͕/EϬϬϲϭϵϭͲΨ ϰϬϲ͘ϭϯϬϯͬϭϬͬϮϬϮϮ ϲϬϴϴϲϱϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϯϯϮ͘ϯϰ ƵƚŽWĂƌƚƐΕ ϭϬϵϳϯϴϱϴϲ Ϭϭϭ͘ϬϬϭϰϴϲϮ&dKZzDKdKZWZd^ϬϬϲϲϵϲͲΨ ϯϯϮ͘ϯϰϬϯͬϭϬͬϮϬϮϮ ϲϬϴϴϲϲWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϰϱŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮZ>z,<^sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEd,<EhDZWzDEddϬϭϭ͘ϵϬϭϵ͘ϱϲϬϬϭϬ Ψ ϱϱ͘ϰϳ WĞƌŝŽĚ͗ϬϭͬϭϲͬϮϮͲϬϮͬϭϱͬϮϮ ϬϭϭϲϮϮ&ZKEd/ZϬϬϱϴϮϱͲΨ ϱϱ͘ϰϳϬϯͬϭϬͬϮϬϮϮ ϲϬϴϴϲϳϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϯϬϲ͘ϯϲ ƵƚŽWĂƌƚƐΘĐĐĞƐƐŽƌŝĞƐΕ ϭϰϯϳϲϮ Ϭϭϭ͘ϬϬϭϰϴϱϴ'ZszYh/WDEdKDWEzϬϬϬϯϵϵͲΨ ϯϬϲ͘ϯϲϬϯͬϭϬͬϮϬϮϮ ϲϬϴϴϲϴϬϭϭ͘ϭϬϰϲ͘ϱϵϬϬϬϬ Ψ ϳϱϬ͘ϱϬ 'W^WƌŽWůƵƐWůĂŶ /EϮϵϴϵϴϵ'Kdh^͕/EϬϬϳϭϬϳͲΨ ϳϱϬ͘ϱϬϬϯͬϭϬͬϮϬϮϮ ϲϬϴϴϲϵϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϲϰϬ͘ϬϬ ^ĞŐŵĞŶƚƌƵƐŚĞƐΕ ϳϴϮϰϬ Ϭϭϭ͘ϬϬϭϱϭϯϭ,<ZYh/WDEdKDWEzϬϬϭϯϰϲͲϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϳϬ͘ϬϬ &ƌĞŝŐŚƚ ϳϴϮϰϬ Ϭϭϭ͘ϬϬϭϱϭϯϭϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϲϬ͘ϴϬ ^ĂůĞƐdĂǆϵ͘ϱй ϳϴϮϰϬΨ ϳϳϬ͘ϴϬϬϯͬϭϬͬϮϬϮϮ ϲϬϴϴϳϬϬϮϬ͘ϭϬϴϰ͘ϵϬϬϬϬϬ Ψ ϭϲ͕ϴϱϲ͘ϬϬ ŽĂƟŶŐ/ŶƐƉĞĐƟŽŶ^ĞƌǀŝĐĞƐ E'ϳϲϰϭ,ZWZΘ^^K/d^E'/EZ/EϬϬϬϮϴϬͲΨ ϭϲ͕ϴϱϲ͘ϬϬϬϯͬϭϬͬϮϬϮϮ ϲϬϴϴϳϭWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϰϲŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮZ>z,<^sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEd,<EhDZWzDEddϬϭϭ͘ϭϬϰϭ͘ϱϵϱϮϬϬ Ψ ϱ͕ϱϮϭ͘ϬϮ ƵŝůĚŝŶŐΘ^ĂĨĞƚǇWůĂŶZĞǀŝĞǁΕ ϳϬϭϴϲ/EdZt^dKE^h>d/E''ZKhW͕/EϬϬϰϭϰϯͲϬϭϭ͘ϭϬϰϭ͘ϱϵϱϮϬϬ Ψ ϭ͕ϭϳϴ͘ϲϬ ƵŝůĚŝŶŐΘ^ĂĨĞƚǇWůĂŶZĞǀŝĞǁΕ ϳϭϭϵϳϬϭϭ͘ϭϬϰϭ͘ϱϵϱϮϬϬ Ψ ϯ͕ϳϳϯ͘ϯϲ ƵŝůĚŝŶŐΘ^ĂĨĞƚǇWůĂŶZĞǀŝĞǁΕ ϳϭϱϴϵϬϭϭ͘ϭϬϰϭ͘ϱϵϱϮϬϬ Ψ ϭϱ͕ϳϲϬ͘ϴϭ ƵŝůĚŝŶŐΘ^ĂĨĞƚǇWůĂŶZĞǀŝĞǁΕ ϳϭϵϵϭϬϭϭ͘ϭϬϰϭ͘ϱϵϱϮϬϬ Ψ ϯϯϯ͘ϲϬ ƵŝůĚŝŶŐΘ^ĂĨĞƚǇWůĂŶZĞǀŝĞǁΕ ϳϭϵϵϮϬϭϭ͘ϭϬϰϭ͘ϱϵϱϮϬϬ Ψ ϯ͕Ϭϭϳ͘ϱϬ ƵŝůĚŝŶŐΘ^ĂĨĞƚǇWůĂŶZĞǀŝĞǁΕ ϳϭϵϵϯϬϭϭ͘ϭϬϰϭ͘ϱϵϱϮϬϬ Ψ ϭ͕Ϯϰϱ͘ϭϮ ƵŝůĚŝŶŐΘ^ĂĨĞƚǇWůĂŶZĞǀŝĞǁΕ ϳϮϵϳϲϬϭϭ͘ϭϬϰϭ͘ϱϵϱϮϬϬ Ψ ϯϰϰ͘ϯϰ ƵŝůĚŝŶŐΘ^ĂĨĞƚǇWůĂŶZĞǀŝĞǁΕ ϳϯϲϳϳϬϭϭ͘ϭϬϰϭ͘ϱϵϱϮϬϬ Ψ ϭ͕ϯϲϳ͘ϮϬ ƵŝůĚŝŶŐΘ^ĂĨĞƚǇWůĂŶZĞǀŝĞǁΕ ϳϯϲϴϭϬϭϭ͘ϭϬϰϭ͘ϱϵϱϮϬϬ Ψ Ϯ͕ϵϰϱ͘ϬϬ ƵŝůĚŝŶŐΘ^ĂĨĞƚǇWůĂŶZĞǀŝĞǁΕ ϳϯϲϴϮϬϭϭ͘ϭϬϰϭ͘ϱϵϱϮϬϬ Ψ ϯϴϯ͘ϲϬ ƵŝůĚŝŶŐΘ^ĂĨĞƚǇWůĂŶZĞǀŝĞǁΕ ϳϰϰϬϳϬϭϭ͘ϭϬϰϭ͘ϱϵϱϮϬϬ Ψ ϳ͕ϯϲϮ͘ϱϬ ƵŝůĚŝŶŐΘ^ĂĨĞƚǇWůĂŶZĞǀŝĞǁΕ ϳϰϰϬϴϬϭϭ͘ϭϬϰϭ͘ϱϵϱϮϬϬ Ψ Ϯ͕ϱϳϮ͘ϳϯ ƵŝůĚŝŶŐΘ^ĂĨĞƚǇWůĂŶZĞǀŝĞǁΕ ϳϱϬϭϰϬϭϭ͘ϭϬϰϭ͘ϱϵϱϮϬϬ Ψ ϲ͕ϭϱϬ͘ϬϬ ƵŝůĚŝŶŐΘ^ĂĨĞƚǇWůĂŶZĞǀŝĞǁΕ ϳϱϬϲϯϬϭϭ͘ϭϬϰϭ͘ϱϵϱϮϬϬ Ψ ϰϬϬ͘ϬϬ ƵŝůĚŝŶŐΘ^ĂĨĞƚǇWůĂŶZĞǀŝĞǁΕ ϳϲϭϳϲϬϭϭ͘ϭϬϰϭ͘ϱϵϱϮϬϬ Ψ ϭϭ͕ϭϮϰ͘ϱϯ ƵŝůĚŝŶŐΘ^ĂĨĞƚǇWůĂŶZĞǀŝĞǁΕ ϳϲϭϳϳϬϭϭ͘ϭϬϰϭ͘ϱϵϱϮϬϬ Ψ ϭϮϱ͘ϬϬ ƵŝůĚŝŶŐΘ^ĂĨĞƚǇWůĂŶZĞǀŝĞǁΕ ϳϲϭϳϴΨ ϲϯ͕ϲϬϰ͘ϵϭϬϯͬϭϬͬϮϬϮϮ ϲϬϴϴϳϮϬϭϭ͘ϵϬϭϵ͘ϱϲϬϬϭϬ Ψ ϯϱϬ͘Ϯϵ KīƐŝƚĞĂĐŬƵƉdĂƉĞ^ƚŽƌĂŐĞ ϮϬϮϰϴϬϰϭϮ/ZKEDKhEd/EϬϬϬϴϮϵͲΨ ϯϱϬ͘ϮϵϬϯͬϭϬͬϮϬϮϮ ϲϬϴϴϳϯWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϰϳŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮZ>z,<^sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEd,<EhDZWzDEddϬϭϭ͘ϭϬϯϭ͘ϱϵϲϮϬϬ Ψ ϭ͕ϮϬϬ͘ϬϬ ĂĐŬŐƌŽƵŶĚ/ŶǀĞƐƟŐĂƟŽŶ ϮϬϮϮsEϬϬϭ>,Z͕KE>ϬϬϲϱϲϳͲΨ ϭ͕ϮϬϬ͘ϬϬϬϯͬϭϬͬϮϬϮϮ ϲϬϴϴϳϰϬϭϭ͘ϭϬϯϭ͘ϱϵϰϮϬϬ Ψ ϭϭϲ͘ϵϭ /ŶƚĞƌƉƌĞƚĂƟŽŶ^ĞƌǀŝĐĞƐ ϭϬϰϲϵϲϬϱ>E'h'>/E^Zs/^͕/EϬϬϯϮϳϮͲΨ ϭϭϲ͘ϵϭϬϯͬϭϬͬϮϬϮϮ ϲϬϴϴϳϱϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϳϮϲ͘ϮϬ dŝƌĞƐ͕ĐĐĞƐƐŽƌŝĞƐΘZĞƉĂŝƌƐΕ ϰϵϵϰ Ϭϭϭ͘ϬϬϭϰϴϲϯ>KWΘ>KWd/Z^Zs/ϬϬϯϵϬϴͲϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϳϬϳ͘ϴϬ dŝƌĞƐ͕ĐĐĞƐƐŽƌŝĞƐΘZĞƉĂŝƌƐΕ ϱϬϬϱ Ϭϭϭ͘ϬϬϭϰϴϲϯϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ Ϯϰϴ͘ϭϮ dŝƌĞƐ͕ĐĐĞƐƐŽƌŝĞƐΘZĞƉĂŝƌƐΕ ϱϬϰϬ Ϭϭϭ͘ϬϬϭϰϴϲϯϬϭϭ͘ϭϬϰϲ͘ϱϵϬϬϬϬ Ψ ϭϴ͘ϬϬ >ĂďŽƌ ϱϬϲϱ Ϭϭϭ͘ϬϬϭϰϴϲϯΨ ϭ͕ϳϬϬ͘ϭϮϬϯͬϭϬͬϮϬϮϮ ϲϬϴϴϳϲϬϭϭ͘ϵϬϭϵ͘ϱϵϬϭϭϬ Ψ ϭ͕Ϯϱϱ͘ϲϭ DĂŶĂŐĞĚWƌŝŶƚ^ĞƌǀŝĐĞƐ /EϮϰϵϴϭϮϲDZ^DZdd,EK>K'z^K>hd/KE^ϬϬϲϮϬϯͲΨ ϭ͕Ϯϱϱ͘ϲϭϬϯͬϭϬͬϮϬϮϮ ϲϬϴϴϳϳWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϰϴŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮZ>z,<^sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEd,<EhDZWzDEddϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϳϭϱ͘ϬϮ ƵƚŽWĂƌƚƐΘĐĐĞƐƐŽƌŝĞƐΕ ϭϮϬϯϵϰ Ϭϭϭ͘ϬϬϭϰϴϲϰEWhdKWZd^ϬϬϬϯϬϵͲϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϭϬϴ͘Ϭϱ ƵƚŽWĂƌƚƐΘĐĐĞƐƐŽƌŝĞƐΕ ϭϮϯϭϬϵ Ϭϭϭ͘ϬϬϭϰϴϲϰϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϭϯ͘ϭϯ ƵƚŽWĂƌƚƐΘĐĐĞƐƐŽƌŝĞƐΕ ϭϮϯϰϵϴ Ϭϭϭ͘ϬϬϭϰϴϲϰϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϰϯ͘ϳϱ ƵƚŽWĂƌƚƐΘĐĐĞƐƐŽƌŝĞƐΕ ϭϮϯϱϬϭ Ϭϭϭ͘ϬϬϭϰϴϲϰϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϭϴϬ͘ϬϮ ƵƚŽWĂƌƚƐΘĐĐĞƐƐŽƌŝĞƐΕ ϭϮϰϯϰϱ Ϭϭϭ͘ϬϬϭϰϴϲϰϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϯϵϰ͘Ϭϳ ƵƚŽWĂƌƚƐΘĐĐĞƐƐŽƌŝĞƐΕ ϭϮϰϯϳϵ Ϭϭϭ͘ϬϬϭϰϴϲϰϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϰϮϳ͘Ϭϰ ƵƚŽWĂƌƚƐΘĐĐĞƐƐŽƌŝĞƐΕ ϭϮϰϰϬϴ Ϭϭϭ͘ϬϬϭϰϴϲϰϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϭϭ͘ϲϵ ƵƚŽWĂƌƚƐΘĐĐĞƐƐŽƌŝĞƐΕ ϭϮϰϰϭϭ Ϭϭϭ͘ϬϬϭϰϴϲϰϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ͲϮϬϭ͘ϰϳ ƵƚŽWĂƌƚƐΘĐĐĞƐƐŽƌŝĞƐΕ ϭϮϰϱϬϱ Ϭϭϭ͘ϬϬϭϰϴϲϰϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ Ϯϱϴ͘ϱϰ ƵƚŽWĂƌƚƐΘĐĐĞƐƐŽƌŝĞƐΕ ϭϮϱϮϲϰ Ϭϭϭ͘ϬϬϭϰϴϲϰϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ Ϯ͘ϰϵ ƵƚŽWĂƌƚƐΘĐĐĞƐƐŽƌŝĞƐΕ ϭϮϱϯϮϵ Ϭϭϭ͘ϬϬϭϰϴϲϰϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϴ͘ϵϴ ƵƚŽWĂƌƚƐΘĐĐĞƐƐŽƌŝĞƐΕ ϭϮϱϲϳϬ Ϭϭϭ͘ϬϬϭϰϴϲϰϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ Ϯ͘ϴϵ ƵƚŽWĂƌƚƐΘĐĐĞƐƐŽƌŝĞƐΕ ϭϮϱϲϳϯ Ϭϭϭ͘ϬϬϭϰϴϲϰϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϳϭ͘Ϭϳ ƵƚŽWĂƌƚƐΘĐĐĞƐƐŽƌŝĞƐΕ ϭϮϲϯϭϭ Ϭϭϭ͘ϬϬϭϰϴϲϰϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϴϲ͘ϮϮ ƵƚŽWĂƌƚƐΘĐĐĞƐƐŽƌŝĞƐΕ ϭϮϲϰϰϱ Ϭϭϭ͘ϬϬϭϰϴϲϰϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ Ϯϵϳ͘ϴϯ ƵƚŽWĂƌƚƐΘĐĐĞƐƐŽƌŝĞƐΕ ϭϮϲϲϯϭ Ϭϭϭ͘ϬϬϭϰϴϲϰΨ Ϯ͕ϰϭϵ͘ϯϮϬϯͬϭϬͬϮϬϮϮ ϲϬϴϴϳϴϬϭϭ͘ϭϬϰϯ͘ϵϬϬϬϬϬ Ψ ϵϰ͕ϵϮϴ͘ϳϱ WƌŽŐƌĞƐƐWĂǇŵĞŶƚηϭ ϬϭϯϭϮϮKEzyWs/E'KDWEz͕/EϬϬϳϮϱϰͲϬϭϭ͘ϭϬϰϯ͘ϵϬϬϬϬϬ Ψ ϱ͕ϯϰϲ͘ϲϬ WƌŽŐƌĞƐƐWĂǇŵĞŶƚηϮ ϬϮϭϴϮϮΨ ϭϬϬ͕Ϯϳϱ͘ϯϱϬϯͬϭϬͬϮϬϮϮ ϲϬϴϴϳϵWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϰϵŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮZ>z,<^sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEd,<EhDZWzDEddϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϲϭ͘Ϭϲ ƵƚŽWĂƌƚƐΘĐĐĞƐƐŽƌŝĞƐΕ ϯϬϰϵϯϴϲϯϱϵ Ϭϭϭ͘ϬϬϭϰϴϲϬKΖZ/>>zhdKWZd^ϬϬϱϵϯϰͲϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϭϱ͘ϭϮ ƵƚŽWĂƌƚƐΘĐĐĞƐƐŽƌŝĞƐΕ ϯϬϰϵϯϴϳϲϭϵ Ϭϭϭ͘ϬϬϭϰϴϲϬϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϳ͘ϲϬ ƵƚŽWĂƌƚƐΘĐĐĞƐƐŽƌŝĞƐΕ ϯϬϰϵϯϴϴϱϰϬ Ϭϭϭ͘ϬϬϭϰϴϲϬϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ Ϯϯ͘ϱϬ ƵƚŽWĂƌƚƐΘĐĐĞƐƐŽƌŝĞƐΕ ϯϬϰϵϯϴϴϱϳϱ Ϭϭϭ͘ϬϬϭϰϴϲϬϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϱϱ͘ϳϴ ƵƚŽWĂƌƚƐΘĐĐĞƐƐŽƌŝĞƐΕ ϯϬϰϵϯϴϵϲϮϳ Ϭϭϭ͘ϬϬϭϰϴϲϬϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϯϮϭ͘Ϯϵ ƵƚŽWĂƌƚƐΘĐĐĞƐƐŽƌŝĞƐΕ ϯϬϰϵϯϴϵϲϯϮ Ϭϭϭ͘ϬϬϭϰϴϲϬΨ ϰϴϰ͘ϯϱϬϯͬϭϬͬϮϬϮϮ ϲϬϴϴϴϬϬϱϲ͘ϱϲϬϬ͘ϵϬϬϬϬϬ Ψ ϰ͕ϱϯϯ͘ϬϬ ƌĞƐƐĞƌΕ ϭϬϳϭϬϬ Ϭϱϲ͘ϬϬϬϬϲϲϬW&dͲ>yEZ͕/EϬϬϱϳϲϮͲϬϱϲ͘ϱϲϬϬ͘ϵϬϬϬϬϬ Ψ ϰϲϰ͘ϲϯ ^ĂůĞƐdĂǆϭϬ͘Ϯϱ ϭϬϳϭϬϬΨ ϰ͕ϵϵϳ͘ϲϯϬϯͬϭϬͬϮϬϮϮ ϲϬϴϴϴϭϬϱϲ͘ϱϲϬϬ͘ϱϵϲϳϬϬ Ψ ϲϬϯ͘ϯϭ dƌĂŝŶŝŶŐ^ĞƌǀŝĐĞƐ ϴϬϲϮϴϱϯϬW'ΘϬϬϱϲϭϲͲΨ ϲϬϯ͘ϯϭϬϯͬϭϬͬϮϬϮϮ ϲϬϴϴϴϮϬϭϭ͘ϭϬϰϲ͘ϱϵϬϬϬϬ Ψ ϵϬϬ͘ϬϬ ĂƌtĂƐŚ^ĞƌǀŝĐĞƐ ϮϵϯϰϬϭYh>/&/DK/>͕/EϬϬϲϲϭϮͲΨ ϵϬϬ͘ϬϬϬϯͬϭϬͬϮϬϮϮ ϲϬϴϴϴϯϬϭϭ͘ϭϬϰϯ͘ϱϵϱϮϬϬ Ψ ϭ͕ϯϮϬ͘ϬϬ dƌĂĸĐŶŐŝŶĞĞƌŝŶŐ^ĞƌǀŝĐĞƐ sϮϭϬϭϲYhEdhDYh>/dzKE^h>d/E'͕/EϬϬϲϵϱϲͲϬϭϭ͘ϭϬϰϯ͘ϱϵϲϮϬϬ Ψ ϯϲϬ͘ϬϬ dƌĂĸĐŶŐŝŶĞĞƌŝŶŐ^ĞƌǀŝĐĞƐ sϮϮϬϬϯϬϭϭ͘ϭϬϰϯ͘ϱϵϱϮϬϬ Ψ ϴϲϬ͘ϬϬ dƌĂĸĐŶŐŝŶĞĞƌŝŶŐ^ĞƌǀŝĐĞƐ sϮϮϬϬϰΨ Ϯ͕ϱϰϬ͘ϬϬϬϯͬϭϬͬϮϬϮϮ ϲϬϴϴϴϰϬϭϭ͘ϭϬϯϭ͘ϱϵϲϱϬϬ Ψ ϴϱ͘ϵϲ >ĞƐƐ>ĞƚŚĂů/ŶƐƚƌƵĐƚŽƌΖƐŽƵƌƐĞ ϬϮϬϵϮϮ;ϮͿ^>E͕Z>K^ϬϬϲϴϳϬͲΨ ϴϱ͘ϵϲϬϯͬϭϬͬϮϬϮϮ ϲϬϴϴϴϱWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϱϬŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮZ>z,<^sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEd,<EhDZWzDEddϬϭϭ͘ϵϬϭϵ͘ϱϲϬϬϭϬ Ψ ϯϯ͘ϵϰ WĞƌŝŽĚ͗ϭϬͬϬϮͬϮϭͲϭϭͬϬϭͬϮϭ ϲϳϳϵϳϱϯϭϴϮϰϬ^WZ/EdϬϬϭϬϭϳͲϬϭϭ͘ϵϬϭϵ͘ϱϲϬϬϭϬ Ψ ϯϯ͘ϵϰ WĞƌŝŽĚ͗ϭϭͬϬϮͬϮϭͲϭϮͬϬϭͬϮϭ ϲϳϳϵϳϱϯϭϴϮϰϭϬϭϭ͘ϵϬϭϵ͘ϱϲϬϬϭϬ Ψ ϯϯ͘ϴϯ WĞƌŝŽĚ͗ϭϮͬϬϮͬϮϭͲϬϭͬϬϭͬϮϮ ϲϳϳϵϳϱϯϭϴϮϰϮϬϭϭ͘ϵϬϭϵ͘ϱϲϬϬϭϬ Ψ ϯϯ͘ϵϲ WĞƌŝŽĚ͗ϬϭͬϬϮͬϮϮͲϬϮͬϬϭͬϮϮ ϲϳϳϵϳϱϯϭϴϮϰϯΨ ϭϯϱ͘ϲϳϬϯͬϭϬͬϮϬϮϮ ϲϬϴϴϴϲϬϭϭ͘ϵϬϭϵ͘ϱϵϬϭϭϬ Ψ ϴ͕ϯϳϴ͘ϬϬ WWŚŽŶĞZĞĐŽƌĚŝŶŐ^ǇƐƚĞŵ ϭϭϮϰϰ^dE/>KZWKZd/KEϬϬϬϴϯϴͲΨ ϴ͕ϯϳϴ͘ϬϬϬϯͬϭϬͬϮϬϮϮ ϲϬϴϴϴϳϬϭϭ͘ϭϬϯϭ͘ϱϮϬϬϬϬ Ψ ϵ͘ϵϬ >ĂƵŶĚƌǇ^ĞƌǀŝĐĞƐΕ ϭϭϮϴϲ Ϭϭϭ͘ϬϬϭϰϵϮϮ^dd^dZd>hEZzϬϬϬϭϵϭͲϬϭϭ͘ϭϬϯϭ͘ϱϮϬϬϬϬ Ψ ϵ͘ϵϬ >ĂƵŶĚƌǇ^ĞƌǀŝĐĞƐΕ ϭϭϮϴϳ Ϭϭϭ͘ϬϬϭϰϵϮϮϬϭϭ͘ϭϬϯϭ͘ϱϮϬϬϬϬ Ψ ϰ͘ϱϬ >ĂƵŶĚƌǇ^ĞƌǀŝĐĞƐΕ ϭϭϮϴϴ Ϭϭϭ͘ϬϬϭϰϵϮϮϬϭϭ͘ϭϬϯϭ͘ϱϮϬϬϬϬ Ψ ϲ͘ϯϬ >ĂƵŶĚƌǇ^ĞƌǀŝĐĞƐΕ ϭϭϮϴϵ Ϭϭϭ͘ϬϬϭϰϵϮϮΨ ϯϬ͘ϲϬϬϯͬϭϬͬϮϬϮϮ ϲϬϴϴϴϴϬϭϭ͘ϭϬϯϭ͘ϱϵϰϮϬϬ Ψ ϭ͕ϲϯϰ͘ϱϬ WĂƌŬŝŶŐŝƚĂƟŽŶƐϬϭͬϮϮ ϬϮϬϲϮϮ^hWZ/KZdK&>K&>ϬϬϱϰϭϵͲΨ ϭ͕ϲϯϰ͘ϱϬϬϯͬϭϬͬϮϬϮϮ ϲϬϴϴϴϵϬϭϭ͘ϭϬϮϰ͘ϱϵϲϲϬϬ Ψ Ϯϯϳ͘ϯϱ ^ŽŌǁĂƌĞ^ƵďƐĐƌŝƉƟŽŶŚĂƌŐĞƐ ϴϰϱϵϰϴϵϱϵd,KD^KEZhdZ^Ͳt^dϬϬϬϭϰϭͲϬϭϭ͘ϭϬϯϭ͘ϱϵϲϮϬϬ Ψ ϭ͕Ϯϳϲ͘ϲϬ ^ŽŌǁĂƌĞ^ƵďƐĐƌŝƉƟŽŶŚĂƌŐĞƐ ϴϰϱϵϲϴϭϲϱϬϭϭ͘ϭϬϲϬ͘ϱϵϲϲϬϬ Ψ ϭ͕Ϭϳϭ͘ϲϯ ^ŽŌǁĂƌĞ^ƵďƐĐƌŝƉƟŽŶŚĂƌŐĞƐ ϴϰϲϬϮϭϮϭϮΨ Ϯ͕ϱϴϱ͘ϱϴϬϯͬϭϬͬϮϬϮϮ ϲϬϴϴϵϬWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϱϭŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮZ>z,<^sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEd,<EhDZWzDEddϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϯϮϱ͘ϲϬ dƌĂŝůĞƌdŝƌĞƐΕ ϮϱϳϰϯϵϮϭ Ϭϭϭ͘ϬϬϭϱϭϯϮd/Z,h͕>>ϬϬϲϯϳϭͲϬϭϭ͘ϭϬϰϲ͘ϱϵϬϬϬϬ Ψ ϳ͘ϬϬ Ă͘dŝƌĞ&ĞĞ ϮϱϳϰϯϵϮϭ Ϭϭϭ͘ϬϬϭϱϭϯϮϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϯϬ͘ϵϰ ^ĂůĞƐdĂǆϵ͘ϱй ϮϱϳϰϯϵϮϭϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ Ϯϰϵ͘ϯϰ dŝƌĞƐΕ ϮϱϳϵϬϰϮϰ Ϭϭϭ͘ϬϬϭϱϭϯϱϬϭϭ͘ϭϬϰϲ͘ϱϵϬϬϬϬ Ψ ϯ͘ϱϬ ͘dŝƌĞ&ĞĞ ϮϱϳϵϬϰϮϰ Ϭϭϭ͘ϬϬϭϱϭϯϱϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ Ϯϯ͘ϲϵ ^ĂůĞƐdĂǆϵ͘ϱй ϮϱϳϵϬϰϮϰΨ ϲϰϬ͘ϬϳϬϯͬϭϬͬϮϬϮϮ ϲϬϴϴϵϭϬϱϱ͘ϴϰϬϬ͘ϱϵϬϬϬϬ Ψ ϭ͕ϴϵϬ͘ϬϬ &ĞŶĐŝŶŐΘZĞƉĂŝƌƐ ϭϵϲϳϱhE/d^d>&EKDWEzϬϬϱϬϯϬͲΨ ϭ͕ϴϵϬ͘ϬϬϬϯͬϭϬͬϮϬϮϮ ϲϬϴϴϵϮϬϱϱ͘ϵϬϬϬ͘ϱϲϬϬϭϬ Ψ ϳϵϲ͘ϴϰ WĞƌŝŽĚ͗ϭϬͬϮϰͬϮϭͲϭϭͬϮϯͬϮϭ ϵϴϵϯϲϬϭϬϳϴsZ/KEt/Z>^^ϬϬϭϰϴϭͲϬϭϭ͘ϵϬϭϵ͘ϱϲϬϬϭϬ Ψ ϴϵϳ͘ϯϮ WĞƌŝŽĚ͗ϭϮͬϭϭͬϮϭͲϭϮͬϭϬͬϮϮ ϵϴϵϲϵϲϵϯϰϴΨ ϭ͕ϲϵϰ͘ϭϲϬϯͬϭϬͬϮϬϮϮ ϲϬϴϴϵϯϬϭϭ͘ϵϬϭϵ͘ϱϲϬϬϭϬ Ψ ϱϴϵ͘ϵϱ WĞƌŝŽĚ͗ϬϴͬϮϭ ϳϭϵϱϮϵϯϬsZ/KEh^/E^^^Zs/^ϬϬϭϰϴϭͲϬϭϭ͘ϵϬϭϵ͘ϱϲϬϬϭϬ Ψ ϱϳϵ͘ϯϭ WĞƌŝŽĚ͗ϭϮͬϮϭ ϳϮϬϴϴϰϴϮΨ ϭ͕ϭϲϵ͘ϮϲϬϯͬϭϬͬϮϬϮϮ ϲϬϴϴϵϰϬϮϬ͘ϭϬϴϰ͘ϱϵϲϱϱϬ Ψ Ϯ͕ϰϰϯ͘ϬϬ DĞŵďĞƌƐŚŝƉƵĞƐΕ ϳϬϬϭϵϵϵϮϬϰDZ/EtdZtKZ<^^^KϬϬϬϬϱϭͲΨ Ϯ͕ϰϰϯ͘ϬϬϬϯͬϭϳͬϮϬϮϮ ϲϬϴϴϵϱWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϱϮŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮZ>z,<^sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEd,<EhDZWzDEddϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϲ͘ϵϱ Kŝů&ŝůƚĞƌΕ ϯϲϭϬϴ Ϭϭϭ͘ϬϬϭϱϭϯϵEz^Zs/EdZϬϬϲϯϬϴͲϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϭϮ͘ϰϴ ^ĞĂůΕ ϯϲϭϬϴ Ϭϭϭ͘ϬϬϭϱϭϯϵϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϮϬ͘ϵϯ 'ĂƐŬĞƚΕ ϯϲϭϬϴ Ϭϭϭ͘ϬϬϭϱϭϯϵϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϳ͘ϵϬ ^ĞĂůΕ ϯϲϭϬϴ Ϭϭϭ͘ϬϬϭϱϭϯϵϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϭϴ͘ϵϱ 'ĂƐŬĞƚΕ ϯϲϭϬϴ Ϭϭϭ͘ϬϬϭϱϭϯϵϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϭϱ͘ϵϱ 'ĂƐŬĞƚΕ ϯϲϭϬϴ Ϭϭϭ͘ϬϬϭϱϭϯϵϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϭϰϮ͘ϵϱ tĂƚĞƌWƵŵƉΕ ϯϲϭϬϴ Ϭϭϭ͘ϬϬϭϱϭϯϵϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ Ϯϲ͘ϵϱ ƌŝǀĞĞůƚΕ ϯϲϭϬϴ Ϭϭϭ͘ϬϬϭϱϭϯϵϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϱϰ͘ϵϱ ĞůƚdĞŶƐŝŽŶĞƌΕ ϯϲϭϬϴ Ϭϭϭ͘ϬϬϭϱϭϯϵϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ Ϯϭ͘ϵϱ Kŝů^ĞŶĚĞƌΕ ϯϲϭϬϴ Ϭϭϭ͘ϬϬϭϱϭϯϵϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ Ϯϯ͘ϵϱ 'ƵŝĚĞΕ ϯϲϭϬϴ Ϭϭϭ͘ϬϬϭϱϭϯϵϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϱϭ͘ϵϬ ŶƟĨƌĞĞǌĞΕ ϯϲϭϬϴ Ϭϭϭ͘ϬϬϭϱϭϯϵϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ Ϯϭ͘ϬϬ DŽƚŽƌKŝů ϯϲϭϬϴ Ϭϭϭ͘ϬϬϭϱϭϯϵϬϭϭ͘ϭϬϰϲ͘ϱϵϬϬϬϬ Ψ ϲϰϬ͘ϬϬ >ĂďŽƌ ϯϲϭϬϴ Ϭϭϭ͘ϬϬϭϱϭϯϵϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϰϯ͘ϳϱ ^ĂůĞƐdĂǆϭϬ͘Ϯϱ ϯϲϭϬϴΨ ϭ͕ϭϭϬ͘ϱϲϬϯͬϭϳͬϮϬϮϮ ϲϬϴϴϵϲϬϱϱ͘ϳϮϬϬ͘ϱϵϲϳϬϮ Ψ ϰ͕ϮϬϳ͘ϴϴ ƵƐƚŽŵĞƌ/ŶĐĞŶƟǀĞWƌŽŐƌĂŵ ϬϯϭϰϮϮ^,Z&Z/^KEWd^ϬϬϳϯϯϵͲΨ ϰ͕ϮϬϳ͘ϴϴϬϯͬϭϳͬϮϬϮϮ ϲϬϴϴϵϳϬϭϭ͘ϭϬϬϯ͘ϱϵϰϬϬϬ Ψ ϲ͕ϯϳϳ͘ϬϬ ŽŶƐƵůƟŶŐ^ĞƌǀŝĐĞƐĨŽƌ>ŽĐĂů,ĂǌĂƌĚ ϭϯϰϳd>^W>EE/E'^K>hd/KE^ϬϬϳϭϮϮͲΨ ϲ͕ϯϳϳ͘ϬϬϬϯͬϭϳͬϮϬϮϮ ϲϬϴϴϵϴWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϱϯŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮZ>z,<^sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEd,<EhDZWzDEddϬϭϭ͘ϭϬϮϰ͘ϱϵϯϮϬϬ Ψ ϯϮ͘ϱϬ ZĞ͗DĂƌƟŶĞƐ͕/ƐŵĂĞůǀ͘ŝƚǇŽĨsĞƌŶŽŶ͕ ϮϱϭϱϱϴhZ<͕t/>>/D^Θ^KZE^E͕>>ϬϬϱϬϳϴͲϬϭϭ͘ϭϬϮϰ͘ϱϵϯϮϬϬ Ψ Ϯ͕ϳϳϴ͘ϱϬ ZĞ͗'ĞŶĞƌĂůΕ ϮϴϭϮϵϰϬϭϭ͘ϭϬϮϰ͘ϱϵϯϮϬϬ Ψ ϭϱϱ͘ϬϬ ZĞ͗DĂƌƟŶĞƐ͕/ƐŵĂĞůǀ͘ŝƚǇŽĨsĞƌŶŽŶ͕ ϮϴϭϮϵϱϬϭϭ͘ϭϬϮϰ͘ϱϵϯϮϬϬ Ψ ϱ͕ϯϳϵ͘ϬϬ ZĞ͗^ĂŶĐŚĞǌ͕ŚƌŝƐƟŶĂǀ͘^ƚĂƚĞŽĨ ϮϴϭϮϵϲϬϭϭ͘ϭϬϮϰ͘ϱϵϯϮϬϬ Ψ ϳϭ͘ϵϰ ZĞ͗^ĂŶĐŚĞǌ͕ŚƌŝƐƟŶĂǀ͘^ƚĂƚĞŽĨ ϮϴϭϱϲϮΨ ϴ͕ϰϭϲ͘ϵϰϬϯͬϭϳͬϮϬϮϮ ϲϬϴϴϵϵϬϮϬ͘ϭϬϴϰ͘ϵϬϬϬϬϬ Ψ ϱϯ͕Ϭϰϴ͘ϴϬ &ŝŶĂůWĂǇŵĞŶƚΕ ϬϭϭϰϮϮZKKE^dZhd/KE͕/EϬϬϳϭϬϬͲΨ ϱϯ͕Ϭϰϴ͘ϴϬϬϯͬϭϳͬϮϬϮϮ ϲϬϴϵϬϬϬϭϭ͘ϭϬϬϰ͘ϱϵϱϮϬϬ Ψ ϭϱ͕ϳϭϬ͘ϬϬ ƵĚŝƟŶŐ^ĞƌǀŝĐĞƐ ϯϭϯϳϴϮϵ>/&dKE>Z^KE>>E͕>>WϬϬϲϵϳϮͲΨ ϭϱ͕ϳϭϬ͘ϬϬϬϯͬϭϳͬϮϬϮϮ ϲϬϴϵϬϭϬϮϬ͘ϭϬϴϰ͘ϱϵϱϮϬϬ Ψ ϭ͕ϮϮϭ͘ϬϬ tĂƚĞƌYƵĂůŝƚǇdĞƐƟŶŐΘZĞƉŽƌƟŶŐ ϮϭϬϭϯϲϬsZE>/E/>>K&^EZEZ/EKϬϬϯϬϴϴͲϬϮϬ͘ϭϬϴϰ͘ϱϵϱϮϬϬ Ψ ϳϮϲ͘ϬϬ tĂƚĞƌYƵĂůŝƚǇdĞƐƟŶŐΘZĞƉŽƌƟŶŐ ϮϮϬϬϮϱϯsZEΨ ϭ͕ϵϰϳ͘ϬϬϬϯͬϭϳͬϮϬϮϮ ϲϬϴϵϬϮϬϱϱ͘ϴϰϬϬ͘ϱϵϬϬϬϬ Ψ ϯϴ͘ϰϯ DĂŝŶƚĞŶĂŶĐĞΘZĞƉĂŝƌƐ ϯϵϭϳϰKDWZ^^/Z^W/>d/^/EϬϬϬϵϴϴͲΨ ϯϴ͘ϰϯϬϯͬϭϳͬϮϬϮϮ ϲϬϴϵϬϯWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϱϰŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮZ>z,<^sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEd,<EhDZWzDEddϬϮϬ͘ϭϬϴϰ͘ϵϬϬϬϬϬ Ψ ϯ͕ϮϵϮ͘ϭϱ ůĞĐƚƌŝĐĂůΘ,ĂƌĚǁĂƌĞ^ƵƉƉůŝĞƐΕ Ϯϳϭϱϲϱ Ϭϭϭ͘ϬϬϭϰϴϳϱhZZEdt,K>^>>dZ/^hWϬϬϭϯϯϲͲϬϮϬ͘ϭϬϴϰ͘ϵϬϬϬϬϬ Ψ ϭ͕ϭϭϰ͘ϯϬ ůĞĐƚƌŝĐĂůΘ,ĂƌĚǁĂƌĞ^ƵƉƉůŝĞƐΕ Ϯϳϭϱϲϲ Ϭϭϭ͘ϬϬϭϰϴϳϱϬϮϬ͘ϭϬϴϰ͘ϱϮϬϬϬϬ Ψ ϰϮϬ͘ϳϲ ůĞĐƚƌŝĐĂůΘ,ĂƌĚǁĂƌĞ^ƵƉƉůŝĞƐΕ Ϯϳϭϴϯϭ Ϭϭϭ͘ϬϬϭϰϴϳϱϬϮϬ͘ϭϬϴϰ͘ϵϬϬϬϬϬ Ψ Ϯ͕ϲϯϮ͘ϴϴ ůĞĐƚƌŝĐĂůΘ,ĂƌĚǁĂƌĞ^ƵƉƉůŝĞƐΕ ϮϳϭϴϯϮ Ϭϭϭ͘ϬϬϭϰϴϳϱϬϮϬ͘ϭϬϴϰ͘ϵϬϬϬϬϬ Ψ ϭ͕ϯϲϵ͘Ϭϴ ůĞĐƚƌŝĐĂůΘ,ĂƌĚǁĂƌĞ^ƵƉƉůŝĞƐΕ Ϯϳϭϴϯϯ Ϭϭϭ͘ϬϬϭϰϴϳϱΨ ϴ͕ϴϮϵ͘ϭϳϬϯͬϭϳͬϮϬϮϮ ϲϬϴϵϬϰϬϭϭ͘ϭϬϰϴ͘ϱϵϲϮϬϬ Ψ ϭϬϬ͘ϬϬ ƩĞŶĚĂŶĐĞ^ƟƉĞŶĚΕ ϬϯϭϬϮϮZKE/d,EͲZzϬϬϲϳϭϳͲΨ ϭϬϬ͘ϬϬϬϯͬϭϳͬϮϬϮϮ ϲϬϴϵϬϱϬϱϱ͘ϵϬϬϬ͘ϱϵϲϮϬϬ Ψ Ϯ͕ϵϴϵ͘ϬϬ WƌŽĨĞƐƐŝŽŶĂů^ĞƌǀŝĐĞƐΕ ϯϲϬϭϭ>^'hEEt/EZ''EZϬϬϳϭϰϱͲϬϱϱ͘ϵϬϬϬ͘ϱϵϲϮϬϬ Ψ Ϯϵϰ͘ϬϬ WƌŽĨĞƐƐŝŽŶĂů^ĞƌǀŝĐĞƐΕ ϯϲϬϭϮ>^'Ψ ϯ͕Ϯϴϯ͘ϬϬϬϯͬϭϳͬϮϬϮϮ ϲϬϴϵϬϲϬϭϭ͘ϭϬϰϯ͘ϵϬϬϬϬϬ Ψ ϲϴ͕ϭϮϲ͘ϱϵ /ŵƉƌŽǀĞŵĞŶƚƐĂƚ/ŶƚĞƌƐĞĐƟŽŶŽĨ ϱϱϲϳϵE^'EZ>E'/EZ/E'͕/EϬϬϳϮϱϯͲΨ ϲϴ͕ϭϮϲ͘ϱϵϬϯͬϭϳͬϮϬϮϮ ϲϬϴϵϬϳϬϭϭ͘ϭϬϰϵ͘ϱϮϬϬϬϬ Ψ ϯ͕ϮϴϬ͘ϬϬ ŽīĞĞΕ ϰϮϭϯϰϵϯ Ϭϭϭ͘ϬϬϭϱϭϳϭ&'s/EΘ^KE^͕/EϬϬϭϵϮϲͲΨ ϯ͕ϮϴϬ͘ϬϬϬϯͬϭϳͬϮϬϮϮ ϲϬϴϵϬϴϬϭϭ͘ϭϬϰϲ͘ϱϵϬϬϬϬ Ψ ϭϯϱ͘ϬϬ KƉĂĐŝƚǇdĞƐƚ Ϯϳϯϵ&>dZt͕/EϬϬϲϵϮϱͲΨ ϭϯϱ͘ϬϬϬϯͬϭϳͬϮϬϮϮ ϲϬϴϵϬϵWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϱϱŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮZ>z,<^sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEd,<EhDZWzDEddϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϳϱ͘ϰϬ ^ĞƉĞƌĂƚŽƌƐƐĞŵďůǇΕ &Ϭ^ϮϰϱϬϳϲ Ϭϭϭ͘ϬϬϭϱϭϯϲ&KZK&DKEd>>KϬϬϬϵϵϳͲϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ Ϯϯ͘Ϯϵ ůĞŵĞŶƚ<ŝƚΕ &Ϭ^ϮϰϱϬϳϲ Ϭϭϭ͘ϬϬϭϱϭϯϲϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϭϲ͘ϴϯ DŽƚŽƌĐƌĂŌ^Ε &Ϭ^ϮϰϱϬϳϲ Ϭϭϭ͘ϬϬϭϱϭϯϲϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϱϭ͘ϴϮ DŽƚŽƌĐƌĂŌ^Ε &Ϭ^ϮϰϱϬϳϲ Ϭϭϭ͘ϬϬϭϱϭϯϲϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϳϵ͘Ϯϭ dƵďĞKƵƚůĞƚΕ &Ϭ^ϮϰϱϬϳϲ Ϭϭϭ͘ϬϬϭϱϭϯϲϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϮϮ͘Ϭϭ ϭϯϬϬϱ^DW>'ZE &Ϭ^ϮϰϱϬϳϲ Ϭϭϭ͘ϬϬϭϱϭϯϲϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϲ͘ϯϴ ^ŚĂŵƉŽŽŶŐŝŶĞĞŐƌĞĂƐĞƌ &Ϭ^ϮϰϱϬϳϲ Ϭϭϭ͘ϬϬϭϱϭϯϲϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ Ϯ͕ϰϭϯ͘ϱϬ >ĂďŽƌ &Ϭ^ϮϰϱϬϳϲ Ϭϭϭ͘ϬϬϭϱϭϯϲϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ Ϯϴ͘ϭϴ ^ĂůĞƐdĂǆϭϬ͘Ϯϱ &Ϭ^ϮϰϱϬϳϲΨ Ϯ͕ϳϭϲ͘ϲϮϬϯͬϭϳͬϮϬϮϮ ϲϬϴϵϭϬϬϭϭ͘ϭϬϮϲ͘ϱϵϲϮϬϬ Ψ ϱϮ͘ϬϬ ZĞŝŵď͘>ŝǀĞ^ĐĂŶ ϬϯϭϱϮϮ>/>/,ZEEϬϬϱϰϰϮͲΨ ϱϮ͘ϬϬϬϯͬϭϳͬϮϬϮϮ ϲϬϴϵϭϭϬϭϭ͘ϭϬϰϯ͘ϱϵϬϬϬϬ Ψ ϰϲ͕ϳϬϳ͘ϳϬ ŝƚǇǁŝĚĞ^ƚƌŝƉŝŶŐΘWĂǀĞŵĞŶƚDĂƌŬŝŶŐƐ ϭϭϲϬϵ:Θ^^dZ/W/E'K͕/EϬϬϰϰϲϬͲΨ ϰϲ͕ϳϬϳ͘ϳϬϬϯͬϭϳͬϮϬϮϮ ϲϬϴϵϭϮϬϱϱ͘ϳϮϬϬ͘ϱϵϲϳϬϮ Ψ ϴ͕ϲϬϰ͘ϵϴ ƵƐƚŽŵĞƌ/ŶĐĞŶƟǀĞWƌŽŐƌĂŵ ϬϯϭϰϮϮ<ZE<E/EϬϬϳϯϯϴͲΨ ϴ͕ϲϬϰ͘ϵϴϬϯͬϭϳͬϮϬϮϮ ϲϬϴϵϭϯϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϭ͕ϰϬϯ͘ϴϴ EƵƚƐ͕ďŽůƚƐ͕tĂƐŚĞƌƐ͕>ŽĐŬtĂƐŚĞƌƐϵͬϭϲϵϲϳϱϱϱϴ Ϭϭϭ͘ϬϬϭϱϭϯϰ</D>>D/t^dϬϬϰϭϮϮͲϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϭϰϯ͘ϵϬ ^ĂůĞƐdĂǆϭϬ͘Ϯϱ ϵϲϳϱϱϱϴΨ ϭ͕ϱϰϳ͘ϳϴϬϯͬϭϳͬϮϬϮϮ ϲϬϴϵϭϰϬϭϭ͘ϭϬϬϮ͘ϱϵϲϱϬϬ Ψ ϳϬϬ͘ϬϬ ^ƵĐĐĞƐƐŝŽŶWůĂŶŶŝŶŐtŽƌŬƐŚŽƉ ϭϬϴϱ>Z'Ks͕>>ϬϬϳϯϯϰͲΨ ϳϬϬ͘ϬϬϬϯͬϭϳͬϮϬϮϮ ϲϬϴϵϭϱWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϱϲŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮZ>z,<^sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEd,<EhDZWzDEddϬϭϭ͘ϭϬϯϭ͘ϱϳϬϬϬϬ Ψ ϭϰϲ͘ϬϬ ĂƌΘdƌƵĐŬtĂƐŚ^ĞƌǀŝĐĞƐΕ ϭϭϳϭ Ϭϭϭ͘ϬϬϭϰϵϰϴDztKKZt^,ϬϬϬϴϳϬͲΨ ϭϰϲ͘ϬϬϬϯͬϭϳͬϮϬϮϮ ϲϬϴϵϭϲϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ Ͳϲ͕Ϯϵϴ͘ϵϭ ƌĞĚŝƚĨŽƌZĞƚƵƌŶƐΕ ϯϱϵϯϮDDEd/KE>^/'E>͕/EϬϬϯϰϵϯͲϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϴ͕ϴϮϳ͘ϰϬ ƌƌŽǁďŽĂƌĚƐΕ ϯϲϵϰϳ/E Ϭϭϭ͘ϬϬϭϱϬϵϴϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϵϬϰ͘ϴϭ ^ĂůĞƐdĂǆϭϬ͘Ϯϱ ϯϲϵϰϳ/EϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϭ͕ϮϮϴ͘ϱϬ WůĞǆŝŐůĂƐƐtŝŶĚŽǁ^ŚĞĞƚƐΕ ϯϳϭϴϲ/E Ϭϭϭ͘ϬϬϭϱϭϮϮϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϭϮϱ͘ϵϯ ^ĂůĞƐdĂǆϭϬ͘Ϯϱ ϯϳϭϴϲ/EΨ ϰ͕ϳϴϳ͘ϳϯϬϯͬϭϳͬϮϬϮϮ ϲϬϴϵϭϳϬϭϭ͘ϭϬϰϴ͘ϱϵϲϮϬϬ Ψ ϭϬϬ͘ϬϬ ƩĞŶĚĂŶĐĞ^ƟƉĞŶĚΕ ϬϯϭϬϮϮ:KZ'>͘EsZ:ZϬϬϲϳϭϱͲΨ ϭϬϬ͘ϬϬϬϯͬϭϳͬϮϬϮϮ ϲϬϴϵϭϴϬϱϲ͘ϱϲϬϬ͘ϱϵϱϮϬϬ Ψ Ϯ͕ϱϬϰ͘ϮϬ &ŝŶĂŶĐŝĂů^ƵƉƉŽƌƚΘƵƐŝŶĞƐƐΕ ϭϮϱϮϱEt'E^dZd'/^Θ^K>hd/KE^͕ϬϬϲϭϴϱͲϬϱϲ͘ϱϲϬϬ͘ϱϵϲϮϬϬ Ψ ϳϵϬ͘ϴϬ &ŝŶĂŶĐŝĂů^ƵƉƉŽƌƚΘƵƐŝŶĞƐƐΕ ϭϮϱϮϱϬϱϲ͘ϱϲϬϬ͘ϱϵϱϮϬϬ Ψ Ϯ͕ϲϬϰ͘ϵϬ &ŝŶĂŶĐŝĂů^ƵƉƉŽƌƚΘƵƐŝŶĞƐƐΕ ϭϮϲϱϲϬϱϲ͘ϱϲϬϬ͘ϱϵϲϮϬϬ Ψ ϴϮϮ͘ϲϬ &ŝŶĂŶĐŝĂů^ƵƉƉŽƌƚΘƵƐŝŶĞƐƐΕ ϭϮϲϱϲΨ ϲ͕ϳϮϮ͘ϱϬϬϯͬϭϳͬϮϬϮϮ ϲϬϴϵϭϵϬϭϭ͘ϭϬϮϲ͘ϱϵϳϬϬϬ Ψ Ϯϵϰ͘ϬϬ DĞĚŝĐĂů^ĞƌǀŝĐĞƐ ϳϰϱϱϴϭϰϬKhWd/KE>,>d,EdZ^K&ϬϬϲϱϴϲͲΨ Ϯϵϰ͘ϬϬϬϯͬϭϳͬϮϬϮϮ ϲϬϴϵϮϬϬϮϬ͘ϭϬϴϰ͘ϱϮϬϬϬϬ Ψ ϭϳ͘ϳϵ WůƵŵďŝŶŐ,ĂƌĚǁĂƌĞΘ^ƵƉƉůŝĞƐΕ ^ϭϮϲϬϮϱϲϬϬϭ Ϭϭϭ͘ϬϬϭϰϴϵϮW>hD/E'Θ/Eh^dZ/>^hWW>zϬϬϭϵϰϯͲΨ ϭϳ͘ϳϵϬϯͬϭϳͬϮϬϮϮ ϲϬϴϵϮϭWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϱϳŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮZ>z,<^sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEd,<EhDZWzDEddϬϭϭ͘ϵϬϭϵ͘ϱϮϬϬϭϬ Ψ ϭ͕ϯϰϬ͘ϬϬ ĂƩĞƌŝĞƐΕ ϰϭϴϴϬ Ϭϭϭ͘ϬϬϭϱϭϱϯWKtZ^/'EϬϬϭϱϭϰͲϬϭϭ͘ϵϬϭϵ͘ϱϮϬϬϭϬ Ψ ϮϭϮ͘ϬϬ ĂƩĞƌŝĞƐΕ ϰϭϴϴϬ Ϭϭϭ͘ϬϬϭϱϭϱϯϬϭϭ͘ϵϬϭϵ͘ϱϮϬϬϭϬ Ψ ϳϯϬ͘ϬϬ WŽǁĞƌĞƐŝŐŶKŶͲƐŝƚĞDĂŝŶƚĞŶĂŶĐĞ͘Ε ϰϭϴϴϬ Ϭϭϭ͘ϬϬϭϱϭϱϯϬϭϭ͘ϵϬϭϵ͘ϱϮϬϬϭϬ Ψ ϭϰϳ͘ϰϰ ^ĂůĞƐdĂǆϵ͘ϱй ϰϭϴϴϬΨ Ϯ͕ϰϮϵ͘ϰϰϬϯͬϭϳͬϮϬϮϮ ϲϬϴϵϮϮϬϭϭ͘ϭϬϰϲ͘ϱϵϬϬϬϬ Ψ ϭ͕Ϭϱϳ͘ϱϬ ĂƌtĂƐŚ^ĞƌǀŝĐĞƐ ϮϵϯϲϯϴYh>/&/DK/>͕/EϬϬϲϲϭϮͲΨ ϭ͕Ϭϱϳ͘ϱϬϬϯͬϭϳͬϮϬϮϮ ϲϬϴϵϮϯϬϭϭ͘ϭϬϮϲ͘ϱϵϲϮϬϬ Ψ ϱϮ͘ϬϬ ZĞŝŵď͘>ŝǀĞ^ĐĂŶ ϬϯϬϴϮϮ^,>zZs>^ϬϬϳϯϯϳͲΨ ϱϮ͘ϬϬϬϯͬϭϳͬϮϬϮϮ ϲϬϴϵϮϰϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϰϮϭ͘ϯϱ WĂƌƚƐ/ŐŶŝƟŽŶDŽĚƵůĞΕ ϯϵϳϰϭ Ϭϭϭ͘ϬϬϭϱϭϯϯ^ΘE'/E͕/EϬϬϭϲϴϱͲϬϭϭ͘ϭϬϰϲ͘ϱϵϬϬϬϬ Ψ Ϯϴϱ͘ϬϬ >ĂďŽƌƚŽZĞƉĂŝƌhŶŝƚ ϯϵϳϰϭ Ϭϭϭ͘ϬϬϭϱϭϯϯϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϰϯ͘ϭϵ ^ĂůĞƐdĂǆϭϬ͘Ϯϱ ϯϵϳϰϭΨ ϳϰϵ͘ϱϰϬϯͬϭϳͬϮϬϮϮ ϲϬϴϵϮϱϬϭϭ͘ϵϬϭϵ͘ϱϵϱϮϭϬ Ψ ϭϮ͕ϲϴϳ͘ϱϬ WƌŽĨĞƐƐŝŽŶĂů^ĞƌǀŝĐĞƐZĞŶĚĞƌĞĚΕ ϴϮϳϲ^/WZ^E͕>>ϬϬϳϬϱϳͲϬϭϭ͘ϵϬϭϵ͘ϱϵϱϮϭϬ Ψ ϭϲ͕ϲϮϱ͘ϬϬ WƌŽĨĞƐƐŝŽŶĂů^ĞƌǀŝĐĞƐZĞŶĚĞƌĞĚΕ ϴϱϳϴΨ Ϯϵ͕ϯϭϮ͘ϱϬϬϯͬϭϳͬϮϬϮϮ ϲϬϴϵϮϲϬϮϬ͘ϭϬϴϰ͘ϱϮϬϬϬϬ Ψ ϯϯ͘ϲϵ ƌƵƐŚĂƐĞDĂƚĞƌŝĂůΕ ϯϳϯϮϵ Ϭϭϭ͘ϬϬϭϰϴϵϯ^hZ/dzWs/E'KDWEz͕/EϬϬϭϴϰϱͲϬϮϬ͘ϭϬϴϰ͘ϱϮϬϬϬϬ Ψ ϯϰ͘ϱϰ ƌƵƐŚĂƐĞDĂƚĞƌŝĂůΕ ϯϳϯϴϱ Ϭϭϭ͘ϬϬϭϰϴϵϯϬϮϬ͘ϭϬϴϰ͘ϱϮϬϬϬϬ Ψ ϳϬ͘ϭϱ ƌƵƐŚĂƐĞDĂƚĞƌŝĂůΕ ϯϳϳϬϱ Ϭϭϭ͘ϬϬϭϰϴϵϯΨ ϭϯϴ͘ϯϴϬϯͬϭϳͬϮϬϮϮ ϲϬϴϵϮϳWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϱϴŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮZ>z,<^sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEd,<EhDZWzDEddϬϱϱ͘ϵϭϵϬ͘ϱϰϬϬϬϬ Ψ ϭϰϯ͘ϴϳ ^ƚĞĞůdŽĞtŽƌŬŽŽƚƐΕ Ϯϵϭϭϳ/E Ϭϱϱ͘ϬϬϬϮϴϴϲ^,KdZ/ϬϬϬϭϳϭͲϬϱϱ͘ϵϬϬϬ͘ϱϰϬϬϬϬ Ψ ϭϭϵ͘Ϭϲ ^ƚĞĞůdŽĞtŽƌŬŽŽƚƐΕ ϮϵϮϳϴ/E Ϭϱϱ͘ϬϬϬϮϴϴϲϬϱϱ͘ϵϭϬϬ͘ϱϰϬϬϬϬ Ψ ϭϮϰ͘ϬϮ ^ƚĞĞůdŽĞtŽƌŬŽŽƚƐΕ ϮϵϮϳϵ/E Ϭϱϱ͘ϬϬϬϮϴϴϲϬϱϱ͘ϵϬϬϬ͘ϱϰϬϬϬϬ Ψ ϵϰ͘Ϯϱ ^ƚĞĞůdŽĞtŽƌŬŽŽƚƐΕ ϮϵϮϴϬ/E Ϭϱϱ͘ϬϬϬϮϴϴϲϬϭϭ͘ϭϬϰϯ͘ϱϮϬϬϬϬ Ψ ϮϬϬ͘ϬϬ ^ƚĞĞůdŽĞtŽƌŬŽŽƚƐΕ Ϯϵϲϯϵ/E Ϭϭϭ͘ϬϬϭϱϬϭϳΨ ϲϴϭ͘ϮϬϬϯͬϭϳͬϮϬϮϮ ϲϬϴϵϮϴϬϱϱ͘ϴϭϬϬ͘ϱϮϬϬϬϬ Ψ ϴϵ͘ϬϬ ƵƐŝŶĞƐƐĂƌĚƐΕ Ϯϳϯϳϳ Ϭϱϱ͘ϬϬϬϮϵϮϴ^/>sΖ^WZ/Ed/E'EdtKZ<ϬϬϯϳϳϱͲϬϱϱ͘ϴϭϬϬ͘ϱϮϬϬϬϬ Ψ ϵ͘ϭϮ ^ĂůĞƐdĂǆϭϬ͘Ϯϱ ϮϳϯϳϳϬϭϭ͘ϭϬϮϲ͘ϱϮϬϬϬϬ Ψ ϳϵ͘ϬϬ ƵƐŝŶĞƐƐĂƌĚƐΕ ϮϳϰϬϵ Ϭϭϭ͘ϬϬϭϱϭϲϭϬϭϭ͘ϭϬϮϲ͘ϱϮϬϬϬϬ Ψ ϴ͘ϭϬ ^ĂůĞƐdĂǆϭϬ͘Ϯϱ ϮϳϰϬϵΨ ϭϴϱ͘ϮϮϬϯͬϭϳͬϮϬϮϮ ϲϬϴϵϮϵϬϱϱ͘ϵϭϬϬ͘ϰϲϰϬϬϬ Ψ ϳ͕ϱϵϬ͘ϬϬ :ŽŝŶƚWŽůĞ͕^ĂůǀĂŐĞƋƵŝƉŵĞŶƚ͕Θ ϳϱϬϭϯϯϬϳϳϮ^K>/^KEϬϬϬϬϱϵͲΨ ϳ͕ϱϵϬ͘ϬϬϬϯͬϭϳͬϮϬϮϮ ϲϬϴϵϯϬWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϱϵŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮZ>z,<^sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEd,<EhDZWzDEddϬϭϭ͘ϭϬϰϴ͘ϱϵϬϬϬϬ Ψ ϲϱ͘ϬϬ WĞƐƚŽŶƚƌŽůϬϳͬϮϭΕ ϰϭϬϯϳϲϰϳϱdZD/E/yKDDZ/>ϬϬϲϵϴϱͲϬϭϭ͘ϭϬϰϵ͘ϱϵϬϬϬϬ Ψ ϭϯϬ͘ϬϬ WĞƐƚŽŶƚƌŽůϬϵͬϮϭΕ ϰϭϮϳϬϳϲϲϱϬϭϭ͘ϭϬϰϴ͘ϱϵϬϬϬϬ Ψ ϴϬ͘ϬϬ WĞƐƚŽŶƚƌŽůϭϭͬϮϭΕ ϰϭϰϱϰϱϭϭϯϬϭϭ͘ϭϬϰϴ͘ϱϵϬϬϬϬ Ψ ϲϱ͘ϬϬ WĞƐƚŽŶƚƌŽůϭϭͬϮϭΕ ϰϭϰϱϰϱϱϴϴϬϭϭ͘ϭϬϰϴ͘ϱϵϬϬϬϬ Ψ ϳϱ͘ϬϬ WĞƐƚŽŶƚƌŽůϭϭͬϮϭΕ ϰϭϰϱϰϱϳϲϰϬϭϭ͘ϭϬϰϵ͘ϱϵϬϬϬϬ Ψ ϭϯϬ͘ϬϬ WĞƐƚŽŶƚƌŽůϭϭͬϮϭΕ ϰϭϰϳϱϱϬϬϱϬϭϭ͘ϭϬϰϵ͘ϱϵϬϬϬϬ Ψ ϲϱ͘ϬϬ WĞƐƚŽŶƚƌŽůϭϮͬϮϭΕ ϰϭϱϱϵϵϳϮϯϬϭϭ͘ϭϬϰϴ͘ϱϵϬϬϬϬ Ψ ϲϱ͘ϬϬ WĞƐƚŽŶƚƌŽůϭϬͬϮϭΕ ϰϭϱϱϵϵϳϴϰϬϭϭ͘ϭϬϰϵ͘ϱϵϬϬϬϬ Ψ ϲϱ͘ϬϬ WĞƐƚŽŶƚƌŽůϬϭͬϮϮΕ ϰϭϲϰϵϲϵϭϲϬϭϭ͘ϭϬϰϵ͘ϱϵϬϬϬϬ Ψ ϴϰ͘ϬϬ WĞƐƚŽŶƚƌŽůϬϭͬϮϮΕ ϰϭϲϰϵϳϭϬϰϬϭϭ͘ϭϬϰϴ͘ϱϵϬϬϬϬ Ψ ϲϱ͘ϬϬ WĞƐƚŽŶƚƌŽůϬϭͬϮϮΕ ϰϭϲϰϵϳϭϴϲϬϭϭ͘ϭϬϰϴ͘ϱϵϬϬϬϬ Ψ ϲϱ͘ϬϬ WĞƐƚŽŶƚƌŽůϬϭͬϮϮΕ ϰϭϲϰϵϳϮϲϰϬϭϭ͘ϭϬϰϴ͘ϱϵϬϬϬϬ Ψ ϳϱ͘ϬϬ WĞƐƚŽŶƚƌŽůϭϬͬϮϭΕ ϰϭϲϰϵϳϯϰϴϬϭϭ͘ϭϬϰϵ͘ϱϵϬϬϬϬ Ψ ϲϱ͘ϬϬ WĞƐƚŽŶƚƌŽůϬϭͬϮϮΕ ϰϭϲϰϵϳϰϳϮϬϭϭ͘ϭϬϰϴ͘ϱϵϬϬϬϬ Ψ ϴϬ͘ϬϬ WĞƐƚŽŶƚƌŽůϬϵͬϮϭΕ ϰϭϲϰϵϳϲϭϲϬϭϭ͘ϭϬϰϵ͘ϱϵϬϬϬϬ Ψ ϲϱ͘ϬϬ WĞƐƚŽŶƚƌŽůϬϭͬϮϮΕ ϰϭϲϳϭϱϱϬϴϬϭϭ͘ϭϬϰϴ͘ϱϵϬϬϬϬ Ψ ϴϱ͘ϬϬ WĞƐƚŽŶƚƌŽůϬϮͬϮϴΕ ϰϭϳϲϱϬϵϬϬϬϭϭ͘ϭϬϰϵ͘ϱϵϬϬϬϬ Ψ ϴϰ͘ϬϬ WĞƐƚŽŶƚƌŽůϬϮϮϴΕ ϰϭϳϲϱϭϬϱϰϬϭϭ͘ϭϬϰϵ͘ϱϵϬϬϬϬ Ψ ϲϵ͘ϬϬ WĞƐƚŽŶƚƌŽůϬϮͬϮϮΕ ϰϭϳϲϱϭϭϮϱϬϭϭ͘ϭϬϰϴ͘ϱϵϬϬϬϬ Ψ ϲϵ͘ϬϬ WĞƐƚŽŶƚƌŽůϬϮϮϮΕ ϰϭϳϲϱϭϭϴϬϬϭϭ͘ϭϬϰϴ͘ϱϵϬϬϬϬ Ψ ϲϵ͘ϬϬ WĞƐƚŽŶƚƌŽůϬϮͬϮϮΕ ϰϭϳϲϱϭϯϰϵϬϭϭ͘ϭϬϰϴ͘ϱϵϬϬϬϬ Ψ ϴϬ͘ϬϬ WĞƐƚŽŶƚƌŽůϬϮͬϮϮΕ ϰϭϳϲϱϭϰϮϭϬϭϭ͘ϭϬϰϵ͘ϱϵϬϬϬϬ Ψ ϭϰϮ͘ϬϬ WĞƐƚŽŶƚƌŽůϬϮͬϮϮΕ ϰϭϳϳϬϮϬϭϬWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϲϬŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮZ>z,<^sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEd,<EhDZWzDEddΨ ϭ͕ϴϯϳ͘ϬϬϬϯͬϭϳͬϮϬϮϮ ϲϬϴϵϯϭϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϭ͕ϬϭϬ͘ϮϬ dŝƌĞƐΕ ϮϱϴϴϬϵϳϱ Ϭϭϭ͘ϬϬϭϱϭϰϭd/Z,h͕>>ϬϬϲϯϳϭͲϬϭϭ͘ϭϬϰϲ͘ϱϵϬϬϬϬ Ψ ϴ͘ϳϱ ĂůŝĨŽƌŶŝĂ&ĞĞ ϮϱϴϴϬϵϳϱ Ϭϭϭ͘ϬϬϭϱϭϰϭϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϵϱ͘ϵϳ ^ĂůĞƐdĂǆϵ͘ϱй ϮϱϴϴϬϵϳϱϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϲϳϱ͘ϬϬ dŝƌĞƐΕ ϮϱϴϵϲϮϴϲ Ϭϭϭ͘ϬϬϭϱϭϰϬϬϭϭ͘ϭϬϰϲ͘ϱϵϬϬϬϬ Ψ ϴ͘ϳϱ dŝƌĞ&ĞĞ ϮϱϴϵϲϮϴϲ Ϭϭϭ͘ϬϬϭϱϭϰϬϬϭϭ͘ϭϬϰϲ͘ϱϮϬϬϬϬ Ψ ϲϰ͘ϭϯ ^ĂůĞƐdĂǆϵ͘ϱй ϮϱϴϵϲϮϴϲΨ ϭ͕ϴϲϮ͘ϴϬϬϯͬϭϳͬϮϬϮϮ ϲϬϴϵϯϮϬϭϭ͘ϭϬϯϯ͘ϱϲϬϬϬϬ Ψ ϮϮϱ͘ϬϬ ,ǇĚƌĂŶƚ ϬϭϬϭϮϮdZ/Ͳ/dzDhdh>tdZKDWEzϬϬϬϮϴϮͲϬϭϭ͘ϭϬϯϯ͘ϱϲϬϬϬϬ Ψ ϮϮϱ͘ϬϬ ,ǇĚƌĂŶƚ ϬϮϬϭϮϮϬϭϭ͘ϭϬϯϯ͘ϱϲϬϬϬϬ Ψ ϮϮϱ͘ϬϬ ,ǇĚƌĂŶƚ ϬϯϬϭϮϮϬϭϭ͘ϭϬϯϯ͘ϱϲϬϬϬϬ Ψ ϮϮϱ͘ϬϬ ,ǇĚƌĂŶƚ ϭϮϬϭϮϭΨ ϵϬϬ͘ϬϬϬϯͬϭϳͬϮϬϮϮ ϲϬϴϵϯϯϬϱϱ͘ϴϰϬϬ͘ϱϵϬϬϬϬ Ψ ϭ͕ϵϴϲ͘ϬϬ &ĞŶĐŝŶŐΘZĞƉĂŝƌƐ ϭϵϲϳϵhE/d^d>&EKDWEzϬϬϱϬϯϬͲΨ ϭ͕ϵϴϲ͘ϬϬϬϯͬϭϳͬϮϬϮϮ ϲϬϴϵϯϰϬϭϭ͘ϰϬϯϭ͘ϱϰϬϬϬϬ Ψ ϱ͕ϭϴϰ͘ϭϱ sĞƌŶŽŶWŽůŝĐĞϵͬϭϭŶŶŝǀĞƌƐĂƌǇĂĚŐĞƐ͘ ϱϯϰϵϬZs/^ Ϭϭϭ͘ϬϬϭϰϵϳϴsΘsDEh&dhZ/E'͕/EϬϬϬϯϱϯͲϬϭϭ͘ϰϬϯϭ͘ϱϰϬϬϬϬ Ψ ͲϰϵϮ͘ϰϵ ĚũƵƐƚŵĞŶƚ ϱϯϰϵϬZs/^ Ϭϭϭ͘ϬϬϭϰϵϳϴϬϭϭ͘ϰϬϯϭ͘ϱϰϬϬϬϬ Ψ ϰϵϮ͘ϰϵ ^ĂůĞƐdĂǆϵ͘ϱй ϱϯϰϵϬZs/^Ψ ϱ͕ϭϴϰ͘ϭϱϬϯͬϭϳͬϮϬϮϮ ϲϬϴϵϯϱWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϲϭŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮZ>z,<^sEKZEDEEhDZKhEdEhDZ/EsK/DKhEd^Z/Wd/KE/EsK/W͘K͘ηWzDEdDKhEd,<EhDZWzDEddϬϭϭ͘ϭϬϰϯ͘ϱϵϬϬϬϬ Ψ ϭ͕ϬϴϬ͘ϬϬ hƌďĂŶ&ŽƌĞƐƚDĂŶĂŐĞŵĞŶƚ^ĞƌǀŝĐĞƐ ϭϴϯϬϵϱt^dK^dZKZ/^d^͕/EϬϬϬϯϭϳͲΨ ϭ͕ϬϴϬ͘ϬϬϬϯͬϭϳͬϮϬϮϮ ϲϬϴϵϯϲϬϭϭ͘ϭϬϰϴ͘ϱϵϲϮϬϬ Ψ ϭϬϬ͘ϬϬ ƩĞŶĚĂŶĐĞ^ƟƉĞŶĚΕ ϬϯϭϬϮϮDZ>E>^zZZϬϬϲϳϭϲͲΨ ϭϬϬ͘ϬϬϬϯͬϭϳͬϮϬϮϮ ϲϬϴϵϯϳdKd>Z>z,<^Ψ ϵϭϬ͕Ϭϰϱ͘ϯϳWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϲϮŽĨϲϯ /dzK&sZEKEKWZd/E'KhEdtZZEdZ'/^dZEK͘ϴϰWZ/>ϱ͕ϮϬϮϮZWz&hE&hE>dZKE/dKd>Z>z,<dKd>tZZEddKd>'ZEdKd>^Ψ ϭ͕ϵϵϴ͕ϴϬϰ͘ϵϰΨ Ϯ͕ϰϱϲ͕ϰϭϯ͘ϮϭΨϬ͘ϬϬΨ ϰϱϳ͕ϲϬϴ͘ϮϳϬϭϭͲ'EZ>ϲϮϴ͕ϮϵϮ͘ϰϰϳϭϱ͕ϱϭϮ͘ϳϯϬ͘ϬϬϴϳ͕ϮϮϬ͘ϮϵϬϮϬͲtdZϲ͕ϭϮϵ͕ϵϳϳ͘ϲϬϲ͕ϰϴϬ͕ϰϵϯ͘ϵϳϬ͘ϬϬϯϱϬ͕ϱϭϲ͘ϯϳϬϱϱͲ>/',dΘWKtZϵϭϮ͕ϭϳϵ͘ϮϴϵϮϲ͕ϴϳϵ͘ϳϮϬ͘ϬϬϭϰ͕ϳϬϬ͘ϰϰϬϱϲͲEdhZ>'^ϯϳ͕ϱϵϭ͘ϱϭϯϳ͕ϱϵϭ͘ϱϭϬ͘ϬϬϬ͘ϬϬϬϱϳͲ&/ZKWd/'ZEdKd>Ψ ϭϬ͕ϲϭϲ͕ϴϵϭ͘ϭϰΨϬ͘ϬϬΨ ϵϭϬ͕Ϭϰϱ͘ϯϳΨ ϵ͕ϳϬϲ͕ϴϰϱ͘ϳϳdKd>,<^dKWZ/EdϬWƌŝŶƚĞĚ͗ϯͬϮϴͬϮϬϮϮϭϮ͗ϱϲ͗ϱϬWDWĂŐĞϲϯŽĨϲϯWĂŐĞ ! !" #$ % !& ' # ( ( ) ## # # $ & ' # )& *& $ % ! Construction Value Number of Permits Year to Date Value Year to Date Permits Construction Value Number of Permits Year to Date Value Year to Date Permits Permit Difference Valuation Difference January 4,464,611$ 62 4,464,611$ 62 1,813,324$ 29 1,813,324$ 29 -53% -59% February 5,711,149$ 45 10,175,760$ 107 2,895,873$ 31 4,709,197$ 60 -44% -54% March April May June July August September October November December 2021 2022 Year to Date Monthly Report Summary City of Vernon Building Division 0 10 20 30 40 50 60 70 $- $1,000,000 $2,000,000 $3,000,000 $4,000,000 $5,000,000 $6,000,000 Monthly 2021 Construction Value 2022 Construction Value 2021 Number of Permits 2022 Number of Permits 0 20 40 60 80 100 120 $- $2,000,000 $4,000,000 $6,000,000 $8,000,000 $10,000,000 $12,000,000 Year to Date 2021 Year to Date Value 2022 Year to Date Value 2021 Year to Date Permits 2022 Year to Date Permits Value 10 2 1 2 10 6 31 60 45$5,711,149.00 $4,464,611.00 62 $10,175,760.00 107 29 YEAR TO DATE TOTAL $4,709,196.50 February 2021 TOTALS PERMITS: PREVIOUS MONTHS TOTAL PRIOR YEAR TO DATE TOTAL Plumbing $338,931.00 February 2022 TOTALS PERMITS:$2,895,873.00 PREVIOUS MONTHS TOTAL $1,813,323.50 Industrial - Remodel $2,000.00 Mechanical $100,967.00 Miscellaneous $1,228,775.00 City of Vernon Building Department Monthly Report from 2/1/2022 to 2/28/2022 Type # of Permits Electrical $652,700.00 Grading $572,500.00 None City of Vernon Building Department Demolition Report -)HEUXDU\ 1RQH City of Vernon Building Department New Buildings Report - )HEUXDU\ !" # $ %& ' !"#$ ! % "$" &' "('%$) *("+ ,, +- * ."#$ %% /0' "('+-123- ,, !"#$ %!% "$" &' "(' /4 0 ',, ) - ) ."#$ ()* "+ ,- . % % * %534206 $) ,, 7 % & 3 34 "#$ % * #8 , 7 ,, 3 ) 8% ."#$ )/0 /"+ ,- 1 ! %%* 3,4 ,, 94 : 3 94 7- %"#$ ) "+ ,- % *'0:#' "(' ;. 7 4 , .. 7 %"#$ $6 :8 3 , 94 343 )4 7,4 4 3 7 - !"#$ %. % * .!! 7 9, 7 43) - 3 3, 3,4 )) ) &< %!.. % !"#$ %. % "$6$ 0(6 .!! 7 43) 9, - 3 3, 3,4 )) ) &<2%. % "#$ !" # $ %& /0' "(':8 3 , , 8 3 , ::* , ::* 39 8 % ! 4 3 , ) 4 7 8 = 8 =; ::* ,7 "#$ %! /0' "('$4 4 , !"#$ *) ** *0/"+ ,- & %!.. % * =8 = " 7 9, 7 43) - 3 3, 3,4 )) ) % !"#$ %. % "$6$ 0(6 7 43) 9, - 3 3, 3,4 )) ) % "#$ %% * #4 7 ,271 343 34 ) 3 8 * 3 ,3 ) 4 3 ,3 3 , 3 & *3 %"#$ 2 )22 "+ ,- *) 0*3 0/" ,- $ 4 1 5 City of Vernon Building Department Status of Certificates of Occupancy Requests Month of )HEUXDU\ Request for Inspection Approved Pending Temporary Occupancies City of Vernon Certificate of Occupancy Applications Date From 2/1/2022 to 2/28/2022 Permit No. Project Address DescriptionTenant Square FeetFees PaidIssued C-2022-1861 4569 MAYWOOD AVE Romaine Empire Dba Farmer's Fridge 10241Packaged food storage and distribution 885.00 6304028033APN C-2022-1862 2803 SANTA FE AVE One and Only Collective Inc. 5920Garment wholesale and storage 0.00 6302007023APN C-2022-1863 4201 ROSS ST Brinks Inc. 31497Cash logistics 885.00 6302017048APN C-2022-1864 4770 DISTRICT BLVD 1338164 B.C. LTD 4100Warehouse home workout equipment 385.00 6304015013APN C-2022-1865 5401 SOTO ST New Media Retail Concepts LLC 100Wholesale apparel 385.00 6309026032APN C-2022-1866 5401 SOTO ST Private Brands LLC 100Wholesale apparel 385.00 6309026032APN C-2022-1867 5401 SOTO ST Seven Internet LLC 428Wholesale apparel 385.00 6309026032APN C-2022-1868 5401 SOTO ST Diane Gilman Jeans LLC 852Wholesale apparel 385.00 6309026032APN C-2022-1869 5401 SOTO ST Seven Licensing Co LLC 100Wholesale apparel 385.00 6309026032APN C-2022-1870 5401 SOTO ST Heroes Producs LLC 1496Wholesale apparel 385.00 6309026032APN C-2022-1871 5401 SOTO ST House of Pliner LLC 100Wholesale apparel 385.00 6309026032APN C-2022-1872 5401 SOTO ST Dutch Apparel LLC 1558Wholesale apparel 385.00 6309026032APN C-2022-1873 5401 SOTO ST Sunrise Apparel Group LLC 462Wholesale apparel 385.00 6309026032APN C-2022-1874 5401 SOTO ST Sunrise Brands LLC 7713Wholesale apparel 885.00 6309026032APN C-2022-1875 4425 49TH ST Complete Clothing Company 19116Warehouse and manufacture apparel 885.00 6304025014APN C-2022-1876 4154 BANDINI BLVD 88 Logistics, Inc. 39560Warehousing and distribution of general merchandise 885.00 6304003001APN C-2022-1877 4280 BANDINI BLVD Trilogy Medwaste West, LLC 14923Biohazard waste, steam sterilization. Reusable container washing. 885.00 6304004021APN 1 Permit No. Project Address DescriptionTenant Square FeetFees PaidIssued Certificate of Occupancy 138,266.00Total for Certificate of Occupancy: 9,160.00 Total Fees Paid 9,160.00Permits(s)17 2 City of Vernon Certificate of Occupancy Issued Date From 2/1/2022 to 2/28/2022 Permit No. Project Address DescriptionTenant Square FeetFees PaidIssued C-2022-1857 4340 DISTRICT BLVD Moka Wholesale LLC 5000Warehousing and distribution of general merchandise 385.002/7/2022 6304023023APN C-2022-1855 4120 BANDINI BLVD Southwest Processors Inc. 40453Waste water and grease treatment facility 1,770.002/7/2022 6304003008APN C-2021-1618 5770 ANDERSON ST Digifab Systems, Inc. 8904Digital printing 885.002/7/2022 6308019020APN C-2021-1798 4615 48TH ST L.A. Designs, Inc. Dba Jesse Blessings-Creations 10000Screenprinting of shirts 885.002/7/2022 6304019024APN C-2021-1839 2734 46TH ST C. Luce, Inc. 31360Office and warehousing & distribution of clothing 885.002/9/2022 6308002014APN C-2021-1737 2761 FRUITLAND AVE Jaya Apparel Group, LLC 11097Garment manufacturing 1,770.002/17/2022 6308002006APN 106,814.00Total for Certificate of Occupancy: 6,580.00 Total Fees Paid 6,580.00Permits(s)6 1 !" #$ %! &'!%%!%! ! ( !" # $ %! &'!% %! %! ) !* +,+-.-/,+-.-01 ! ! !1 !*!" !2 ! ' ! !!)(' !*3!4 !*! 5! !*! 2 )(' ( (*6 !(!! 2(6!*!" !2 ! ! !/!! (!* 0 (!! ! !( ! ! (! !! ) ( + (3!' '! ! # 7!) +8. '(.)+5!(3!'! ! ! !2 ! !2(( ! ,+-.-) ! ' (9( 21 !( 9! !*! (!-! ! ! ) ( ' ! 1 " ! ! * ! ! ! !* ! " 2 ! ! !)( !1 ( * !" # $ &'!%%!%! ! !2(,+-.-) ** * ! ( !" # $ &'! % %!%! !2(,+-.-"( :/:0 +& 2 ! 1 ) *! ( ! !* ! 2 ! ( ; ! % !7!))<)+5) *!(!!* &! ! ( !*!(' ) +)* !" #$ &'!%%!%! )7!*!!*%! Recovered Organic Waste and Recycled-Content Paper Procurement Policy City of Vernon RECOVERED ORGANIC WASTE AND RECYCLED-CONTENT PAPER PROCUREMENT POLICY TABLE OF CONTENTS SECTION 1. PURPOSE.................................................................................................1 SECTION 2. DEFINITIONS............................................................................................1 SECTION 3. RECOVERED ORGANIC WASTE PRODUCT PROCUREMENT ............4 3.1 Procurement Target......................................................................................4 3.2 Requirements for City Departments .............................................................5 3.3 Requirements for Direct Service Providers...................................................6 SECTION 4. RECYCLED-CONTENT PAPER PROCUREMENT..................................8 4.1 Requirements for City Departments .............................................................8 4.2 Requirements for Vendors............................................................................9 SECTION 5. RECORDKEEPING RESPONSIBILITIES...............................................10 SECTION 6. EFFECTIVE DATE OF POLICY..............................................................11 City of Vernon Recovered Organic Waste Page 1 of 11 and Recycled-Content Paper Procurement Policy RECOVERED ORGANIC WASTE AND RECYCLED- CONTENT PAPER PROCUREMENT POLICY SECTION 1. PURPOSE A. It is the policy of the City of Vernon, applicable to all City departments, and direct service providers to the City of Vernon, as applicable, to incorporate environmental considerations including recycled-content and recovered Organic Waste product use into purchasing practices and procurement. This Recovered Organic Waste and Recycled-Content Paper Procurement Policy (Policy) will help the City to: 1. Protect and conserve natural resources, water, and energy; 2. Minimize the City’s contribution to climate change, pollution, and solid waste disposal; and 3. Comply with State requirements as contained in 14 CCR Division 7, Chapter 12, Article 12 (SB 1383 procurement regulations) to procure a specified amount of Recovered Organic Waste Products to support Organic Waste disposal reduction targets and markets for products made from recycled and recovered Organic Waste materials, and to purchase Recycled- Content Paper Products and Recycled-Content Printing and Writing Paper. SECTION 2. DEFINITIONS A. “City” means the City of Vernon. B. “Annual Recovered Organic Waste Product Procurement Target” means the amount of Organic Waste in the form of a Recovered Organic Waste Product that the City is required to procure annually under 14 CCR Section 18993.1. This target shall be calculated by multiplying the per capita procurement target, which shall be 0.08 tons of Organic Waste per California resident per year, times the City’s residential population using the most recent annual data reported by the California Department of Finance. Annually, CalRecycle will provide notice to each jurisdiction of its Annual Recovered Organic Waste Product Procurement Target by posting such information on CalRecycle’s website and providing written notice directly to the jurisdiction. C. “Compost” means the product resulting from the controlled biological decomposition of organic solid wastes that are source separated from the municipal solid waste stream or which are separated at a centralized facility or as otherwise defined in 14 CCR Section 17896.2(a)(4). City of Vernon Recovered Organic Waste and Page 2 of 11 Recycled-Content Paper Procurement Policy Compost eligible for meeting the Annual Recovered Organic Waste Product Procurement Target must be produced at a compostable material handling operation or facility permitted or authorized under 14 CCR Chapter 3.1 of Division 7 or produced at a large volume in-vessel digestion facility that composts on-site as defined and permitted under 14 CCR Chapter 3.2 of Division 7. Compost shall meet the State’s composting operations regulatory requirements. D. “Direct Service Provider” means a person, company, agency, district, or other entity that provides a service or services to City of Vernon pursuant to a contract or other written agreement or as otherwise defined in 14 CCR Section 18982(a)(17). E. “Electricity Procured from Biomass Conversion” means electricity generated from biomass facilities that convert recovered Organic Waste, such as wood and prunings from the municipal stream, into electricity. Electricity procured from a biomass conversion facility may only count toward the City’s Annual Recovered Organic Waste Product Procurement Target if the facility receives feedstock directly from certain permitted or authorized compostable material handling operations or facilities, transfer/processing operations or facilities, or landfills, as described in 14 CCR Section 18993.1(i). F. “Organic Waste” means solid wastes containing material originated from living organisms and their metabolic waste products including, but not limited to, food, yard trimmings, organic textiles and carpets, lumber, wood, Paper Products, Printing and Writing Paper, manure, biosolids, digestate, and sludges, or as otherwise defined in 14 CCR Section 18982(a)(46). Biosolids and digestate are as defined in 14 CCR Section 18982(a)(4) and 14 CCR Section 18982(a)(16.5), respectively. G. “Paper Products” include, but are not limited to, paper janitorial supplies, cartons, wrapping, packaging, file folders, hanging files, corrugated boxes, tissue, and toweling; or as otherwise defined in 14 CCR Section 18982(a)(51). H. “Printing and Writing Papers” include, but are not limited to, copy, xerographic, watermark, cotton fiber, offset, forms, computer printout paper, white wove envelopes, manila envelopes, book paper, note pads, writing tablets, newsprint, and other uncoated writing papers, posters, index cards, calendars, brochures, reports, magazines, and publications; or as otherwise defined in 14 CCR Section 18982(a)(54). I. “Procurement of Recovered Organic Waste Products” shall mean purchase or acquisition (e.g., free delivery or free distribution from a hauler or other entity via a written agreement or contract), and end use by the City or others. The City’s Annual Recovered Organic Waste Product Procurement Target can be fulfilled directly by the City or by Direct Service Providers through written contracts or City of Vernon Recovered Organic Waste and Page 3 of 11 Recycled-Content Paper Procurement Policy agreements for Procurement of Recovered Organic Waste Products at the City’s behest. J. “Publicly-Owned Treatment Works” or “POTW” has the same meaning as in Section 403.3(r) of Title 40 of the Code of Federal Regulations. K. “Recovered Organic Waste Products” means products made from California, landfill-diverted recovered Organic Waste processed at a permitted or otherwise authorized operation or facility, or as otherwise defined in 14 CCR Section 18982(a)(60). Products that can be used to meet the Annual Recovered Organic Waste Product Procurement Target shall include Compost, SB 1383 Eligible Mulch, Renewable Gasfrom an in-vessel digestion facility, and ElectricityProcured from Biomass Conversion as described herein and provided that such products meet requirements of 14 CCR, Division 7, Chapter 12, Article 12. L. “Recordkeeping Designee” means the public employee appointed by the City Director of Finance or their designee to track procurement and maintain records of Recovered Organic Waste Product procurement efforts both by the City and others, if applicable, as required by 14 CCR, Division 7, Chapter 12, Articles 12 and 13. M. "Recyclability" means that the Paper Products and Printing and Writing Paper offered or sold to the City are eligible to be labeled with an unqualified recyclable label as defined in 16 Code of Federal Regulations Section 260.12 (2013). N. “Recycled-Content Paper Products and Recycled-Content Printing and Writing Paper” means such products that consist of at least thirty percent (30%), by fiber weight, postconsumer fiber, consistent with the requirements of Sections 22150 to 22154 and Sections 12200 and 12209 of the Public Contract Code,and as amended. O. “Renewable Gas” means gas derived from Organic Waste that has been diverted from a landfill and processed at an in-vessel digestion facility that is permitted or otherwise authorized by 14 CCR to recover Organic Waste, or as otherwise defined in 14 CCR Section 18982(a)(62). P. “SB 1383” means Senate Bill 1383 of 2016 approved by the Governor on September 19, 2016, which added Sections 39730.5, 39730.6, 39730.7, and 39730.8 to the Health and Safety Code, and added Chapter 13.1 (commencing with Section 42652) to Part 3 of Division 30 of the Public Resources Code, establishing methane emissions reduction targets in a statewide effort to reduce emissions of short-lived climate pollutants, as amended, supplemented, superseded, and replaced from time to time. Q. “SB 1383 Regulations” or “SB 1383 Regulatory” means or refers to, for the purposes of this policy, the Short-Lived Climate Pollutants (SLCP): Organic Waste City of Vernon Recovered Organic Waste and Page 4 of 11 Recycled-Content Paper Procurement Policy Reductions regulations developed by CalRecycle and adopted in 2020 that created Chapter 12 of 14 CCR, Division 7 and amended portions of regulations of 14 CCR and 27 CCR. R. “SB 1383 Eligible Mulch” means mulch eligible to meet the Annual Recovered Organic Waste Product Procurement Target, pursuant to 14 CCR Chapter 12 of Division 7. This SB 1383 Eligible Mulch shall meet the following conditions for the duration of the applicable procurement compliance year, as specified by 14 CCR Section 18993.1(f)(4): 1. Produced at one of the following facilities: i. A compostable material handling operation or facility as defined in 14 CCR Section 17852(a)(12), that is permitted or authorized under 14 CCR Division 7, other than a chipping and grinding operation or facility as defined in 14 CCR Section 17852(a)(10); ii. A transfer/processing facility or transfer/processing operation as defined in 14 CCR Sections 17402(a)(30) and (31), respectively, that is permitted or authorized under 14 CCR Division 7; or iii. A solid waste landfill as defined in Public Resources Code Section 40195.1 that is permitted under 27 CCR Division 2. 2. Meet or exceed the physical contamination, maximum metal concentration, and pathogen density standards for land application specified in 14 CCR Sections 17852(a)(24.5)(A)1 through 3, as enforced by City of Vernon Municipal Code Chapter 8.14. S. “State” means the State of California. SECTION 3. RECOVERED ORGANIC WASTE PRODUCT PROCUREMENT 3.1 Procurement Target A. The City will annually procure for use or giveaway a quantity of Recovered Organic Waste Products that meets or exceeds its Annual Recovered Organic Waste Product Procurement Target through the implementation of Sections 3 through 5 of this Policy. B. To be eligible to meet the Annual Recovered Organic Waste Product Procurement Target, products that may be procured include the following (provided that each product meets the criteria included in their respective definition in Section 2 of this Policy): 1. SB 1383 eligible Compost (as defined in Section 2.B). City of Vernon Recovered Organic Waste and Page 5 of 11 Recycled-Content Paper Procurement Policy 2. SB 1383 Eligible Mulch (as defined in Section 2.R). 3. Renewable Gas (in the form of transportation fuel, electricity, or heat) (as defined in Section 2.O). 4. Electricity Procured from Biomass Conversion (as defined in Section 2.D). 3.2 Requirements for City Departments A. Electricity Procured from Biomass Conversion. For Electricity Procured from Biomass Conversion, the City shall: 1. Procure electricity from a biomass conversion facility that receives feedstock from a composting facility, transfer/processing facility, a solid waste landfill, and/or receives feedstock from the generator or employees on behalf of the generator of the Organic Waste and to the degree that it is available and practicable for the City and to help meet the Annual Recovered Organic Waste Product Procurement Target, which requires compliance with criteria specified in 14 CCR Section 18993.1. 2. Maintain records and conduct the following recordkeeping activities: a. General procurement records, including: (i) General description of how and where the product was used and applied, if applicable; (ii) Source of product, including name, physical location, and contact information for each entity, operation, or facility from whom the Recovered Organic Waste Products were procured; (iii) Type of product; (iv) Quantity of each product; and (v) Invoice or other record demonstrating purchase or procurement. b. Receive written notification by an authorized representative of the biomass conversion facility certifying that biomass feedstock was received from a permitted solid waste facility identified in 14 CCR Section 18993.1(i). c. Provide these records to the Recordkeeping Designee. City of Vernon Recovered Organic Waste and Page 6 of 11 Recycled-Content Paper Procurement Policy 3.3 Requirements for Direct Service Providers A. Direct Service Providers of landscaping maintenance, renovation, and construction shall: 1. Use Compost and SB 1383 Eligible Mulch, as practicable, produced from recovered Organic Waste, as defined in Section 2.B and 2.R of this Policy, for all landscaping renovations, construction, or maintenance performed for the City, whenever available, and capable of meeting quality standards and criteria specified. SB 1383 Eligible Mulch used for land application shall comply with 14 CCR, Division 7, Chapter 12, Article 12 and must meet or exceed the physical contamination, maximum metal concentration and pathogen density standards specified in 14 CCR Section 17852(a)(24.5)(A)(1) through (3). 2. If Direct Service Provider is subject to the City’s WELO pursuant to City of Vernon Municipal Code Chapter 8.14, comply with one of the following, whichever is more stringent: (i) the locally-adopted WELO that is more stringent than the State’s MWELO, or (ii) Sections 492.6 (a)(3)(B), (C), (D), and (G) of the State’s MWELO, Title 23, Division 2, Chapter 2.7 of the CCR, as amended September 15, 2015, which requires the submittal of a landscape design plan with a “Soil Preparation, Mulch, and Amendments Section” to include the following: a. For landscape installations, Compost at a rate of a minimum of 4 cubic yards per 1,000 square feet of permeable area shall be incorporated to a depth of six (6) inches into the soil. Soils with greater than six percent (6%) organic matter in the top six (6) inches of soil are exempt from adding Compost and tilling. b. Apply a minimum three- (3) inch layer of mulch on all exposed soil surfaces of planting areas except in turf areas, creeping or rooting groundcovers, or direct seeding applications where mulch is contraindicated. To provide habitat for beneficial insects and other wildlife, leave up to five percent (5%) of the landscape area without mulch. Designated insect habitat must be included in the landscape design plan as such. c. Procure organic mulch materials made from recycled or post- consumer materials rather than inorganic materials or virgin forest products unless the recycled post-consumer organic products are not locally available. Organic mulches are not required where prohibited by local Fuel Modification Plan Guidelines or other applicable local ordinances. d. For all mulch that is land applied, procure SB 1383 Eligible Mulch City of Vernon Recovered Organic Waste and Page 7 of 11 Recycled-Content Paper Procurement Policy that meets or exceeds the physical contamination, maximum metal concentration, and pathogen density standards for land applications specified in 14 CCR Section 17852(a)(24.5)(A)(1) through (3). 3. Keep and provide records of Procurement of Recovered Organic W aste Products (either through purchase or acquisition) to Recordkeeping Designee, on a schedule to be determined by Recordkeeping Designee. Information to be provided shall include: a. General description of how and where the product was used and if applicable, applied; b. Source of product, including name, physical location, and contact information for each entity, operation, or facility from whom the Recovered Organic Waste Products were procured; c. Type of product; d. Quantity of each product; and e. Invoice or other record demonstrating purchase or procurement. B. Direct Service Provider of Organic Waste collection services shall: 1. Provide a specified quantity of Compost or SB 1383 Eligible Mulch to the City and its customers via periodic “giveaways” as specified in a franchise agreement or other agreement. 2. Keep and provide records to the City including the following: a. Dates provided; b. Source of product including name, physical location and contact information for each entity, operation or facility from whom the Recovered Organic Waste Products were procured; c. Type of product; d. Quantity provided; and e. Invoice or other record or documentation demonstrating purchase, procurement, or transfer of material to giveaway location. C. Renewable Gas procurement by Direct Service Providers 1. Direct Service Providers transporting solid waste, organic materials, and/or recyclable materials shall include a price preference to contractors of their City of Vernon Recovered Organic Waste and Page 8 of 11 Recycled-Content Paper Procurement Policy fuel as Renewable Gas if required to do so in RFPs and RFQs released by the City for such services or as required by permit, license, written agreement, or written contract with the City. 2. Departments releasing RFPs and RFQs for contractors that procure fuel in the course of their services to the City shall include a price preference to contractors that propose to use the amount or percentage of Renewable Gas specified in the RFP or RFQ to be eligible for said price preference. Such use, if it occurs, shall be documented in a written contract or agreement. 3. If Renewable Gas made from recovered Organic Waste is used by Direct Service Providers, Direct Service Providers shall submit information listed in Section 3.3.B.2.a-e on a schedule to be determined by the City, but not less than annually to the Recordkeeping Designee. 4. Renewable Gas used by Direct Service Providers under Sections 3.3.A and 3.3.B shall comply with criteria specified in 14 CCR Section 18993.1. SECTION 4. RECYCLED-CONTENT PAPER PROCUREMENT 4.1 Requirements for City Departments A. If fitness and quality of Recycled-Content Paper Products and Recycled-Content Printing and Writing Paper are equal to that of non-recycled items, all departments and divisions of the City shall purchase Recycled-Content Paper Products and Recycled-Content Printing and Writing Paper (rather than non-recycled items) that consists of at least thirty percent (30%), by fiber weight, postconsumer fiber, consistent with the requirements of the Public Contract Code, Sections 22150 through 22154 and Sections 12200 and 12209, as amended. B. All Paper Products and Printing and Writing Paper shall be eligible to be labeled with an unqualified recyclable label as defined in Title 16 Code of Federal Regulations Section 260.12 (2013). C. Provide records to the Recordkeeping Designee of all Paper Products and Printing and Writing Paper purchases on a schedule to be determined by Recordkeeping Designee (both recycled-content and non-recycled content, if any is purchased) made by a division or department or employee of the City. Records shall include a copy of the invoice or other documentation of purchase, written certifications as required in Section 4.2.A.3-4 for recycled-content purchases, vendor name, purchaser name, quantity purchased, date purchased, and recycled content (including products that contain none), and if non-Recycled-Content Paper Products and/or non-Recycled-Content Printing and Writing Paper are provided, include a description of why Recycled-Content Paper Products and/or Recycled- Content Printing and Writing Paper were not provided. City of Vernon Recovered Organic Waste and Page 9 of 11 Recycled-Content Paper Procurement Policy 4.2 Requirements for Vendors A. All vendors that provide Paper Products (including janitorial Paper Products) and Printing and Writing Paper to City shall: 1. Provide Recycled-Content Paper Products and Recycled-Content Printing and Writing Paper that consists of at least thirty percent (30%), by fiber weight, postconsumer fiber, if fitness and quality are equal to that of non- recycled item. 2. Only provide Paper Products and Printing and Writing Papers that meet Federal Trade Commission Recyclability standard as defined in Title 16 Code of Federal Regulations Section 260.12 (2013). 3. Certify in writing, under penalty of perjury, the minimum percentage of postconsumer material in the Paper Products and Printing and Writing Paper offered or sold to the City of Vernon. This certification requirement may be waived if the percentage of postconsumer material in the Paper Products, Printing and Writing Paper, or both can be verified by a product label, catalog, invoice, or a manufacturer or vendor internet website. 4. Certify in writing, under penalty of perjury, that the Paper Products and Printing and Writing Paper offered or sold to the City are eligible to be labeled with an unqualified recyclable label as defined in Title 16 Code of Federal Regulations Section 260.12 (2013). 5. Provide records to the Recordkeeping Designee of all Paper Products and Printing and Writing Paper purchased from the vendor o n a schedule to be determined by Recordkeeping Designee (both recycled-content and non- recycled content, if any is purchased) made by a division or department or employee of the City of Vernon. Records shall include a copy of the invoice or other documentation of purchase, written certifications as required in Section 4.2.A.3-4 for recycled-content purchases, purchaser name, quantity purchased, date purchased, and recycled content (including products that contain none), and if non-Recycled-Content Paper Products and/or non- Recycled-Content Printing and Writing Paper are provided, include a description of why Recycled-Content Paper Products and/or Recycled- Content Printing and Writing Paper were not provided. B. All vendors providing printing services to the City via a printing contract or written agreement, shall use Printing and Writing Paper that consists of at least thirty percent (30%), by fiber weight, postconsumer fiber, or as amended by Public Contract Code Section 12209. City of Vernon Recovered Organic Waste and Page 10 of 11 Recycled-Content Paper Procurement Policy SECTION 5. RECORDKEEPING RESPONSIBILITIES A. The Finance Department will be the responsible department and will select an employee to act as the Recordkeeping Designee that will be responsible for obtaining records pertaining to Procurement of Recovered Organic Waste Products and Recycled-Content Paper Products and Recycled-Content Printing and Writing Paper. B. The Recordkeeping Designee will do the following to track Procurement of Recovered Organic Waste Products, Recycled-Content Paper Products, and Recycled-Content Printing and Writing Paper: 1. Collect and collate copies of invoices or receipts (paper or electronic) or other proof of purchase that describe the procurement of Printing and Writing Paper and Paper Products, including the volume and type of all paper purchases; and, copies of certifications and other required verifications from all departments and/or divisions procuring Paper Products and Printing and Writing Paper (whether or not they contain recycled content) and/or from the vendors providing Printing and Writing Paper and Paper Products. These records must be kept as part of the City’s documentation of its compliance with 14 CCR Section 18993.3. 2. Collect and collate copies of invoices or receipts or documentation evidencing procurement from all departments and divisions procuring Recovered Organic Waste Products and invoices or similar records from vendors/contractors/others procuring Recovered Organic Waste Products on behalf of the City to develop evidence of the City meeting its Annual Recovered Organic Waste Product Procurement Target. These records must be kept as part of the City’s documentation of its compliance with 14 CCR Section 18993.1. 3. Collect, collate, and maintain documentation submitted by the City, Direct Service Providers, and/or vendors, including the information reported to the Recordkeeping Designee in accordance with Sections 3.2.A.3, 3.2.B.2, 3.2.C.2, 3.3.A.3, 3.3.B.2, 3.3.C.3, 4.1.C, and 4.2.A.5. 4. Compile an annual report on the City’s direct procurement, and vendor/other procurement on behalf of the City, of Recovered Organic Waste Products, Recycled-Content Paper Products, and Recycled-Content Printing and Writing Paper, consistent with the recordkeeping requirements contained in 14 CCR Section 18993.2 for the Annual Recovered Organic Waste Product Procurement Target and 14 CCR Section 18993.4 for Recycled-Content Paper Products and Recycled-Content Printing and Writing Paper procurement. This report shall be made available to the City’s responsible entity for compiling the annual report to be submitted to CalRecycle (which will include a description of compliance on many other City of Vernon Recovered Organic Waste and Page 11 of 11 Recycled-Content Paper Procurement Policy SB 1383 regulatory requirements) pursuant to 14 CCR Division 7, Chapter 12, Article 13. The procurement report shall also be shared with City Council annually as evidence of implementing this Policy. SECTION 6. EFFECTIVE DATE OF POLICY This Policy shall go into effect immediately. 1001 I Street, Sacramento, CA 95814 y P.O. Box 4025, Sacramento, CA 95812 www.CalRecycle.ca.gov y (916) 322-4027 California Environmental Protection Agency Gavin Newsom California Governor Jared Blumenfeld Secretary for Environmental Protection Department of Rachel Machi Wagoner Resources Recycling and Recovery CalRecycle Director November 17, 2021 Dear Jurisdiction Representative, We are writing to notify you that the annual recovered organic waste product procurement targets for each city and county for the calendar year of 2022 have been published on CalRecycle’s website. Pursuant to the Senate Bill 1383 (SB 1383) Regulations, each California jurisdiction (city, county, or city and county) will be required to procure recovered organic waste products (“products”) made from California, landfill-diverted organic waste, beginning January 1, 2022. Jurisdictions, including special districts that provide solid waste collection services, will also be required to procure recycled-content paper that is recyclable, pursuant to 14 CCR Section 18993.3. Eligible products that can be procured to meet a jurisdiction’s procurement target must meet the requirements of 14 CCR Section 18993.1 and may include any combination of the following: x Compost x Mulch x Renewable energy products from anaerobic digestion (including transportation fuel, electricity, and gas used for heating applications) x Electricity from biomass conversion Each jurisdiction will be required to procure a specified quantity of recovered organic waste products each year to meet its procurement target. Jurisdictions’ procurement targets for the calendar year of 2022 can be found on CalRecycle’s Procurement Webpage: https://www2.calrecycle.ca.gov/Docs/Web/119889 Please note:There are also recordkeeping requirements to document the procurement of recovered organic waste products and recycled-content paper (see 14 CCR Sections 18993.2 and 18993.4). Resources that may assist jurisdictions with the procurement of recovered organic waste products and recycled-content paper include: x CalRecycle’s Procurement Calculator Tool, which may help the jurisdiction plan for their procurement of recovered organic waste products, determine the quantities of products that may be procured to meet their procurement target, track procurement progress, and organize details important for recordkeeping and reporting: https://www2.calrecycle.ca.gov/Docs/Web/118908 x Procurement FAQs:https://www.calrecycle.ca.gov/organics/slcp/faq/recycledproducts x Procurement Webpage:https://www.calrecycle.ca.gov/Organics/SLCP/Procurement x Article 12 of the SB 1383 Regulations, which describes requirements for procurement and product eligibility, calculation of the jurisdiction’s procurement target, and conversion factors that shall be used to convert the jurisdiction’s procurement target into quantities of recovered organic waste products (pp. 95-100): https://www2.calrecycle.ca.gov/Docs/Web/118368 We commend jurisdictions for their engagement with CalRecycle to prepare for the procurement requirements established by the SB 1383 Regulations. Your efforts will help California achieve its goals to reduce the landfill disposal of organic waste, conserve natural resources, strengthen the State’s economy, and reduce greenhouse gas emissions. If you have any questions, please contact your LAMD representative: https://www2.calrecycle.ca.gov/LGCentral/Contacts/ Sincerely, Matt Henigan Deputy Director Materials Management and Local Assistance Division Jurisdiction Procurement Targets Based on January 1, 2021 Population Estimates The list below indicates the annual recovered organic waste product procurement targets for each jurisdiction (city, county, or city and county) in California that will be in effect from January 1, 2022 through December 31, 2026. This data is organized alphabetically by county and includes all cities within the county and the unincorporated county. Rural jurisdictions are included in the list below; however, please note that rural jurisdictions may be eligible to delay their implementation of the procurement requirements. Rural counties (counties that have a total population of less than 70,000 persons), and jurisdictions located within rural counties that are exempt from the organic waste collection requirements pursuant to 14 CCR Section 18984.12(c), are not required to comply with the recovered organic waste product procurement requirements until January 1, 2027. For more information, please contact CalRecycle at SLCP.Organics@CalRecycle.ca.gov. County/City Total Population (1/1/2021 Population Estimate) Annual Procurement Target (Tons of Organic Waste) Alameda Population Annual Procurement Target Alameda 80,884 6,471 Albany 17,055 1,364 Berkeley 116,761 9,341 Dublin 64,695 5,176 Emeryville 12,586 1,007 Fremont 234,239 18,739 Hayward 158,089 12,647 Livermore 91,216 7,297 Newark 48,859 3,909 Oakland 435,514 34,841 Piedmont 11,296 904 Pleasanton 78,371 6,270 San Leandro 87,289 6,983 Union City 72,779 5,822 Unincorporated County 146,958 11,757 Alpine Population Annual Procurement Target Unincorporated County 1,135 91 Amador Population Annual Procurement Target Amador 153 12 Ione 7,712 617 Jackson 4,621 370 Plymouth 950 76 Sutter Creek 2,421 194 Unincorporated County 21,520 1,722 Butte Population Annual Procurement Target Biggs 1,727 138 Chico 111,490 8,919 Gridley 6,129 490 Oroville 17,863 1,429 Paradise 6,046 484 Unincorporated County 59,414 4,753 Calaveras Population Annual Procurement Target Angels City 4,038 323 Unincorporated County 40,998 3,280 Colusa Population Annual Procurement Target Colusa 6,268 501 Williams 5,487 439 Unincorporated County 10,493 839 Contra Costa Population Annual Procurement Target Antioch 112,848 9,028 Brentwood 66,097 5,288 Clayton 11,268 901 Concord 129,273 10,342 Danville 43,906 3,512 El Cerrito 24,846 1,988 Hercules 25,864 2,069 Lafayette 25,358 2,029 Martinez 36,827 2,946 Moraga 16,820 1,346 Oakley 42,895 3,432 Orinda 19,078 1,526 Pinole 19,369 1,550 Pittsburg 74,498 5,960 Pleasant Hill 34,133 2,731 Richmond 110,130 8,810 San Pablo 31,041 2,483 San Ramon 83,863 6,709 Walnut Creek 71,317 5,705 Unincorporated County 174,423 13,954 Del Norte Population Annual Procurement Target Crescent City 6,282 503 Unincorporated County 20,667 1,653 El Dorado Population Annual Procurement Target Placerville 10,888 871 South Lake Tahoe 23,398 1,872 Unincorporated County 161,076 12,886 Fresno Population Annual Procurement Target Clovis 121,834 9,747 Coalinga 16,748 1,340 Firebaugh 8,126 650 Fowler 6,601 528 Fresno 546,770 43,742 Huron 7,404 592 Kerman 16,118 1,289 Kingsburg 13,084 1,047 Mendota 12,448 996 Orange Cove 9,581 766 Parlier 15,828 1,266 Reedley 26,087 2,087 Sanger 27,353 2,188 San Joaquin 4,145 332 Selma 24,487 1,959 Unincorporated County 170,067 13,605 Glenn Population Annual Procurement Target Orland 8,527 682 Willows 6,233 499 Unincorporated County 14,919 1,194 Humboldt Population Annual Procurement Target Arcata 16,909 1,353 Blue Lake 1,262 101 Eureka 26,113 2,089 Ferndale 1,368 109 Fortuna 11,926 954 Rio Dell 3,299 264 Trinidad 342 27 Unincorporated County 69,632 5,571 Imperial Population Annual Procurement Target Brawley 27,326 2,186 Calexico 40,485 3,239 Calipatria 6,509 521 El Centro 44,997 3,600 Holtville 6,236 499 Imperial 20,289 1,623 Westmorland 2,305 184 Unincorporated County 37,887 3,031 Inyo Population Annual Procurement Target Bishop 3,924 314 Unincorporated County 14,639 1,171 Kern Population Annual Procurement Target Arvin 22,014 1,761 Bakersfield 397,392 31,791 California City 14,120 1,130 Delano 51,070 4,086 Maricopa 1,142 91 McFarland 14,044 1,124 Ridgecrest 29,591 2,367 Shafter 20,448 1,636 Taft 7,142 571 Tehachapi 12,008 961 Wasco 26,815 2,145 Unincorporated County 318,407 25,473 Kings Population Annual Procurement Target Avenal 12,354 988 Corcoran 20,476 1,638 Hanford 59,981 4,798 Lemoore 26,809 2,145 Unincorporated County 32,923 2,634 Lake Population Annual Procurement Target Clearlake 13,993 1,119 Lakeport 4,774 382 Unincorporated County 45,173 3,614 Lassen Population Annual Procurement Target Susanville 12,729 1,018 Unincorporated County 14,843 1,187 Los Angeles Population Annual Procurement Target Agoura Hills 20,457 1,637 Alhambra 86,258 6,901 Arcadia 57,660 4,613 Artesia 16,484 1,319 Avalon 3,973 318 Azusa 49,587 3,967 Baldwin Park 75,935 6,075 Bell 36,319 2,906 Bellflower 77,458 6,197 Bell Gardens 42,233 3,379 Beverly Hills 33,399 2,672 Bradbury 1,045 84 Burbank 103,969 8,318 Calabasas 24,341 1,947 Carson 91,668 7,333 Cerritos 50,048 4,004 Claremont 35,707 2,857 Commerce 12,792 1,023 Compton 97,775 7,822 Covina 48,833 3,907 Cudahy 23,750 1,900 Culver City 39,805 3,184 Diamond Bar 56,717 4,537 Downey 111,425 8,914 Duarte 21,457 1,717 El Monte 116,465 9,317 El Segundo 16,660 1,333 Gardena 60,344 4,828 Glendale 203,834 16,307 Glendora 51,540 4,123 Hawaiian Gardens 14,467 1,157 Hawthorne 86,999 6,960 Hermosa Beach 19,451 1,556 Hidden Hills 1,913 153 Huntington Park 58,937 4,715 Industry 427 34 Inglewood 110,159 8,813 Irwindale 1,441 115 La Canada Flintridge 20,194 1,616 La Habra Heights 5,451 436 Lakewood 80,218 6,417 La Mirada 48,631 3,890 Lancaster 161,372 12,910 La Puente 40,087 3,207 La Verne 33,084 2,647 Lawndale 32,710 2,617 Lomita 20,431 1,634 Long Beach 467,730 37,418 Los Angeles 3,923,341 313,867 Lynwood 69,880 5,590 Malibu 11,537 923 Manhattan Beach 35,058 2,805 Maywood 27,670 2,214 Monrovia 38,479 3,078 Montebello 62,914 5,033 Monterey Park 60,380 4,830 Norwalk 105,393 8,431 Palmdale 156,074 12,486 Palos Verdes Estates 13,286 1,063 Paramount 55,200 4,416 Pasadena 145,306 11,624 Pico Rivera 63,157 5,053 Pomona 151,319 12,106 Rancho Palos Verdes 41,541 3,323 Redondo Beach 66,484 5,319 Rolling Hills 1,866 149 Rolling Hills Estates 8,098 648 Rosemead 54,229 4,338 San Dimas 34,003 2,720 San Fernando 24,754 1,980 San Gabriel 39,945 3,196 San Marino 12,961 1,037 Santa Clarita 221,572 17,726 Santa Fe Springs 18,129 1,450 Santa Monica 92,968 7,437 Sierra Madre 10,655 852 Signal Hill 11,617 929 South El Monte 21,296 1,704 South Gate 96,553 7,724 South Pasadena 25,668 2,053 Temple City 36,225 2,898 Torrance 144,832 11,587 Vernon 295 24 Walnut 29,835 2,387 West Covina 105,593 8,447 West Hollywood 36,125 2,890 Westlake Village 8,180 654 Whittier 86,196 6,896 Unincorporated County 1,024,204 81,936 Madera Population Annual Procurement Target Chowchilla 17,330 1,386 Madera 66,172 5,294 Unincorporated County 74,972 5,998 Marin Population Annual Procurement Target Belvedere 2,066 165 Corte Madera 10,029 802 Fairfax 7,498 600 Larkspur 12,194 976 Mill Valley 14,550 1,164 Novato 53,486 4,279 Ross 2,547 204 San Anselmo 12,689 1,015 San Rafael 59,016 4,721 Sausalito 7,355 588 Tiburon 9,456 756 Unincorporated County 66,888 5,351 Mariposa Population Annual Procurement Target Unincorporated County 18,037 1,443 Mendocino Population Annual Procurement Target Fort Bragg 7,409 593 Point Arena 435 35 Ukiah 15,526 1,242 Willits 5,040 403 Unincorporated County 58,259 4,661 Merced Population Annual Procurement Target Atwater 31,810 2,545 Dos Palos 5,575 446 Gustine 5,845 468 Livingston 15,448 1,236 Los Banos 42,869 3,430 Merced 90,971 7,278 Unincorporated County 92,318 7,385 Modoc Population Annual Procurement Target Alturas 2,886 231 Unincorporated County 6,605 528 Mono Population Annual Procurement Target Mammoth Lakes 7,827 626 Unincorporated County 5,468 437 Monterey Population Annual Procurement Target Carmel-by-the-Sea 4,023 322 Del Rey Oaks 1,670 134 Gonzales 8,490 679 Greenfield 18,402 1,472 King City 14,977 1,198 Marina 21,920 1,754 Monterey 28,382 2,271 Pacific Grove 15,536 1,243 Salinas 160,206 12,816 Sand City 385 31 Seaside 32,121 2,570 Soledad 24,454 1,956 Unincorporated County 106,752 8,540 Napa Population Annual Procurement Target American Canyon 20,802 1,664 Calistoga 5,340 427 Napa 79,397 6,352 St Helena 6,070 486 Yountville 2,642 211 Unincorporated County 23,386 1,871 Nevada Population Annual Procurement Target Grass Valley 12,758 1,021 Nevada City 3,081 246 Truckee 16,213 1,297 Unincorporated County 65,414 5,233 Orange Population Annual Procurement Target Aliso Viejo 49,813 3,985 Anaheim 353,468 28,277 Brea 45,137 3,611 Buena Park 81,626 6,530 Costa Mesa 112,780 9,022 Cypress 48,531 3,882 Dana Point 33,189 2,655 Fountain Valley 54,953 4,396 Fullerton 139,431 11,154 Garden Grove 172,476 13,798 Huntington Beach 196,874 15,750 Irvine 271,564 21,725 Laguna Beach 22,495 1,800 Laguna Hills 31,073 2,486 Laguna Niguel 65,168 5,213 Laguna Woods 16,036 1,283 La Habra 62,808 5,025 Lake Forest 84,538 6,763 La Palma 15,442 1,235 Los Alamitos 11,538 923 Mission Viejo 94,119 7,530 Newport Beach 85,865 6,869 Orange 137,366 10,989 Placentia 51,173 4,094 Rancho Santa Margarita 48,183 3,855 San Clemente 64,065 5,125 San Juan Capistrano 35,801 2,864 Santa Ana 331,369 26,510 Seal Beach 24,443 1,955 Stanton 39,573 3,166 Tustin 80,009 6,401 Villa Park 5,759 461 Westminster 91,466 7,317 Yorba Linda 67,846 5,428 Unincorporated County 127,787 10,223 Placer Population Annual Procurement Target Auburn 14,433 1,155 Colfax 2,172 174 Lincoln 49,624 3,970 Loomis 6,808 545 Rocklin 70,469 5,638 Roseville 146,875 11,750 Unincorporated County 114,613 9,169 Plumas Population Annual Procurement Target Portola 1,928 154 Unincorporated County 16,188 1,295 Riverside Population Annual Procurement Target Banning 32,233 2,579 Beaumont 52,686 4,215 Blythe 18,556 1,484 Calimesa 10,236 819 Canyon Lake 11,025 882 Cathedral City 53,973 4,318 Coachella 47,825 3,826 Corona 169,454 13,556 Desert Hot Springs 30,086 2,407 Eastvale 67,626 5,410 Hemet 84,525 6,762 Indian Wells 5,428 434 Indio 91,621 7,330 Jurupa Valley 108,097 8,648 Lake Elsinore 64,762 5,181 La Quinta 41,247 3,300 Menifee 99,686 7,975 Moreno Valley 209,426 16,754 Murrieta 115,172 9,214 Norco 26,107 2,089 Palm Desert 53,892 4,311 Palm Springs 47,754 3,820 Perris 78,977 6,318 Rancho Mirage 18,799 1,504 Riverside 324,302 25,944 San Jacinto 51,269 4,102 Temecula 112,771 9,022 Wildomar 37,013 2,961 Unincorporated County 389,905 31,192 Sacramento Population Annual Procurement Target Citrus Heights 87,811 7,025 Elk Grove 178,124 14,250 Folsom 82,303 6,584 Galt 26,116 2,089 Isleton 832 67 Rancho Cordova 79,662 6,373 Sacramento 515,673 41,254 Unincorporated County 590,493 47,239 San Benito Population Annual Procurement Target Hollister 41,386 3,311 San Juan Bautista 2,151 172 Unincorporated County 19,989 1,599 San Bernardino Population Annual Procurement Target Adelanto 35,147 2,812 Apple Valley 74,350 5,948 Barstow 24,205 1,936 Big Bear Lake 5,189 415 Chino 88,184 7,055 Chino Hills 82,661 6,613 Colton 54,198 4,336 Fontana 213,944 17,116 Grand Terrace 12,399 992 Hesperia 96,053 7,684 Highland 55,060 4,405 Loma Linda 24,895 1,992 Montclair 39,598 3,168 Needles 5,353 428 Ontario 182,004 14,560 Rancho Cucamonga 175,131 14,010 Redlands 71,154 5,692 Rialto 102,567 8,205 San Bernardino 216,291 17,303 Twentynine Palms 29,967 2,397 Upland 78,513 6,281 Victorville 127,170 10,174 Yucaipa 55,634 4,451 Yucca Valley 22,330 1,786 Unincorporated County 303,912 24,313 San Diego Population Annual Procurement Target Carlsbad 115,501 9,240 Chula Vista 274,449 21,956 Coronado 22,357 1,789 Del Mar 4,258 341 El Cajon 103,243 8,259 Encinitas 62,289 4,983 Escondido 151,688 12,135 Imperial Beach 27,774 2,222 La Mesa 59,578 4,766 Lemon Grove 26,345 2,108 National City 62,749 5,020 Oceanside 176,754 14,140 Poway 48,936 3,915 San Diego 1,411,034 112,883 San Marcos 96,302 7,704 Santee 56,800 4,544 Solana Beach 13,827 1,106 Vista 103,268 8,261 Unincorporated County 498,252 39,860 San Francisco Population Annual Procurement Target City and County 875,010 70,001 San Joaquin Population Annual Procurement Target Escalon 7,501 600 Lathrop 28,503 2,280 Lodi 68,751 5,500 Manteca 87,319 6,986 Ripon 16,292 1,303 Stockton 320,876 25,670 Tracy 98,601 7,888 Unincorporated County 155,691 12,455 San Luis Obispo Population Annual Procurement Target Arroyo Grande 17,555 1,404 Atascadero 29,623 2,370 El Paso de Robles 31,073 2,486 Grover Beach 13,128 1,050 Morro Bay 10,121 810 Pismo Beach 8,108 649 San Luis Obispo 46,058 3,685 Unincorporated County 115,506 9,240 San Mateo Population Annual Procurement Target Atherton 6,896 552 Belmont 26,470 2,118 Brisbane 4,579 366 Burlingame 29,746 2,380 Colma 1,659 133 Daly City 108,599 8,688 East Palo Alto 30,350 2,428 Foster City 32,842 2,627 Half Moon Bay 12,309 985 Hillsborough 11,391 911 Menlo Park 34,825 2,786 Millbrae 22,509 1,801 Pacifica 37,890 3,031 Portola Valley 4,560 365 Redwood City 85,182 6,815 San Bruno 44,936 3,595 San Carlos 29,814 2,385 San Mateo 103,045 8,244 South San Francisco 67,135 5,371 Woodside 5,628 450 Unincorporated County 64,880 5,190 Santa Barbara Population Annual Procurement Target Buellton 5,435 435 Carpinteria 13,196 1,056 Goleta 32,339 2,587 Guadalupe 8,346 668 Lompoc 42,493 3,399 Santa Barbara 93,055 7,444 Santa Maria 107,445 8,596 Solvang 5,512 441 Unincorporated County 133,351 10,668 Santa Clara Population Annual Procurement Target Campbell 41,533 3,323 Cupertino 58,656 4,692 Gilroy 56,599 4,528 Los Altos 30,510 2,441 Los Altos Hills 8,390 671 Los Gatos 30,836 2,467 Milpitas 75,663 6,053 Monte Sereno 3,604 288 Morgan Hill 47,374 3,790 Mountain View 82,814 6,625 Palo Alto 67,657 5,413 San Jose 1,029,782 82,383 Santa Clara 130,746 10,460 Saratoga 30,546 2,444 Sunnyvale 153,827 12,306 Unincorporated County 85,634 6,851 Santa Cruz Population Annual Procurement Target Capitola 10,091 807 Santa Cruz 56,156 4,492 Scotts Valley 11,755 940 Watsonville 51,366 4,109 Unincorporated County 131,747 10,540 Shasta Population Annual Procurement Target Anderson 10,702 856 Redding 91,715 7,337 Shasta Lake 10,657 853 Unincorporated County 64,723 5,178 Sierra Population Annual Procurement Target Loyalton 754 60 Unincorporated County 2,435 195 Siskiyou Population Annual Procurement Target Dorris 991 79 Dunsmuir 1,648 132 Etna 743 59 Fort Jones 670 54 Montague 1,353 108 Mount Shasta 3,408 273 Tulelake 902 72 Weed 2,657 213 Yreka 7,746 620 Unincorporated County 24,212 1,937 Solano Population Annual Procurement Target Benicia 27,111 2,169 Dixon 20,197 1,616 Fairfield 118,005 9,440 Rio Vista 10,080 806 Suisun City 28,882 2,311 Vacaville 98,041 7,843 Vallejo 117,846 9,428 Unincorporated County 18,365 1,469 Sonoma Population Annual Procurement Target Cloverdale 9,133 731 Cotati 7,429 594 Healdsburg 11,800 944 Petaluma 61,104 4,888 Rohnert Park 42,484 3,399 Santa Rosa 171,711 13,737 Sebastopol 7,657 613 Sonoma 10,924 874 Windsor 27,855 2,228 Unincorporated County 134,110 10,729 Stanislaus Population Annual Procurement Target Ceres 48,901 3,912 Hughson 7,303 584 Modesto 219,294 17,544 Newman 11,962 957 Oakdale 23,237 1,859 Patterson 23,304 1,864 Riverbank 25,189 2,015 Turlock 74,820 5,986 Waterford 8,944 716 Unincorporated County 113,014 9,041 Sutter Population Annual Procurement Target Live Oak 9,367 749 Yuba City 70,776 5,662 Unincorporated County 21,146 1,692 Tehama Population Annual Procurement Target Corning 7,664 613 Red Bluff 14,272 1,142 Tehama 448 36 Unincorporated County 42,970 3,438 Trinity Population Annual Procurement Target Unincorporated County 13,535 1,083 Tulare Population Annual Procurement Target Dinuba 26,517 2,121 Exeter 10,997 880 Farmersville 11,327 906 Lindsay 13,090 1,047 Porterville 59,571 4,766 Tulare 69,246 5,540 Visalia 139,254 11,140 Woodlake 8,054 644 Unincorporated County 143,677 11,494 Tuolumne Population Annual Procurement Target Sonora 4,690 375 Unincorporated County 48,775 3,902 Ventura Population Annual Procurement Target Camarillo 69,708 5,577 Fillmore 15,807 1,265 Moorpark 35,981 2,878 Ojai 7,436 595 Oxnard 204,675 16,374 Port Hueneme 23,374 1,870 San Buenaventura 105,415 8,433 Santa Paula 30,691 2,455 Simi Valley 124,468 9,957 Thousand Oaks 125,426 10,034 Unincorporated County 92,242 7,379 Yolo Population Annual Procurement Target Davis 69,295 5,544 West Sacramento 53,967 4,317 Winters 7,618 609 Woodland 60,978 4,878 Unincorporated County 25,642 2,051 Yuba Population Annual Procurement Target Marysville 12,201 976 Wheatland 3,610 289 Unincorporated County 63,596 5,088 !""#$$% &#% ' ( )* + ,""$ -. /. !""$#$ """ $% * %" # 0 $ $ 1 $ $ 0 2 ""#% *%". + 3"! $ !" + $ &4 . ' *5 $#% $ " "# $2 $ $ " . + 3"! 4 . !""* $ " !"" 0 $ $" 0*( 0 "! $ * 2 $ !" $ + $ !" " . + !"2 $ !" + $ &" " $ $ ' !""+ * % " - $ " 2* %" 0 2+ $ !"" 0 *! 6 - " 0 * "# 6 - " $ 1 . 7-" . % $ !"#% * #% 6 "# # " "-$" $ $ "# *( )* + ," "$ - " "*# #" ! 6 $ $ 2 *%" $( )* + ,! "$ $ 6 #% ""2 " "# ""$ * %" $ !"" * 8*( )* + , RESOLUTION NO. 2022-07 A RESOLUTION OF THE CITY COUNCIL OF THE CITY OF VERNON AUTHORIZING THE DIRECTOR OF PUBLIC WORKS TO EXECUTE ALL FEDERAL OR STATE GRANT FUNDING AGREEMENTS WITH THE STATE OF CALIFORNIA, ACTING BY AND THROUGH THE DEPARTMENT OF TRANSPORTATION SECTION 1. Recitals. A. The City of Vernon is eligible to receive Federal and/or State funding for certain transportation projects through the California Department of Transportation (CalTrans). B. Master Agreements, Program Supplemental Agreements, Fund Exchange Agreements and/or Fund Transfer Agreements need to be executed with CalTrans before such funds can be claimed. C. The City Council wishes to delegate authorization to execute these agreements and any amendments thereto to the Director of Public Works. NOW, THEREFORE, BE IT RESOLVED BY THE CITY COUNCIL OF THE CITY OF VERNON AS FOLLOWS: SECTION 2. The City Council of the City of Vernon hereby finds and determines that the above recitals are true and correct. SECTION 3. The City Council of the City of Vernon hereby authorizes the Director of Public Works, or his or her designee, to execute any and all documents, including but not limited to, Master Agreements, Program Supplemental Agreements, Fund Exchange Agreements, Fund Transfer Agreements, and any amendments, necessary for the purposes of securing federal-aid highway program and state-only funded program funds for, and on behalf of, the City of Vernon and to take whatever actions are deemed necessary or desirable for the purpose of implementing and carrying out the purposes of this Resolution and the actions herein approved or authorized. / / / / / / / / / / / / Resolution No. 2022-07 Page 2 of 2 _______________________ SECTION 4. The City Clerk shall certify the passage and adoption of this resolution and enter it into the book of original resolutions. APPROVED AND ADOPTED this 5th day of April, 2022. ________________________ MELISSA YBARRA, Mayor ATTEST: LISA POPE, City Clerk (seal) APPROVED AS TO FORM: ZAYNAH N. MOUSSA, Interim City Attorney ! "# $%$&' (")'" * *+ * , * - - - ! %$' (")'"&. /* * ! - 01**01 2.1 1 - * 2.* 0 -* -* 1 - 2* . /* 2 , "1 ! . 33333 4 56233-* *2" 71$' (")'". /* - - * 21 2 - * #8--. /*- 1**. ). --" ! CERTIFICATE OF ACCEPTANCE (California Government Code Section 27281) This is to certify that interests in real property conveyed to or created in favor of the City of Vernon by certain Electrical Easements executed by co-owners in counterparts, 2340 E. 52nd Street LLC dated January 25, 2022, Lee Enterprise LLC dated January 25, 2022 and Klein Brea Investments LLC dated February 8, 2022 and all California limited liability companies are hereby accepted by the undersigned officer on behalf of the City pursuant to the authority conferred by Minute Order by the City Council of the City on April 5, 2022, and the grantee consents to recordation thereof by its duly authorized officer. Dated: , 2022 CITY OF VERNON MELISSA YBARRA, Mayor ATTEST: LISA POPE, City Clerk APPROVED AS TO FORM: ZAYNAH N. MOUSSA, Interim City Attorney !"#$%&''% #$%&''%(% )*%+,-./ 01 ! "2 * 3 " " 4 " % / $ 5 (%$5. !" %$5 1 ,66 "2/!/ !/ 7 ,6,, "2 / / ( . 4 / 7 * "8"% 4 % %+,-!"#$%&''% #$%&''% " / ++4 9-::6;-*:</"% /01 ! " 2/ "+ 7 %* "8 /9<" / 4 " "2 " "% %" & / " / * & ,6 " % "8 " / => / (=3. /> / /"% /01 ! "2*?"2 " / / 1 ! " " 3 " " / 0* ?" 1 ! "!! "% / !" > * ?" "=3@ -"% A ! > 3 ,*?"% A ! / +"(-6. *?"% (,. /#$%&''% #$%&''%(#$%&.* ?" ! // !" % 6*6*:* #$%& ! / " / " / > / 4 *?"///" " ! !/ " / / " " / " 2 / *?" " #$%& /"!> /"% /0 1 ! "2%+,-* ?" " ! / "% A &//* 3 /"01 ! "2! "3 # (3#.,+ (1 3 +& +% $4 . " / 9* B! / " ! > 96<-6;-*:< (9< . )* ,,+,-6+: (1 3 +& +% $4 . "3#+6 * ,* %+,-!"#$%& *1 ! "= Page 1 of 42 SERVICES AGREEMENT BETWEEN THE CITY OF VERNON AND YESCO, LLC DBA YESCO SIGNS, LLC FOR CS-1425 CITY OF VERNON GATEWAY ARCH PROJECT COVER PAGE Contractor: YESCO, LLC dba YESCO Signs, LLC Responsible Principal of Contractor: Ken Person, Vice President California Region Notice Information - Contractor: YESCO, LLC dba YESCO Signs, LLC 10835 Bellgrave Ave. Jurupa Valley, CA 91752 Attention: Ken Person, Vice President Telephone: 909-923-7668 Notice Information - City: City of Vernon 4305 Santa Fe Avenue Vernon, CA 90058 Attention: Daniel S. Wall, P.E., Director of Public Works Telephone: (323) 583-8811 ext. 305 Commencement Date: April 20, 2022 Termination Date: April 19, 2025 Consideration: Total not to exceed $499,364.97 (includes all applicable sales tax); and more particularly described in Exhibit B Records Retention Period Three (3) years, pursuant to Section 11.20 Page 2 of 42 SERVICES AGREEMENT BETWEEN THE CITY OF VERNON AND YESCO, LLC DBA YESCO SIGNS, LLC FOR CS-1425 CITY OF VERNON GATEWAY ARCH PROJECT This Agreement is made between the City of Vernon ("City"), a California charter City and California municipal corporation (“City”), and YESCO, LLC dba YESCO Signs, LLC, a limited liability company (“Contractor”). The City and Contractor agree as follows: 1.0 EMPLOYMENT OF CONTRACTOR. City agrees to engage Contractor to perform the services as hereinafter set forth as authorized by the City Council on April 5, 2022. 2.0 SCOPE OF SERVICES. 2.1 Contractor shall perform all work necessary to complete the services set forth in the City’s Request for Proposals issued on or about January 3, 2022, and titled CS-1425 City of Vernon Gateway Arch Project, and Contractor's proposal to the City ("Proposal") dated February 11, 2022, Exhibit “A”, a copy which is attached to and incorporated into this Agreement by reference. 2.2 All services shall be performed to the satisfaction of City. 2.3 All services shall be performed in a competent, professional, and satisfactory manner in accordance with the prevailing industry standards for such services. 3.0 PERSONNEL. 3.1 Contractor represents that it employs, or will employ, at its own expense, all personnel required to perform the services under this Agreement. 3.2 Contractor shall not subcontract any services to be performed by it under this Agreement without prior written approval of City. 3.3 All of the services required hereunder will be performed by Contractor or by City approved subcontractors. Contractor, and all personnel engaged in the work, shall be fully qualified and authorized or permitted under State and local law to perform such services and shall be subject to approval by the City. 4.0 TERM. The Contractor shall commence the delivery of services on receipt of a written notice to proceed and shall complete the services on the schedule set forth in Exhibit “B”. 5.0 COMPENSATION AND FEES. 5.1 Contractor has established rates for the City of Vernon which are comparable to and do not exceed the best rates offered to other governmental entities in and around Los Angeles County for the same services. For satisfactory and timely performance of Page 3 of 42 the services, the City will pay Contractor in accordance with the payment schedule set forth in Exhibit “B” attached hereto and incorporated herein by reference. 5.2 Contractor's grand total compensation for the entire term of this Agreement, shall not exceed $499,364.97 without the prior authorization of the City, as appropriate, and written amendment of this Agreement. 5.3 Contractor shall, at its sole cost and expense, furnish all necessary and incidental labor, material, supplies, facilities, equipment, and transportation which may be required for furnishing services pursuant to this Agreement. Materials shall be of the highest quality. The above Agreement fee shall include all staff time and all clerical, administrative, overhead, insurance, reproduction, telephone, air travel, auto rental, subsistence, and all related costs and expenses. 5.4 City shall reimburse Contractor only for those costs or expenses specifically approved in this Agreement, or specifically approved in writing in advance by City. Unless otherwise approved, such costs shall be limited and include nothing more than the following costs incurred by Contractor: 5.4.1 The actual costs of subcontractors for performance of any of the services that Contractor agrees to render pursuant to this Agreement, which have been approved in advance by City and awarded in accordance with this Agreement. 5.4.2 Approved reproduction charges. 5.4.3 Actual costs and/or other costs and/or payments specifically authorized in advance in writing and incurred by Contractor in the performance of this Agreement. 5.5 Contractor shall not receive any compensation for extra work performed without the prior written authorization of City. As used herein, “extra work” means any work that is determined by City to be necessary for the proper completion of the Project, but which is not included within the Scope of Services and which the parties did not reasonably anticipate would be necessary at the time of execution of this Agreement. Compensation for any authorized extra work shall be paid in accordance with the payment schedule as set forth in Exhibit “B,” if the extra work has been approved by the City. 5.6 Licenses, Permits, Fees, and Assessments. Contractor shall obtain, at Contractor’s sole cost and expense, such licenses, permits, and approvals as may be required by law for the performance of the services required by this Agreement. Contractor shall have the sole obligation to pay for any fees, assessments, and taxes, plus applicable penalties and Page 4 of 42 interest, which may be imposed by law and which arise from or are necessary for the performance of the Services by this Agreement. 6.0 PAYMENT. 6.1 As scheduled services are completed, Contractor shall submit to the City an invoice for the services completed, authorized expenses, and authorized extra work actually performed or incurred according to said schedule. 6.2 Each such invoice shall state the basis for the amount invoiced, including a detailed description of the services completed, the number of hours spent, reimbursable expenses incurred and any extra work performed. 6.3 Contractor shall also submit a progress report with each invoice that describes in reasonable detail the services and the extra work, if any, performed in the immediately preceding calendar month. 6.4 Contractor understands and agrees that invoices which lack sufficient detail to measure performance will be returned and not processed for payment. 6.5 City will pay Contractor the amount invoiced within thirty (30) days after the City approves the invoice. 6.6 Payment of such invoices shall be payment in full for all services, authorized costs, and authorized extra work covered by that invoice. 7.0 CITY'S RESPONSIBILITY. City shall cooperate with Contractor as may be reasonably necessary for Contractor to perform its services; and will give any required decisions as promptly as practicable so as to avoid unreasonable delay in the progress of Contractor's services. 8.0 COORDINATION OF SERVICES. Contractor agrees to work closely with City staff in the performance of Services and shall be available to City’s staff, consultants, and other staff at all reasonable times. 9.0 INDEMNITY. Contractor agrees to indemnify City, its officers, elected officials, employees and agents against, and will hold and save each of them harmless from, any and all actions, suits, claims, damages to persons or property, losses, costs, penalties, obligations, errors, omissions or liabilities (herein “claims or liabilities”), including but not limited to professional negligence, that may be asserted or claimed by any person, firm or entity arising out of or in connection with the work, operations or activities of Contractor, its agents, employees, subcontractors, or invitees, provided for herein, or arising from the acts or omissions of Contractor hereunder, or arising from Contractor’s performance of or failure to perform any term, provision, covenant or condition of this Agreement, except to the extent such Page 5 of 42 claims or liabilities arise from the gross negligence or willful misconduct of City, its officers, elected officials, agents or employees. 10.0 INSURANCE. Contractor shall, at its own expense, procure and maintain policies of insurance of the types and in the amounts set forth below, for the duration of the Agreement, including any extensions thereto. The policies shall state that they afford primary coverage. i. Automobile Liability with minimum limits of at least $2,000,000 combined single limit, including owned, hired, and non-owned liability coverage. ii. Contractor agrees to subrogate automobile liability resulting from performance under this Agreement by agreeing to defend, indemnify and hold harmless, the City, and its respective employees, agents, and City Council from and against all claims, liabilities, suits, losses, damages, injuries and expenses, including all costs and reasonable attorney’s fees (“Claims”), which are attributable to any act or omission by the City under the performance of the services. iii. General Liability with minimum limits of at least $2,000,000 per occurrence and $4,000,000 aggregate written on an Insurance Services Office (ISO) Comprehensive General Liability "occurrence" form or its equivalent for coverage on an occurrence basis. Premises/Operations and Personal Injury coverage is required. The City of Vernon, its directors, commissioners, officers, employees, agents, and volunteers must be endorsed on the policy as additional insureds as respects liability arising out of the Contractor's performance of this Agreement. (1) If Contractor employs other contractors as part of the services rendered, Contractor's Protective Coverage is required. Contractor may include all subcontractors as insureds under its own policy or shall furnish separate insurance for each subcontractor, meeting the requirements set forth herein. (2) Contractor agrees to subrogate General Liability resulting from performance under this Agreement by agreeing to defend, indemnify and hold harmless, the City, and its respective employees, agents, and City Council from and against all claims, liabilities, suits, losses, damages, injuries and expenses, including all costs and reasonable attorney’s fees (“Claims”), which are attributable to any act or omission by the City under the performance of the services. iv. Professional Errors and Omissions coverage in a sum of at least $2,000,000, Page 6 of 42 where such risk is applicable. Applicable aggregates must be identified and claims history provided to determine amounts remaining under the aggregate. Contractor shall maintain such coverage for at least one (1) year after the termination of this Agreement. v. Excess Coverage – Any umbrella or excess insurance shall contain or be endorsed to contain a provision that such coverage shall also apply on a primary and non- contributory basis for the benefit of City before the City’s own insurance or self-insurance shall be called upon to project it as a named insured. Any umbrella liability policy or excess liability policy will in “following form” and will contain a provision to the effect that, if the underlying aggregate is exhausted, the excess coverage will drop down as primary insurance. vi. Contractor shall comply with the applicable sections of the California Labor Code concerning workers' compensation for injuries on the job. In addition, Contractor shall require each subcontractor to similarly maintain workers’ compensation insurance in accordance with the laws for California for all of the subcontractor’s employees. Compliance is accomplished in one of the following manners: (1) Provide copy of permissive self-insurance certificate approved by the State of California; or (2) Secure and maintain in force a policy of workers' compensation insurance with statutory limits and Employer's Liability Insurance with a minimal limit of $1,000,000 per accident. The policy shall be endorsed to waive all rights of subrogation against City, its directors, commissioners, officers, employees, and volunteers for losses arising from performance of this Agreement; or (3) Provide a "waiver" form certifying that no employees subject to the Labor Code's Workers' Compensation provision will be used in performance of this Agreement. vii. Each insurance policy included in this clause shall be endorsed to state that coverage shall not be cancelled except after thirty (30) days' prior written notice to City. viii. Insurance shall be placed with insurers with a Best's rating of no less than A-VIII. ix. Prior to commencement of performance, Contractor shall furnish City with a certificate of insurance for each policy. Each certificate is to be signed by a person authorized by that insurer to bind coverage on its behalf. The certificate(s) must be in a form approved by City. City may require complete, certified copies of any or all policies at any time. x. Failure to maintain required insurance at all times shall constitute a default and material breach. In such event, Contractor shall immediately notify City and cease all Page 7 of 42 performance under this Agreement until further directed by the City. In the absence of satisfactory insurance coverage, City may, at its option: (a) procure insurance with collection rights for premiums, attorney's fees and costs against Contractor by way of set-off or recoupment from sums due to Contractor, at City's option; (b) immediately terminate this Agreement and seek damages from the Agreement resulting from said breach; or (c) self-insure the risk, with all damages and costs incurred, by judgment, settlement or otherwise, including attorney's fees and costs, being collectible from Contractor, by way of set-off or recoupment from any sums due to Contractor. 11.0 GENERAL TERMS AND CONDITIONS. 11.1 INDEPENDENT CONTRACTOR. 11.1.1 It is understood that in the performance of the services herein provided for, Contractor shall be, and is, an independent contractor, and is not an agent, officer or employee of City and shall furnish such services in its own manner and method except as required by this Agreement, or any applicable statute, rule, or regulation. Further, Contractor has and shall retain the right to exercise full control over the employment, direction, compensation and discharge of all persons employed by Contractor in the performance of the services hereunder. City assumes no liability for Contractor’s actions and performance, nor assumes responsibility for taxes, bonds, payments, or other commitments, implied or explicit, by or for Contractor. Contractor shall be solely responsible for, and shall indemnify, defend and save City harmless from all matters relating to the payment of its employees, subcontractors and independent contractors, including compliance with social security, withholding and all other wages, salaries, benefits, taxes, exactions, and regulations of any nature whatsoever. 11.1.2 Contractor acknowledges that Contractor and any subcontractors, agents or employees employed by Contractor shall not, under any circumstances, be considered employees of the City, and that they shall not be entitled to any of the benefits or rights afforded employees of City, including, but not limited to, sick leave, vacation leave, holiday pay, Public Employees Retirement System benefits, or health, life, dental, long-term disability or workers' compensation insurance benefits. 11.2 CONTRACTOR NOT AGENT. Except as the City may authorize in writing, Contractor and its subcontractors shall have no authority, express or implied, to act on behalf of or bind the City in any capacity whatsoever as agents or otherwise. 11.3 OWNERSHIP OF WORK. All documents and materials furnished by the City to Contractor shall remain the property of the City and shall be returned to the City upon termination of this Agreement. All reports, drawings, plans, specifications, computer tapes, Page 8 of 42 floppy disks and printouts, studies, memoranda, computation sheets, and other documents prepared by Contractor in furtherance of the work shall be the sole property of City and shall be delivered to City whenever requested at no additional cost to the City. Contractor shall keep such documents and materials on file and available for audit by the City for at least three (3) years after completion or earlier termination of this Agreement. Contractor may make duplicate copies of such materials and documents for its own files or for such other purposes as may be authorized in writing by the City. 11.4 CORRECTION OF WORK. Contractor shall promptly correct any defective, inaccurate or incomplete tasks, deliverables, goods, services and other work, without additional cost to the City. The performance or acceptance of services furnished by Contractor shall not relieve the Contractor from the obligation to correct subsequently discovered defects, inaccuracy, or incompleteness. 11.5 RESPONSIBILITY FOR ERRORS. Contractor shall be responsible for its work and results under this Agreement. Contractor, when requested, shall furnish clarification and/or explanation as may be required by the City, regarding any services rendered under this Agreement at no additional cost to City. In the event that an error or omission attributable to Contractor occurs, then Contractor shall, at no cost to City, provide all necessary design drawings, estimates and other Contractor professional services necessary to rectify and correct the matter to the sole satisfaction of City and to participate in any meeting required with regard to the correction. 11.6 WAIVER. The City's waiver of any term, condition, breach, or default of this Agreement shall not be considered to be a waiver of any other term, condition, default or breach, nor of a subsequent breach of the one waived. The delay or failure of either party at any time to require performance or compliance by the other of any of its obligations or agreements shall in no way be deemed a waiver of those rights to require such performance or compliance. No waiver of any provision of this Agreement shall be effective unless in writing and executed by a duly authorized representative of the party against whom enforcement of a waiver is sought. 11.7 SUCCESSORS. This Agreement shall inure to the benefit of, and shall be binding upon, the parties hereto and their respective heirs, successors, and/or assigns. 11.8 NO ASSIGNMENT. Contractor shall not assign or transfer this Agreement or any rights hereunder without the prior written consent of the City and approval by the City Attorney, which may be withheld in the City's sole discretion. Any unauthorized assignment or transfer shall be null and void and shall constitute a material breach by the Page 9 of 42 Contractor of its obligations under this Agreement. No assignment shall release the original parties from their obligations or otherwise constitute a novation. 11.9 COMPLIANCE WITH LAWS. Contractor shall comply with all Federal, State, County and City laws, ordinances, rules and regulations, which are, as amended from time to time, incorporated herein and applicable to the performance hereof. Violation of any law material to performance of this Agreement shall entitle the City to terminate the Agreement and otherwise pursue its remedies. Further, if the Contractor performs any work knowing it to be contrary to such laws, rules, and regulations Contractor shall be solely responsible for all costs arising therefrom. 11.10 ATTORNEY'S FEES. If any action at law or in equity is brought to enforce or interpret the terms of this Agreement, the prevailing party shall be entitled to reasonable attorney's fees, costs, and necessary disbursements in addition to any other relief to which such party may be entitled. 11.11 INTERPRETATION. 11.11.1 Applicable Law. This Agreement shall be deemed an agreement and shall be governed by and construed in accordance with the laws of the State of California. Contractor agrees that the State and Federal courts which sit in the State of California shall have exclusive jurisdiction over all controversies and disputes arising hereunder, and submits to the jurisdiction thereof. 11.11.2 Entire Agreement. This Agreement, including any exhibits attached hereto, constitutes the entire agreement and understanding between the parties regarding its subject matter and supersedes all prior or contemporaneous negotiations, representations, understandings, correspondence, documentation, and agreements (written or oral). 11.11.3 Written Amendment. This Agreement may only be changed by written amendment executed by Contractor and the City Administrator or other authorized representative of the City, subject to any requisite authorization by the City Council. Any oral representations or modifications concerning this Agreement shall be of no force or effect. 11.11.4 Severability. If any provision in this Agreement is held by any court of competent jurisdiction to be invalid, illegal, void, or unenforceable, such portion shall be deemed severed from this Agreement, and the remaining provisions shall nevertheless continue in full force and effect as fully as though such invalid, illegal, or unenforceable portion had never been part of this Agreement. Page 10 of 42 11.11.5 Order of Precedence. Except for Contractor’s Addendum to Standard Form Agreement (Bid Clarifications/Qualifications), attached hereto as part of Exhibit “A” and incorporated herein by reference, in case of conflict between the terms of this Agreement and the terms contained in any document attached as an Exhibit or otherwise incorporated by reference, the terms of this Agreement shall strictly prevail. The terms of the City’s Request for Proposals shall control over the Contractor’s Proposal. 11.11.6 Construction. In the event an ambiguity or question of intent or interpretation arises with respect to this Agreement, this Agreement shall be construed as if drafted jointly by the parties and in accordance with its fair meaning. There shall be no presumption or burden of proof favoring or disfavoring any party by virtue of the authorship of any of the provisions of this Agreement. 11.12 TIME OF ESSENCE. Time is strictly of the essence of this agreement and each and every covenant, term, and provision hereof. 11.13 AUTHORITY OF CONTRACTOR. The Contractor hereby represents and warrants to the City that the Contractor has the right, power, legal capacity, and authority to enter into and perform its obligations under this Agreement, and its execution of this Agreement has been duly authorized. 11.14 ARBITRATION OF DISPUTES. Any dispute for under $25,000 arising out of or relating to the negotiation, construction, performance, non-performance, breach, or any other aspect of this Agreement, shall be settled by binding arbitration in accordance with the Commercial Rules of the American Arbitration Association at Los Angeles, California and judgment upon the award rendered by the Arbitrators may be entered in any court having jurisdiction thereof. The City does not waive its right to object to the timeliness or sufficiency of any claim filed or required to be filed against the City and reserves the right to conduct full discovery. 11.15 NOTICES. Any notice or demand to be given by one party to the other must be given in writing and by personal delivery or prepaid first-class, registered or certified mail, addressed as follows. Notice simply to the City of Vernon or any other City department is not adequate notice. If to the City: City of Vernon Attention: Daniel S. Wall, P.E., Director of Public Works 4305 Santa Fe Avenue Vernon, CA 90058 If to the Contractor: Page 11 of 42 YESCO, LLC dba YESCO Signs, LLC Attention: Ken Person, Vice President California Region 10835 Bellgrave Ave. Jurupa Valley, CA 91752 Any such notice shall be deemed to have been given upon delivery, if personally delivered, or, if mailed, upon receipt, or upon expiration of three (3) business days from the date of posting, whichever is earlier. Either party may change the address at which it desires to receive notice upon giving written notice of such request to the other party. 11.16 NO THIRD PARTY RIGHTS. This Agreement is entered into for the sole benefit of City and Contractor and no other parties are intended to be direct or incidental beneficiaries of this Agreement and no third party shall have any right or remedy in, under, or to this Agreement. 11.17 TERMINATION FOR CONVENIENCE (Without Cause). City may terminate this Agreement in whole or in part at any time, for any cause or without cause, upon fifteen (15) calendar days' written notice to Contractor. If the Agreement is thus terminated by City for reasons other than Contractor's failure to perform its obligations, City shall pay Contractor a prorated amount based on the services satisfactorily completed and accepted prior to the effective date of termination. Such payment shall be Contractor's exclusive remedy for termination without cause. 11.18 DEFAULT. In the event either party materially defaults in its obligations hereunder, the other party may declare a default and terminate this Agreement by written notice to the defaulting party. The notice shall specify the basis for the default. The Agreement shall terminate unless such default is cured before the effective date of termination stated in such notice, which date shall be no sooner than ten (10) days after the date of the notice. In case of default by Contractor, the City reserves the right to procure the goods or services from other sources and to hold the Contractor responsible for any excess costs occasioned to the City thereby. Contractor shall not be held accountable for additional costs incurred due to delay or default as a result of Force Majeure. Contractor must notify the City immediately upon knowing that non-performance or delay will apply to this Agreement as a result of Force Majeure. At that time Contractor is to submit in writing a Recovery Plan for this Agreement. If the Recovery Plan is not acceptable to the City or not received within 10 days of the necessary notification of Force Majeure default, then the City may cancel this order in its entirety at no cost to the City, owing only for goods and services completed to that point. Page 12 of 42 11.19 TERMINATION FOR CAUSE. Termination for cause shall relieve the terminating party of further liability or responsibility under this Agreement, including the payment of money, except for payment for services satisfactorily and timely performed prior to the service of the notice of termination, and except for reimbursement of (1) any payments made by the City for service not subsequently performed in a timely and satisfactory manner, and (2) costs incurred by the City in obtaining substitute performance. If this Agreement is terminated as provided herein, City may require, at no additional cost to City, that Contractor provide all finished or unfinished documents, data, and other information of any kind prepared by Contractor in connection with the performance of Services under this Agreement. Contractor shall be required to provide such document and other information within fifteen (15) days of the request. 11.19.1 Additional Services. In the event this Agreement is terminated in whole or in part as provided herein, City may procure, upon such terms and in such manner as it may determine appropriate, services similar to those terminated. 11.20 MAINTENANCE AND INSPECTION OF RECORDS. The City, or its authorized auditors or representatives, shall have access to and the right to audit and reproduce any of the Contractor's records to the extent the City deems necessary to insure it is receiving all money to which it is entitled under the Agreement and/or is paying only the amounts to which Contractor is properly entitled under the Agreement or for other purposes relating to the Agreement. The Contractor shall maintain and preserve all such records for a period of at least three (3) years after termination of the Agreement. The Contractor shall maintain all such records in the City of Vernon. If not, the Contractor shall, upon request, promptly deliver the records to the City of Vernon or reimburse the City for all reasonable and extra costs incurred in conducting the audit at a location other than the City of Vernon, including, but not limited to, such additional (out of the City) expenses for personnel, salaries, private auditors, travel, lodging, meals, and overhead. 11.21 CONFLICT. Contractor hereby represents, warrants, and certifies that no member, officer, or employee of the Contractor is a director, officer, or employee of the City of Vernon, or a member of any of its boards, commissions, or committees, except to the extent permitted by law. 11.22 HEADINGS. Paragraphs and subparagraph headings contained in this Agreement are included solely for convenience and are not intended to modify, explain or to be Page 13 of 42 a full or accurate description of the content thereof and shall not in any way affect the meaning or interpretation of this Agreement. 11.23 ENFORCEMENT OF WAGE AND HOUR LAWS. Eight hours labor constitutes a legal day's work. The Contractor, or subcontractor, if any, shall forfeit twenty-five dollars ($25) for each worker employed in the execution of this Agreement by the respective Contractor or subcontractor for each calendar day during which the worker is required or permitted to work more than 8 hours in any one calendar day and 40 hours in any one calendar week in violation of the provisions of Sections 1810 through 1815 of the California Labor Code as a penalty paid to the City; provided, however, work performed by employees of contractors in excess of 8 hours per day, and 40 hours during any one week, shall be permitted upon compensation for all hours worked in excess of 8 hours per day at not less than 1½ times the basic rate of pay. 11.24 EQUAL EMPLOYMENT OPPORTUNITY PRACTICES. Contractor certifies and represents that, during the performance of this Agreement, it and any other parties with whom it may subcontract shall adhere to equal employment opportunity practices to assure that applicants, employees and recipients of service are treated equally and are not discriminated against because of their race, religion, color, national origin, ancestry, disability, sex, age, medical condition, sexual orientation or marital status. Contractor further certifies that it will not maintain any segregated facilities. Contractor further agrees to comply with The Equal Employment Opportunity Practices provisions as set forth in Exhibit “C”. [Signatures Begin on Next Page]. Page 14 of 42 IN WITNESS WHEREOF, the Parties have executed this Agreement as of the Commencement Date stated on the cover page. City of Vernon, a California charter City and California municipal corporation By: ____________________________ Carlos Fandino, City Administrator YESCO, LLC dba YESCO Signs, LLC, a limited liability company By: Name: Title: ATTEST: _______________________________ Lisa Pope, City Clerk By: Name: Title: APPROVED AS TO FORM: _______________________________ Zaynah N. Moussa, Interim City Attorney Page 15 of 42 EXHIBIT A CONTRACTOR'S PROPOSAL Page 1 of 1 BID CLARIFICATIONS/QUALIFICATIONS CITY OF VERNON GATEWAY SIGNAGE YESCO LLC dba YESCO Signs LLC (“Contractor”) is pleased to submit the enclose bid to The City of Vernon (“City”) for the City of Vernon Gateway Signage with the following bid clarifications and qualifications: INDEMNITY References to indemnification, defend, guarantee, hold harmless, and other terms of similar meaning as may exist at various places in the Agreement (collectively “Indemnification” for purposes of this paragraph), are understood by the parties to mean that Subcontractor shall provide such Indemnification only to the extent that damages result from the negligence or otherwise wrongful acts or omissions of only Contractor, its employees, subcontractors, and agents. WAIVER OF SUBROGATION. Waiver of Subrogation applies only as respect to the work performed by Contractor. PRIMARY COVERAGE. In the event, and to the extent that City suffers liability or damages because of Contractor’s negligent or otherwise wrongful performance of the work, or because of Subcontractor’s failure to meet its contractual obligations, Contractor’s insurance will be primary. POSSESSION.References in the Agreement to Contractor taking possession of Contractor’s equipment, scaffolds, tools, appliances and any other items thereon are null and void. PENALTIES/DAMAGES.Neither City nor Contractor will be liable for any liquidated, special, incidental, indirect or consequential damages as a result of a breach, dispute or default under this Agreement. RIGHT TO REVIEW. Contractor hereby reserves the right to review and negotiate any terms and conditions contained in any Work Authorization it may be required to enter into, including General Conditions and Special Conditions, as well as any documents incorporated therein by reference. . Page 39 of 42 EXHIBIT B SCHEDULE Page 42 of 42 EXHIBIT C EQUAL EMPLOYMENT OPPORTUNITY PRACTICES PROVISIONS A. Contractor certifies and represents that, during the performance of this Agreement, the contractor and each subcontractor shall adhere to equal opportunity employment practices to assure that applicants and employees are treated equally and are not discriminated against because of their race, religious creed, color, national origin, ancestry, handicap, sex, or age. Contractor further certifies that it will not maintain any segregated facilities. B. Contractor agrees that it shall, in all solicitations or advertisements for applicants for employment placed by or on behalf of Contractor, state that it is an "Equal Opportunity Employer" or that all qualified applicants will receive consideration for employment without regard to their race, religious creed, color, national origin, ancestry, handicap, sex or age. C. Contractor agrees that it shall, if requested to do so by the City, certify that it has not, in the performance of this Agreement, discriminated against applicants or employees because of their membership in a protected class. D. Contractor agrees to provide the City with access to, and, if requested to do so by City, through its awarding authority, provide copies of all of its records pertaining or relating to its employment practices, except to the extent such records or portions of such records are confidential or privileged under state or federal law. E. Nothing contained in this Agreement shall be construed in any manner as to require or permit any act which is prohibited by law. Artist rendering of the Gateway Arch ! "# $% & ! ' ( !) "#**$*+# , (-(!).!)/ ( ! "# !)$- & ! () )' "# !)$# ) #0#1(!)( 2( #3 2() $2 2 4 & ' 2'( ') ' 4 5 4 4 6#7'( ! 4 )# ( ) ) ( 8 2(( ) 2( ' ( & ' ( '' 9 2( 2(((2 & () &2( '() $2 24 # ( ) ) 2( ' ( &'(() ( 8 () 4 7# &() )2( & ((' () ) $2 2() 4 :#'(( () )# 3(!) & ( ( ! & !)$- ' #(& ('2 & '0'( 2((2 '('& (,*** ( ( # $ & ( ( '' ( ) ' ( & ( ' # '' ( ( ) ) ( ! # 3(' 2((# *# "#$% # "#!)$- RESOLUTION NO. 2022-08 A RESOLUTION OF THE CITY COUNCIL OF THE CITY OF VERNON APPROVING A VERNON RENTAL HOUSING POLICY FOR THE VERNON HOUSING COMMISSION AND REPEALING RESOLUTION NO. 2011-175 SECTION 1. Recitals. A. On October 18, 2011, the City Council of the City of Vernon adopted Resolution No. 2011-175 approving a Vernon Rental Housing Policy (VRHP) for the Vernon Housing Commission (VHC) pursuant to VHC Resolution No. VHC-5. B. On March 9, 2022, the VHC adopted Resolution No. VHC-9 recommending an amended VRHP for approval by the City Council pursuant to Section 2.40.060.B of the Vernon Municipal Code. C. The City Council finds that the VRHP submitted meets the criteria of California federal and state fair housing laws. NOW, THEREFORE, BE IT RESOLVED BY THE CITY COUNCIL OF THE CITY OF VERNON AS FOLLOWS: SECTION 2. The City Council of the City of Vernon hereby finds and determines that the above recitals are true and correct. SECTION 3. The City Council of the City of Vernon hereby adopts the Vernon Rental Housing Policy, attached hereto as Exhibit A, as recommended by the VHC. SECTION 4. All resolutions or parts of resolutions, specifically Resolution No. 2011-175, not consistent with or in conflict with this resolution are hereby repealed. / / / / / / / / / / / / Resolution No. 2022-08 Page 2 of 4 _______________________ SECTION 5. The City Clerk shall certify the passage and adoption of this resolution and enter it into the book of original resolutions. APPROVED AND ADOPTED this 5th day of April, 2022. ________________________ MELISSA YBARRA, Mayor ATTEST: LISA POPE, City Clerk (seal) APPROVED AS TO FORM: ZAYNAH N. MOUSSA, Interim City Attorney VERNON RENTAL HOUSING POLICY Approved by the Housing Commission on March 9, 2022 Adopted by the City Council on April 5, 2022 The following Vernon Rental Housing Policy shall be applied to all housing owned by the City of Vernon and leased to the public. 1. Fair Housing: The City of Vernon is committed to managing its City-owned housing at the highest levels of fairness and impartiality. At a minimum, the City of Vernon shall comply with all applicable federal and state fair housing laws, including the Federal Fair Housing Act, as amended, 42 U.S.C. 3601 et seq., and the California Fair Employment and Housing Act, California Government Code Section 12955 et. seq. (FEHA). 2. “Market” Rents: Subject to the provisions of Section 6 below, all rents charged by the City of Vernon shall be based on a “market” value, the VHC should remain sensitive to the unique industrial and commercial character of the City of Vernon, including various environmental realities that are inherent in the City of Vernon. The VHC should also remain sensitive to the limited number of residential resources that the City of Vernon provides, as compared to other locales. Finally, to the extent reasonably practicable, when setting a “market” value for any particular rental unit, an individualized assessment of the particular rental unit shall be taken into account. 3.Length of Tenancy: All new leases shall be for a term of one (1) year. Renewal(s) of leases shall be for a term no longer than one (1) year, without limitation on the number of renewals, so long as a lessee is in good standing. 4. Terms and Conditions: The terms and conditions of all tenancies shall be neutral, fair and reasonable, and shall be based on appropriate standards to bring all such residential tenancies. To the extent reasonably practicable, terms and conditions should take into account any factors that may be present in the City of Vernon and that may not be present elsewhere. All leases for City-owned residences shall contain a right of first refusal to purchase the residence if the residence is offered for sale. 5. Transition for Existing Tenants: To the extent any existing tenancy is not in compliance with the Policy, the VHC shall adopt procedures to bring all such tenancies into compliance. To avoid undue hardship on existing tenants, transitional procedures shall allow for a reasonable period of time to achieve full compliance with the Policy. To the extent any individual lease has a particularized hardship, the VHC shall adopt procedures to allow an individual lease to appeal to the VHC so that any particularized hardship may be addressed in an equitable manner and to avoid any undue hardship for any particular lessee. Resolution No. 2022-08 Page 3 of 4 ________________________ Vernon Rental Housing Policy Page 2 of 2 ________________________ 6. Implementation: The VHC shall promulgate such procedures as may be appropriate and/or necessary to implement and maintain the Policy. Resolution No. 2022-08 Page 4 of 4 ________________________ RESOLUTION NO. VHC-9 A RESOLUTION OF THE VERNON HOUSING COMMISSION OF THE CITY OF VERNON APPROVING A VERNON RENTAL HOUSING POLICY, SUBMITTING SAID POLICY TO THE CITY COUNCIL FOR ADOPTION AND REPEALING RESOLUTION NO. VHC-5 SECTION 1. Recitals. A. Pursuant to Vernon Municipal Code Section 2.40.060.B., on October 5, 2011, the Vernon Housing Commission (VHC) adopted Resolution No. VHC-5 adopting a Vernon Rental Housing Policy and submitting said Policy to the City Council for approval. B. On October 18, 2011, the City Council considered the Policy and adopted Resolution No. 2011-175 approving a Vernon Rental Housing Policy for the Vernon Housing Commission. C. Said policy has been reviewed and the Vernon Housing Commission desires to update said policy. NOW, THEREFORE, BE IT RESOLVED BY THE VERNON HOUSING COMMISSIN OF THE CITY OF VERNON AS FOLLOWS: SECTION 2. The Vernon Housing Commission of the City of Vernon hereby finds and determines that the above recitals are true and correct. SECTION 3. The Vernon Housing Commission hereby approves the following Vernon Rental Housing Policy, attached hereto as Exhibit A, and recommends the City Council adopt said policy. SECTION 4. All resolutions or parts of resolutions, specifically Resolution No. VHC-5, not consistent with or in conflict with this resolution are hereby repealed. / / / / / / / / / / / / SECTION 5. The Secretary of the Commission shall certify the passage and adoption of this resolution and enter it into the book of original resolutions. APPROVED AND ADOPTED this 9th day of March, 2022. ________________________ STEVEN FROBERG, Chair ATTEST: LISA POPE, Secretary (seal) APPROVED AS TO FORM: ZAYNAH N. MOUSSA, Legal Counsel I CERTIFY THAT THE FOREGOING RESOLUTION NO. VHC-9 was passed and adopted by the Housing Commission of the City of Vernon at the Regular meeting on March 9, 2022 by the following vote: AYES: 5 Commission Members: Edry, Lopez, Nevarez Jr., Ybarra, Froberg NOES: 0 ABSENT: 1 Commission Member: Goff ABSTAIN: 0 ________________________________ LISA POPE, Secretary (seal) Resolution No. VHC-09 Page 2 of 3 __________________ VERNON RENTAL HOUSING POLICY Adopted March 9, 2022 The following Vernon Rental Housing Policy shall be applied to all housing owned by the City of Vernon and leased to the public. 1. Fair Housing: The City of Vernon is committed to managing its City-owned housing at the highest levels of fairness and impartiality. At a minimum, the City of Vernon shall comply with all applicable federal and state fair housing laws, including the Federal Fair Housing Act, as amended, 42 U.S.C. 3601 et seq., and the California Fair Employment and Housing Act, California Government Code Section 12955 et. seq. (FEHA). 2.“Market” Rents: Subject to the provisions of Section 6 below, all rents charged by the City of Vernon shall be based on a “market” value, the VHC should remain sensitive to the unique industrial and commercial character of the City of Vernon, including various environmental realities that are inherent in the City of Vernon. The VHC should also remain sensitive to the limited number of residential resources that the City of Vernon provides, as compared to other locales. Finally, to the extent reasonably practicable, when setting a “market” value for any particular rental unit, an individualized assessment of the particular rental unit shall be taken into account. 3.Length of Tenancy: All new leases shall be for a term of one (1) year. Renewal(s) of leases shall be for a term no longer than one (1) year, without limitation on the number of renewals, so long as a lessee is in good standing. 4. Terms and Conditions: The terms and conditions of all tenancies shall be neutral, fair and reasonable, and shall be based on appropriate standards to bring all such residential tenancies. To the extent reasonably practicable, terms and conditions should take into account any factors that may be present in the City of Vernon and that may not be present elsewhere. All leases for City-owned residences shall contain a right of first refusal to purchase the residence if the residence is offered for sale. 5. Transition for Existing Tenants: To the extent any existing tenancy is not in compliance with the Policy, the VHC shall adopt procedures to bring all such tenancies into compliance. To avoid undue hardship on existing tenants, transitional procedures shall allow for a reasonable period of time to achieve full compliance with the Policy. To the extent any individual lease has a particularized hardship, the VHC shall adopt procedures to allow an individual lease to appeal to the VHC so that any particularized hardship may be addressed in an equitable manner and to avoid any undue hardship for any particular lessee. 6. Implementation: The VHC shall promulgate such procedures as may be appropriate and/or necessary to implement and maintain the Policy. Resolution No. VHC-09 Page 3 of 3 __________________ ! " ##$!%! $%& '(' ')* + , ! ! - $ $ .& / 0./1 & ! ./ 2 ()( !*$! $- $ 3 &&- $ -4 5+ ! $ " ## ! & * ! 4 + & !6! - ! " ## ! $ ''- 7)))8$!%! $%&'(' ')4 + !6 $7!&$$! ! * ! ! ! 9 $ ! $ + :!-'' &' & ) !(;+:!!& & - $! <(=+> $ +9 !?' ! @ %5 0@%51 $A 0A1 $ & +:!"% ( $! &! ! &! * !@ & '$ )' "& 0"1+ A $$ ! !& ) ! ! & 3 $ )%& 6 +A ! $!%! $%&)'()' )') *+A $!%! $%&'(' ') 0*1! $!$!! $! )%&+ :! * $ ! %! $ %& '( ' ') $ & $!- -& $ !' - $!-+%&'(' ') (;;(;; (;;?& + - 4!$ 6!* !& ! & !- $$+ !$ & $ $ ! & $ ! ! $ & $ - 3 !! A !! !!!&+! ! $ ! & ! $ !! &+ 9, (! !6 $ B"&5 0B"51 $ ! %! $ %& '( ' ')+ A 0A1)+)+(!B"5 ! < 5 ! ! + $ !$$ $&01 & !, 85 +:! $ (+ " ##7)))8 + "+7((( )+ & " &"+7(?;= ?+ "+7?)?>( + $ , &"+7)>8 . ! !! - !! & $ ! $+ " ## ! & ! &A+ $$ ! &! ! " ##+ :! ! & & $ ! <9$$+ :!$ $!*7)))8! $7$ ''- $7)))8+ - 0(C1$! ! ! $!6 $!* $$ !6 ! * *& ! !*+:!* !@ %&5 $ ! $ 9 B++(8?+;+ (+ ! " ## Page 1 of 117 CONSTRUCTION CONTRACT BETWEEN CITY AND CONTRACTOR This Agreement is made and entered into at Vernon, California this 5th day of April, 2022, by and between the CITY OF VERNON, a chartered municipal corporation (hereinafter "City") and Capital Industrial Coatings, LLC, an Illinoiscorporation (hereinafter "Contractor"), for construction of Rehabilitation of Reservoirs 2-1, 2-2, and 2-3, Contract No. LP-0655. THE PARTIES HERETO AGREE AS FOLLOWS: 1.CONTRACT DOCUMENTS The “Contract Documents” except for modifications issued after execution of this Agreement, shall consist of the following documents which are either attached hereto as exhibits or are incorporated into this Agreement by this reference, with the same force and effect as if set forth at length herein: A. Governmental Approvals including, but not limited to, permits required for the Work B. This Agreement C. Exhibit A – General Conditions D. Exhibit A1 – Performance Bond E. Exhibit A2 – Payment Bond F. Exhibit A3 – Maintenance Bond G. Exhibit A4 – Insurance Requirements H. Exhibit A5 – Statement to Comply with Minimum Requirements of the Stormwater Permit I. Exhibit A6 – Statement of Intent to Comply with Minimum Requirements of the California Covid-19 Industry Guidance: Construction J. Exhibit B – Special Provisions Specific for this Project K. Exhibit C – Equal Employment Opportunity Practices Provisions L. Notice Inviting Bids M. Instructions to Bidders N. Bid Forms Page 2 of 117 O. Designation of Subcontractors 2.REFERENCE DOCUMENTS The following Reference Documents are not considered Contract Documents and were provided to the Contractor for informational purposes. Contractor may rely upon the technical data contained in such documents but not upon non- technical data, interpretations, opinions or provisional statements contained therein: 3.SCOPE OF WORK Within the Contract Time and for the stated Contract Sum, subject to adjustments thereto, and pursuant to the Contract Documents, the Contractor shall perform and provide all necessary: labor; services; supervision; materials; tools; equipment; apparatus; facilities; supplies; tools; permits, inspections, plan checks, and similar Governmental Approvals; temporary utilities; utility connections; and transportation necessary to complete the Work in strict conformity with the Contract Documents for: Rehabilitation of Reservoirs 2-1, 2-2, and 2-3 Contract No. LP-0655 4. TIME FOR PERFORMANCE Contract Time. Contractor shall achieve Substantial Completion of the Work within three hundred twenty (320) calendar days from the Date of Commencement established in City’s written Notice to Proceed (“Contract Time”), subject to adjustment in accordance with the Contract Documents. Contractor shall achieve Final Completion of the Work, within the time established by the Certificate of Substantial Completion issued by the City. The Contract Time may only be adjusted as permitted by this Construction Contract and the General Conditions. Time is of the essence of this Agreement. Except when the Contract Documents state otherwise, time is of the essence in the performance of the Work. Contractor acknowledges that the time limits and deadlines set forth in the Contract Documents are reasonable for Contractor to perform and complete the Work. Liquidated Damages. If Contractor fails to achieve Substantial Completion of the entire Work within the Contract Time for Substantial Completion, Contractor shall pay City as liquidated damagesthe amount of five hundred dollars ($500.00) per day for each calendar day occurring after the expiration of the Contract Time for Substantial Completion until Contractor achieves Substantial Completion of the entire Work, as required by Article 3 of the General Page 3 of 117 Conditions of Contract. Contractor Initial here: _________. 5. CONTRACT SUM In consideration of the Contractor’s full, complete, timely, and faithful performance of the Work required by the Contract Documents, City shall pay Contractor the sum of two million thirty-three thousand three hundred eight dollars/no cents ($2,033,308.00), payable as set forth in the General Conditions (“Contract Sum”). 6.PERMIT FEE REIMBURSEMENT In accordance with Paragraph 1.03 of the General Conditions, the City shall reimburse Contractor for the documented actual direct cost of Permit Fees, without Allowable Mark-up, in addition to payment of the Contract Sum.) IN WITNESS WHEREOF, the parties have caused this Contract to be executed the date and year first above written. Executed at ___________________, California. Capital Industrial Coatings, LLC: By: _______________________________________ An Authorized Signatory Printed Name: ______________________________ Title: ______________________________________ Date: ______________________________________ Capital Industrial Coatings, LLC By: _______________________________________ An Authorized Signatory Printed Name: ______________________________ Title: ______________________________________ Date: ______________________________________ Contractor’s Corporate Seal Page 4 of 117 CITY OF VERNON: APPROVED AS TO FORM: By: By: Name: Name: Zaynah N. Moussa Title: Title: Interim City Attorney Date: ATTEST: By: Name: Lisa Pope Title: City Clerk CONTRACTOR’S SIGNATURE MUST BE NOTARIZED Page 5 of 117 EXHIBIT A GENERAL CONDITIONS ARTICLE 1 - PRELIMINARY PROVISIONS 1.01 DEFINITIONS The following words shall have the following meanings: A. Allowance. A line item cost estimate established by the City to be carried in the Base Bid sum, Contract Sum, and Schedule of Values for Payment for a particular item of Work, which cannot be sufficiently defined so as to allow the Contractor to adequately determine fair value before the Bid Deadline. Allowances include estimated amounts established by the City for certain construction elements that have not yet been fully designed or authorized for inclusion in the Work or to permit deferred approval or selection of actual materials and equipment to a later date when additional information is available for evaluation. B. As-Builts. The documents prepared by Contractor showing the condition of the Work as actually built, including, without limitation, all changes and the exact locations of all mechanical, electrical, plumbing, HVAC or other portions of the Work that are shown diagrammatically in the Contract Documents. C. Base Bid. The total sum stated in the Bid Form for which the Bidder offers to perform Work described in the Contract Documents as the base Contract Work (e.g. not designated as part of a Bid Alternate). D. Bid. A complete and properly executed offer by the Bidder on City-prescribed forms to perform the Work for the prices stated in response to the Notice Inviting Bids. E. Bid Alternate. An item of Work described in the Contract Documents as an Alternate Bid that will be added to or deducted from the Base Bid and the Contractor’s responsibility only if the City accepts the Bid Alternate. F. Bid Forms: The City-prescribed forms which the Bidder shall complete and use to submit a Bid. The Bid Forms include: (1) Bidder’s Proposal; (2) Schedule of Bid Prices; (3) Incumbency Certificate; (4) Bid Bond; (5) Bidder’s Statement of Qualifications; (6) Experience Form; (7) Trades Experience Form; (8) Contractor Safety Questionnaire; (9) Designation of Subcontractors; (10) Affidavit of Non- Collusion; (11) Insurance Requirements Affidavit; and (12) forms included in the Specification required by the type of project funding (e.g. federal, ARRA, HUD, etc.). G. Bidder. The individual, partnership, firm, corporation, joint ventureor other legal entity submitting a bid on these Contract Documents or any part thereof. H. Bidding Documents. Bidding Documents include the Bidding Requirements and the proposed Contract Documents. The Bidding Requirements consist of: (1) Notice Inviting Bids; (2) Instructions to Bidders; and (3) Bid Forms. The proposed Contract Documents consist of: (1) the Bidding Requirements; (2) the Construction Contract Between City and Contractor; (3) the Conditions of the Contract (General, Supplementary, and Special, if applicable); (4) all Exhibits to the Contract; (5) the Drawings; (6) the Specifications; (7) all Addenda issued prior to the execution of the Construction Contract; (8) all Modifications issued after the execution of the Construction Contract; and (9) Governmental Approvals, if any, including but not limited to, permits. Page 6 of 117 I. ChangeOrder. A Change Order is a written document prepared by the City reflecting the agreement between the City and Contractor for: a change in the terms or conditions of the Contract, if any; a specific Scope Change in the Work; the amount of the adjustment, if any, in the Contract Sum; and the extent of the adjustment, if any, in the Contract Time. J. Change Order Request (COR). A Change Order Request is a written document originated by the Contractor, which describes an instruction issued by the City after the effective date of the Contract, which Contractor believes to be a scope change that may result in changes to the Contract Sum or Contract Time or, which describes the need for or desirability of a change in the Work proposed by Contractor. K. City or Owner. The City of Vernon, California, acting through its City Council or other City officials authorized to act for the City, acting in its proprietary rather than regulatory capacity in connection with the Project. L. Construction Change Directive. A written order prepared and signed by the City directing a change in Work prior to agreement on adjustment, if any, in the Contract Sum or Contract Time, or both. M. Contract Documents. The Contract Documents are enumerated in the Construction Contract between City and Contractor and consist of: (1) the Bidding Requirements; (2) the Construction Contract; (3) the Conditions of the Contract (General, Supplementary, and Special, if applicable); (4) all Exhibits to the Contract; (5) the Drawings; (6) the Specifications; (7) all Addenda issued prior to the execution of the Contract; (8) all Modifications issued after the execution of the Contract; and (9) Governmental Approvals, including, but not limited to, permits. The intent of the Contract Documents is to include all items necessary for the proper execution and completion of the Work by the Contractor. The Contract Documents are complementary, and what is required by one shall be as binding as if required by all; performance by the Contractor shall be required to the extent consistent with the Contract Documents and reasonably inferable from them as being necessary to produce the indicated results. N. Contract. The Contract Documents form the Contract for Construction. The Contract Represents the entire and integrated agreement between the parties hereto and supersedes prior negotiations, representations, or agreements, either written or oral. The Contract may be amended or modified on by a Modification. The Contract Documents shall not be construed to create a contractual relationship of any kind between any persons or entities other than the Owner and the Contractor. There shall be no third party beneficiaries of the Contract Documents. O. ContractSum. The total amount of compensation stated in the Construction Contract that is payable to Contractor for the complete performance of the Work in accordance with the Contract Documents. P. Contract Time. The total number of days set forth in the Construction Contact within which Substantial Completion of the Work must be achieved beginning with the Date of Commencement established in the Notice to Proceed, subject to adjustments in accordance with the terms of the Contract Documents. The Contract Time for Contractor's performance of the Work is measured in calendar days (not work days). Q. Contractor. The individual, partnership, firm, corporation, joint venture or other legal entity with whom the Contract is made by City, or the agent or legal representative who may be appointed to represent such individual, partnership, firm, corporation, joint venture or other legal entity in the execution of the Contract as general contractor for construction of the Work. Page 7 of 117 R. Correction Period. Correction Period is synonymous with the terms of the correction guarantee period used in the Contract Documents. S. Date of Commencement. The date for commencement of the Work fixed by City in a Notice to Proceed to Contractor. T. Day. The terms “day” or “days” mean calendar days unless otherwise specifically designated in the Contract Documents. The term “Work Day” or “Working Day” shall mean any calendar day except Saturdays, Sundays and City recognized legal holidays. City Holidays are as follows: 1. January 1st – New Year’s Day 2. The 3rd Monday in January – Martin Luther King, Jr. Day 3. The 3rd Monday in February – Presidents Day 4. March 31st – Cesar Chavez Day 5. The last Monday in May – Memorial Day 6. July 4th – Independence Day 7. The first Monday in September – Labor Day 8. The second Monday in October – Indigenous Peoples’ Day 9. November 11th – Veterans Day 10. The 4th Thursday in November – Thanksgiving Day 11. December 24th – Christmas Eve 12. December 25th – Christmas Day 13. December 31st – New Year’s Eve U. Director. The General Manager of Public Utilities of the City of Vernon or his/her duly appointed representative. V. Drawings. The Drawings are the graphic and pictorial portions of the Contract Documents showing the design, location, and dimensions of the Work, generally including plans, elevations, sections, details, schedules, and diagrams. W. Extra Work. New or unforeseen work will be classified as Extra Work when determined by the City that the work is not described in, or reasonably inferable from, the Contract Documents, the work is not covered by any Bid line item or Allowance, and the work causes Contractor to incur additional and unforeseen costs. X. Field Directive. See, “Work Directive.” Y. Final Completion. Final Completion is the stage of performance of the Work when (1) all Work required by the Contract Documents has been fully completed in compliance with the Contract Documents and all applicable laws including, but not limited to, correction or completion of all punch list items noted by City upon Substantial Completion; (2) Contractor has delivered to City an Application for Final Payment and all closeout documentation required by the Contract Documents; and (3) documentation of all final Governmental Approvals has been submitted to City including, but not limited to a final Certificate of Occupancy or equivalent Building Department sign-off has been issued covering the entire Project site without exception or conditions. Z. Force Majeure. “Force Majeure” includes but is not limited to declared or undeclared war, sabotage, insurrection, riot, or other acts of civil disobedience, labor disputes, fires, explosions, floods, earthquakes or other acts of God. Page 8 of 117 AA. Fragnet. The sequence of new activities that are proposed to be added to an existing schedule. BB. Governmental Approval. Any approval, authorization, inspection, certification, consent, exemption, filing, permit, registration, plan check, ruling or similar authorization required by any federal, state or local law, regulation or procedures in order for Contractor to perform the Work. CC. Guarantee. Assurance to City by Contractor or product manufacturer or other specified party, as guarantor, that the specified warranty will be fulfilled by the guarantor in the event of default by the warrantor. DD. Modification. A Modification is: (1) a written amendment to Contract signed by both parties; (2) a Change Order; or (3) a Construction Change Directive. EE. Notice to Proceed. The Notice to Proceed is a document issued by the City fixing the date for Commencement for the Work. FF. Parties. The City and Contractor may be referred to in the Contract Documents from time to time as the Parties. GG. Permit Fees. The actual direct costs paid by Contractor for Governmental Approvals and Utility Fees. HH. Permit Fees Reimbursement. A payment made to the Contractor by the City in addition to the Contract Sum to compensate Contractor for the actual direct cost of all Permit Fees. II. Project. The Project is the total construction of which the Work performed under the Contract Documents may be the whole or a part and which may include construction by the City or by separate contractors. JJ. Project Manual/Contract Package. The volumes of Contract Documents and reference documents assembled for the Work made available to Bidders. KK. Record Documents. The Drawings, Specifications, addenda, requests for information, bulletins, Change Orders and other modifications to the Contract Documents, approved shop drawings, product data, samples, mock-ups, permits, inspection reports, test results, daily logs, schedules, subcontracts, and purchase orders. Records Documents shall include a set of “As-Built” Drawings and Specifications, which shall be continuously updated during the prosecution of the Work. LL. Site. The physical area designated in the Contract Documents for Contractor's performance of the Work. MM. Specifications. The Specifications are the volume(s) assembled for the Work that includes, without limitation, the Bidding Documents, the Construction Contract and Exhibits, the General Conditions, Supplementary and/or Special Conditions, if any, the “GREENBOOK” STANDARD SPECIFICATIONS FOR PUBLIC WORKS CONSTRUCTION (2012 Edition), the Standard Plans for Public Works Construction (2009 Edition), State of California, Department of Transportation Standard Plans and Standard Specifications (2010 Edition), and the City of Vernon Standard Plans. NN. Specifications. The Specifications are that portion of the Contract Documents consisting of the written requirements for materials, equipment, systems, standards, and workmanship for the Work Page 9 of 117 and performance of related services, including, but not limited to, the Project Technical Specifications, Standard Specifications, if any, and any applicable Trade Association Specifications. OO. Substantial Completion. Substantial Completion is defined to mean the stage in the progress of the Work when the Work is sufficiently complete in accordance with the Contract Documents as determined by the City so that the City can occupy and utilize the Work for its intended use and as further defined in the Contract Documents. PP. Unilateral Change Order. See “Work Directive.” QQ. Utility Fees. The fees charged by any public, private, cooperative, municipal and/or government line, facility or system used for the carriage, transmission and/or distribution of cable television, electric power, telephone, water, gas, oil, petroleum, steam, chemicals, sewage, storm water or similar commodity including, but not limited to fees for temporary utilities and refuse hauling. RR. Warranty. Assurance to City by contractor, installer, supplier, manufacturer or other party responsible as warrantor, for the quantity, quality, performance and other representations of a product, system service of the Work. SS. Work. The term "Work" means the construction and other services required by, and reasonably inferable from the Contract Documents, whether completed or partially completed, and includes all other labor, materials, equipment, and services provided or to be provided by the Contractor to fulfill the Contractor's obligations. The Work may constitute the whole or a part of the Project. TT. Work Directive. A Work Directive is a unilateral written order issued by the City directing Contractor to continue performance of the Work or to perform a disputed change in the Work prior to agreement or adjustment, if any, in the Contract Sum, Contract Time, or both. 1.02 REPRESENTATIVES A. The Director shall be the representative of the City and, except as otherwise expressly provided herein, shall make all decisions and interpretations to be made by the City under the provisions of the Contract Documents. B. The Contractor shall at all times be represented on the Work in person or by a duly designated agent. Instructions and information given by the Director to the Contractor's agent on the Work shall be considered as having been given to the Contractor. 1.03 PERMITS, INSPECTIONS, PLAN CHECKS, AND SIMILAR GOVERNMENTAL APPROVALS AND UTILITIES A. Except as otherwise provided in the Notice Inviting Bids, the Contractor shall apply for, obtain, and pay for all permits including, but not limited to, building or structure permits, plumbing system permits, mechanical system permits, electrical system permits, structural system permits, demolition permits, excavation permits, street use permits, driveway permits, sidewalk, curb, sewer, gutter, crosswalk, paving or other street work grading permits, street/utility use permits, OSHA permits, fire sprinkler permits, fence permits, blasting permits, landscaping/irrigation permits, and permits to demolish, remove, or make major alterations to any designated historic resource; inspections; and plan checks obtained after the Date of Commencement of the Work. The Notice Inviting Bids contains a list of permits and other Governmental Approvals and Utility Fees obtained and paid for by the City prior to the Date of Commencement; Contractor is responsible for obtaining all Governmental Approvals and Page 10 of 117 Utility Fees not listed in the Notice Inviting Bids. B. The City will reimburse Contractor monthly for the documented actual direct cost paid to governmental agencies or utilities for all Permit Fees according to the payment provisions of the Contract Documents after submission to the City of the Contractor’s and/or Subcontractors’ original receipts from the governmental entities or utilities (“Permit Fee Reimbursement”). Contractor shall deliver the original receipt to the City’s Project Manager with each permit. All Permit Fees shall be separately itemized in each Application for Payment and copies of the receipt(s) and permit(s) must be attached. The Base Bid sum / Contract Sum shall include the cost of administration and coordination for all Governmental Approvals and Utility Fees. C. All documents evidencing Contractor’s satisfaction with all Governmental Approvals and Utility Fees must be submitted to the City prior to submission of the Application for Final Payment. D. Where requirements of the Governmental Approvals differ from those of the Drawings and Specifications, the more stringent requirements shall apply. E. Unless otherwise specified in the Contract Documents, Contractor shall be responsible for payments of all Utility Fees from the Date of Commencement until City’s Final Acceptance of the Work. 1.04 LICENSES The Contractor shall apply for, obtain, and pay for all licenses required by governing authorities for the Work. Contractor shall apply and pay for a City of Vernon business license. 1.05 ALLOWANCES A. Contractor shall include in the Contract Sum and Schedule of Values for Payment, the City’s estimated cost established for each Work item covered by an Allowance stated in the Contract Documents. See Paragraph 1.01 for definition of Allowance. B. The line item cost estimate established by the City for Work covered by an Allowance includes the cost to Contractor of: all materials and equipment, preparation of submittals; labor; transportation; delivery; handling; installation; supervision; overhead; profit; licenses; bonds; insurance; all sales, use and other taxes legally chargeable; and all other costs and expenses incidental to such Work. C. Work items covered by Allowances shall be supplied with such materials and equipment and for such prices approved in advance by City. Contractor shall notify and request City’s approval of material equipment, and pricing information for Work covered by an Allowance before ordering the material or equipment and in sufficient time to avoid delay to the Work. City shall provide approval of materials, equipment, and prices with reasonable promptness. The material, equipment, and pricing information submitted by the Contractor to the City’s Project Manager shall, at a minimum, include product data and detailed costs of material, equipment, and labor to complete such Work, itemized by costs incurred by Contractor and each subcontractor associated with the performance ofsuch Work. Contractor shall not order materials or equipment or proceed with Work covered by an Allowance until the material, equipment, and pricing information for such Work items have been submitted to the City’s Project Representative for review and the Contractor has received City’s approval to proceed with a Work item covered by an Allowance. D. All expenditures for Allowance Work shall be separately itemized in each Application for Payment. Page 11 of 117 E. To the extent that the cost of Work items covered by an Allowance is less than the Allowance cost estimate established by the City, the Contact Sum shall be reduced by Change Order or Construction Change Directive to reflect the actual cost of the Allowance item. Similarly, to the extent the cost of Work items covered by an Allowance is greater than the Allowance cost estimate, the Contract Sum shall be increased by Change Order or Construction Change Directive to reflect the actual cost of the Allowance item. If Work items covered by an Allowance are not performed or the City deletes such items from the Scope of Work, the Contract Sum shall be reduced by Change Order or Construction Change Directive to deduct the Cost of the unused Allowance item. 1.06 WAIVER A waiver by City of any breach of any term, covenant, or condition contained in the Contract Documents shall not be deemed to be a waiver of any subsequent breach of the same or any other term, covenant, or condition contained therein, whether of the same or a different character. 1.07 DATA TO BE FURNISHED BY THE CONTRACTOR The Contractor shall furnish the Director with such information as the Director may desire respecting the character of the materials and the progress and manner of the Work, including all information necessary to determine the Contractor’s costs, such as the number of persons employed, their pay, the time during which they worked on the various classes of construction, and other pertinent data. 1.08 CONTRACT DRAWINGS The City will accept no responsibility for errors resulting from misinterpretation or scaling of the Drawings. 1.09 SPECIFICATIONS AND DRAWINGS A. The Contractor shall keep on the Work Site a copy of all Specifications, Drawings, and Change Orders pertaining to the Work and shall at all times give the Director access thereto. Anything mentioned in the Specifications and not shown on the Drawings or shown on the Drawings and not mentioned in the Specifications shall be of like effect as though shown or mentioned in both. B. In general, the Drawings will show dimensions, positions, and kind of construction; and the Specifications will define materials, quality, and standards. Any Work not particularly detailed, marked or specified, shall be the same as similar parts that are detailed, marked or specified. C. The Drawings shall not be scaled to determine dimensions, and in all cases shall be calculated from figures shown on the Drawings. Any discrepancies between scale and figured dimensions, not marked “not to scale,” must be brought to the Director’s attention before proceeding with the Work affected by the discrepancy. D. Omissions from the Drawings and/or Specifications shall not relieve the Contractor from the responsibility of furnishing, making, or installing all items required by law or code, or usually furnished, made or installed in a project of the scope and general character indicated by the Drawings and Specifications. E. For convenience, the Drawings and Specifications may be arranged in various trade subparagraphs, but such segregation shall not be considered as limiting the Work of any subcontract or trade. The Contractor shall be solely responsible for all subcontract arrangements of the Work regardless of the Page 12 of 117 location or provision in the Drawings and Specifications. F. The City will furnish free of charge to the Contractor, a maximum of six (6) sets of Contract Drawings and Specifications. The Contractor shall pay for the costs of any additional sets or portions thereof. The Contractor shall be responsible to see that all sets are the same as the up-to-date approved set. 1.10 PRECEDENCE OF CONTRACT DOCUMENTS A. In the event of conflict between any of the Contract Documents, the provisions placing a more stringent requirement on the Contractor shall prevail. The Contractor shall provide the better quality or greater quantity of Work and/or materials unless otherwise directed by City in writing. In the event none of the Contract Documents place a more stringent requirement or greater burden on the Contractor, the controlling provision shall be that which is found in the document with higher precedence in accordance with the following order of precedence: 1. Governmental Approvals including, but not limited to, permits required for the Work 2. Modifications issued after execution of the Contract (including modifications to Drawings and Specifications) 3. The Contract, including all exhibits, attachments, appendices and Addenda, with later Addenda having precedence over earlier Addenda 4. Special Conditions, if any 5. General Conditions 6. Specifications 7. Drawings 8. Bidding Requirements B. With reference to the Drawings, the order of precedence is as follows: 1. Change Order Drawings 2. Addenda Drawings 3. Contract Drawings 4. Project Drawings 5. Standard Drawings 6. Detail Drawings 7. General Drawings 8. Figures 9. Scaled dimensions C. Within the Specifications, the order of precedence is as follows: 1. Change Orders 2. Special Conditions 3. Project Technical Specifications 4. Standard Specifications, if any 5. Applicable Trade Association Specifications 1.11 NOTICE OF CONFLICTS If the Contractor, in the course of the Work, becomes aware of any claimed conflicts, errors or omissions in the Contract Documents or in the City's fieldwork or work of City's separate contractors, the Contractor shall immediately notify the Director in writing. The Director shall promptly review the matter, and if the Director Page 13 of 117 finds a conflict, error or omission, the Director shall determine the corrective actions and advise the Contractor accordingly. If the correction associated with a conflict, error or omission increases or decreases the amount of Work called for in the Contract, the City shall issue an appropriate Change Order in accordance with the Contract Documents. After discovery of an error or omission by the Contractor, any related additional work performed by the Contractor shall be done at the Contractor's risk unless authorized by the Director. 1.12 REPORTS A. Daily Construction Reports: The Contractor shall prepare a daily construction report recording the following information concerning events at Project site: 1. List of Subcontractors at Project site. 2. List of other contractors at Project site. 3. Approximate count of personnel at Project site. 4. Equipment at Project site. 5. Material deliveries. 6. High and low temperatures and general weather conditions, including presence of rain or snow. 7. Accidents. 8. Meetings and significant decisions. 9. Unusual events. 10. Stoppages, delays, shortages, and losses. 11. Meter readings and similar recordings. 12. Emergency procedures. 13. Orders and requests of authorities having jurisdiction. 14. Change Orders received and implemented. 15. Construction Change Directives received and implemented. 16. Services connected and disconnected. 17. Equipment or system tests and startups. 18. Partial completions and occupancies. 19. Substantial Completions authorized. 20. List of visitors to Project Site. 21. List of personnel at Project Site including names and job classifications. 22. Description of Work for the day including locations, quantities and related bid items. Immediately upon discovery of a difference between field conditions and the Contract Documents, the Contractor shall prepare and submit a detailed report through a Request for Information (RFI). Include a detailed description of the differing conditions, together with recommendations for a remedy. The Daily Construction Report must be: signed by Contractor’s Superintendent, submitted within 24 hours (next Working Day) to the Director, and shall be made available to others as directed by City. 1.13 LINES, GRADES, AND MEASUREMENTS A. All lines and grades will be established by the Contractor. The Contractors shall carefully preserve all survey stakes and reference points as far as possible. Should any stakes or points be removed or destroyed unnecessarily by any act of the Contractor or his/her employees, they must be reset to the satisfaction of the Director, at the Contractor's expense. B. The Contractor shall inform the Director 48 hours (two Work Days) in advance of the times and places at which he/she intends to Work in order that inspection may be provided, and that necessary Page 14 of 117 measurements for records and payments may be made with minimum inconvenience. C. No direct payment will be made for the cost to the Contractor of any of the Work or delay occasioned by giving lines and grades, by making other necessary measurements, or by inspection. 1.14 RIGHT OF WAY A. The site for the installation of equipment or the right of way for the Work to be constructed under this Contract will be provided by the City. B. The City will provide the appropriate rights of way and property for pipelines and structures. Upon approval by the Director, the Contractor may, without cost, use portions of any of the City's rights of way or property which may be suitable for working space and for storage of equipment and materials. The Contractor will be held responsible for any damage to structures, streets, and roads, trees and landscaping, and for any damage that may result from his/her use of City property. C. In case areas additional to those available on the City's rights of way or property are required by the Contractor for his/her operations, he/she shall make arrangements with the property owners for the use of such additional areas at his/her own expense. 1.15 CONTRACTOR’S OPERATIONS/STORAGE YARD In the event the Contractor requires space for the storage and/or staging of construction materials, supplies, equipment, stockpiling of debris, or any other needs required for construction operations, he/she shall acquire at his/her own expense such areas as he/she may desire. For properties within the City of Vernon, the staging area must be enclosed at Contractor’s expense with construction fencing covered with a mesh screen to limit visibility to the site. Private property used for storage of construction material or debris shall be restored to a legal condition with regard to appearance and maintenance upon conclusion of the project. Property should be graded and free of weeds and debris when project is completed. [END OF ARTICLE] Page 15 of 117 ARTICLE 2 - PERFORMANCE OF THE WORK 2.01 PERFORMANCE OF WORK - GENERAL Contractor shall, at its own cost and expense, furnish all necessary materials, labor, transportation, and equipment for doing and performing said Work and the materials used shall comply with the requirements of the Contract Documents. All Work shall be performed and completed as required in the Contract Documents, and subject to the approval of the Director, or his/her designated assistant. 2.02 NO ASSIGNMENT OR DELEGATION Contractor shall not assign or delegate the duties or obligations under this Contract or his/her interest therein in whole or in part without the prior written consent of the City which may be withheld at the City's sole discretion. 2.03 STANDARD OF PERFORMANCE Contractor agrees that all services performed hereunder shall be provided in a manner commensurate with the highest professional standards and shall be performed by qualified and experienced personnel; that any Work performed by Contractor under the Contract will be performed in the best manner; that any material furnished shall be subject to the approval of the Director; and that both Work and materials will meet fully the requirements of the Contract Documents.Any work deemed unacceptable by the Director, whether a cause is determined or not shall be repaired or replaced by Contractor at Contractor’s expense. The Contractor shall be responsible for the final product and shall make any quality control, adjustments and corrections necessary to obtain the final product accepted by the City Engineer. The Contractor shall perform process and quality control sampling and testing and exercise management control the work of his/her subcontractors, technicians and workers to ensure that the milling, transporting, recycling, spreading, compaction, and finishing processes conform to these Specifications. The proficiency of testing laboratories and sampling and testing personnel shall be reviewed and approved by the City Engineer prior to providing services to the project. The City Engineer shall have unrestricted access to the laboratory, sampling, testing sites, and all information resulting from mix design and quality control activities. All Quality Control testing results shall be submitted to the City Engineer on a daily basis. 2.04 DEFECTIVE WORK Within the time periods that the City specifies, the Contractor shall correct all deficient, improperly executed, or unsatisfactory Work determined by the City. The Contractor shall remove and shall repair or replace, at his/her own expense any part of the Work that is deficient, improperly executed, or unsatisfactorily executed, even though it has been included in the monthly estimates. If he/she refuses or neglects to remove, repair, or replace such defective Work, prior to the City’s acceptance of the Work, it may be replaced by the City at the expense of the Contractor, plus 15%for overhead expenses, and his/her sureties shall be liable therefor. (See Paragraph 2.15 for curing defects after acceptance of the Work.) 2.05 CITY’S RIGHT TO CARRY OUT THE WORK A. Notwithstanding other remedies available to the City, if the Contractor defaults, fails to perform Work required by the Contract Documents, or otherwise neglects to carry out the Work in accordance with the Contract Documents and fails within a 48 hour period after receipt of written notice from the City to commence and correct such default, failure to perform, or neglect with diligence and promptness, the Page 16 of 117 City, at its sole discretion and without obligation, may, with its own or outside forces, perform the Work Contractor has failed to perform and/or replace or correct deficiencies in the Work. In such case, a Change Order or Construction Change Directive shall be issued deducting from payments then or thereafter due to the Contractor the cost of completion, replacement or correction of such deficiencies, including compensation for additional services by the City’s project management staff, the Architect, and their respective consultants made necessary by such default, failure to perform, or neglect, plus 15% for City’s overhead expenses. If payments then or thereafter due the Contractor are not sufficient to cover such amounts, the Contractor shall pay the difference to the City immediately. This remedy is cumulative. B. The City also has the right, but not the obligation, to self-perform or have outside forces perform portions of the Work previously assigned to Contractor. In such case a Change Order or Construction Change Directive shall be issued, reducing the Contract Sum by the Unit Price(s) applicable to such deleted Work or, in the absence of Unit Prices, an amount that reflects the reasonable cost of performing such deleted Work and the Allowable Mark-Up applicable to such deleted Work. 2.06 COMMUNICATIONS AND NOTICES REGARDING THE WORK A. Notices under the Contract Documents shall be in writing and (a) delivered personally, (b) sent by certified mail, return receipt requested, or (c) sent by a recognized overnight mail or courier service, with delivery receipt requested, to the following addresses (or to such other address as may from time to time be specified in writing by such Person): All correspondence with Contractor shall be sent to the following address: Capital Industrial Coatings, LLC 17792 Metzler Lane A Huntington Beach, CA 92647 Attention: Spiro Poulos Phone:(219) 293-1883 All communications shall be copied to City and shall be delivered to City’s Director at the address set forth below, with copies to such additional persons as may be directed by City’s Director. City of Vernon Vernon Public Utilities 4305 Santa Fe Avenue Vernon, CA 90058 Attention: Mark Aumentado, P.E. Phone:(323) 583-8811 ext. 309 E-mail: maumentado@cityofvernon.org B. Notices shall be deemed received when actually received in the office of the addressee (or by the addressee if personally delivered) or when delivery is refused, as shown on the receipt of the U. S. Postal Service, private carrier or other Person making the delivery. All notices received after 5:00 p.m. shall be deemed received on the first business day following delivery. Any technical or other communications pertaining to the Work shall be conducted by Contractor's Project Manager and technical representatives designated by City. Contractor's representatives shall be available at all Page 17 of 117 reasonable times for consultation, and shall be authorized to act on behalf of Contractor in matters concerning the Work. C. Contractor shall copy City on all written correspondence pertaining to the Contract between Contractor and any Person other than Contractor's Subcontractors, consultants and attorneys. D. Notification of Affected Residents/Businesses. The Contractor shall be responsible for distribution of the general information letter of the project to all affected residents and businesses. A project general information letter and sufficient copies thereof will be prepared by City staff for Contractor distribution to all residents, business establishments, and institutions fronting on or directly affected by the project. The Contractor shall be responsible for distribution of said letter in handout form to all the appropriate residences and buildings in the subject area. Distribution shall be accomplished in a manner acceptable to the City Engineer and shall be five (5) working days prior to the beginning of construction operations in the immediate vicinity. In addition to the above, the Contractor shall be fully responsible for such other notifications as may be required related to necessary closures of streets, alleys, driveways, etc., or to unavoidable access or parking restrictions. These notifications shall apply where the closures and access or parking restrictions required in the performance of any work under this contract preclude any resident, tenant, or property owner from utilizing the premises or conducting business thereon in a reasonable and customary manner. Additional notification to the affected businesses and residents shall be prepared by the City and distributed by the Contractor for roadway and driveway closures five (5) working days in advance of any construction work. No removal or excavation work is allowed until the additional notification has been distributed to the affected residents and businesses. If a Contractor is unable to adhere to his schedule as indicated on his written notification, then all the affected residents and places of business shall be re-notified of the revised schedule, in writing, as indicated above. Contractor costs for all of the above notifications shall be considered as included in the appropriate items of the Bid Proposal. E. Notification of Utilities – The provisions of Section 5 entitled "Utilities" of the “Greenbook” Standard Specifications shall apply. The Contractor shall contact the Underground Service Alert of Southern California (U.S.A.) at least two working days in advance of the construction work 2.07 INDEPENDENT CONTRACTOR The Contractor in the performance of the Work hereunder will be acting in an independent capacity and not as an agent, employee, partner, or joint venture of the City. 2.08 EMERGENCY WORK A. During Working Hours: In case of an emergency which threatens loss or injury of property, and/or safety of life during working hours, the Contractor shall act, without previous instructions from the City, as the situation may warrant. He/she shall notify the Director of the emergency and the action taken immediately thereafter. Any compensation claimed by the Contractor, together with substantiating documents in regard to Page 18 of 117 expense, shall be submitted to the Director within 15 calendar days after the emergency. Compensation, if allowed, will be paid for as Extra Work. B. Outside of Working Hours: Whenever, in the opinion of the City, there shall arise outside of the regular Working hours on the Contract Work of an emergency nature which threatens loss or injury of property, or danger to public safety, the Contractor shall act, without previous instructions from the City as the situation may warrant. He/she shall notify the Director of the emergency and the action taken immediately thereafter. Any compensation claimed by the Contractor, together with substantiating documents in regard to expense, shall be submitted to the Director within 15 calendar days after the emergency. Compensation, if allowed, will be paid for as Extra Work. In the event the Contractor is not able to respond to an emergency outside of regular working hours, the City's forces will handle such emergency Work. If such emergency arises out of or is the result of operations by the Contractor, the cost of the corrective measures will be billed to the Contractor and deducted from his/her payment as provided in the Contract Documents. The performance of emergency Work by City forces will not relieve the Contractor of any of his/her responsibilities, obligations, or liabilities under the Contract. 2.09 SUBCONTRACTORS A. Each subcontract shall contain a reference to the Contract between the City and the principal Contractor, and the terms of the Contract and all parts thereof shall be made part of each subcontract insofar as applicable to the Work covered thereby. If, in the Director’s opinion, the Subcontractor fails to comply with the requirements of the principal Contract insofar as the same may be applicable to the Subcontractor’s Work, the Director may disqualify the Subcontractor. B. Nothing contained in these Contract Documents shall be construed as creating any contractual relationship between any Subcontractor and the City. C. The Contractor shall be considered the employer of the Subcontractors and shall be fully responsible to the City for the acts and omissions of Subcontractors and of persons employed by them as the Contractor is for the acts and omissions of persons directly employed by him/her. D. The Contractor shall be responsible for the coordination of the trades, Subcontractors, and material suppliers engaged upon the Work. It shall be the Contractor’s duty to see that all of his/her Subcontractors commence their Work at the proper time and carry it on with due diligence so that they do not delay or injure either the Work or materials; and that all damage caused by them or their workers is made good at his/her expense. E. The City will not undertake to settle differences between the Contractor and his/her Subcontractors or between subcontractors. F. The Contractor shall utilize the services of specialty Subcontractors, without additional expense to the City, on those parts of the Work which are specified to be performed by specialty contractors. 2.10 USE OF FACILITIES PRIOR TO COMPLETION OF CONTRACT A. Whenever in the opinion of the Director any Work under the Contract, or any portion(s) thereof, is in a condition suitable for use by the City, the City may, after written notice and designation from the Director to the Contractor, use (which includes, but is not limited to, taking over or placing into Page 19 of 117 service) any portion(s) designated by the Director. B. The use of any portion(s) by the City shall not be construed as, and will not constitute acceptance in any sense, of any portion(s) of the Work of the Contractor nor will such use trigger the running of any warranty and/or guarantee periods. C. All necessary repairs, renewals, changes, or modifications in the Work or any portion thereof so used, not due to ordinary wear and tear, but due to defective materials or workmanship, the operations of the Contractor, or any other cause, shall be made at the expense of the Contractor. D. The use of any portion(s) by the City shall not relieve the Contractor of any of his/her responsibilities or liabilities under the Contract nor constitute a waiver by the City of any of the conditions thereof. Said use shall not cancel liquidated damages as of the first date of use, or any continuance thereof, nor impair, reduce, or change the amount of liquidated damages. 2.11 COOPERATION WITH OTHER WORK FORCES A. The City reserves the right to perform other Work at or near the site at any time by the use of its own forces or other contractors. B. Other contractors, other utilities and public agencies or their contractors, other City contractors, and City personnel may be working in the vicinity during the project construction period. There may be some interference between these activities and the Work under the Contract Documents. The Contractor shall cooperate and coordinate his/her Work with that of other Work forces to assure timely Contract completion. 2.12 AGREEMENTS WITH PROPERTY OWNERS Agreements with property owners for storing excavated material, storing any other materials, or for any other purpose related to the Work shall be made in writing and a copy submitted to the Director for his/her information. All storage charges shall be at the Contractor’s sole expense. 2.13 PROTECTION OF PROPERTY All public and private property, pavement or improvement, shall be safely guarded from damage or loss in connection with this Contract by the Contractor at all times. Should any facility, structure, or property be damaged during operations of the Contractor, he/she shall immediately notify the property owners or authorities. All damages and losses incurred shall be paid by the Contractor. 2.14 CONTRACTOR'S RESPONSIBILITIES FOR LOSSES OR LIABILITIES A. Risk of Loss Except as otherwise provided in the Contract Documents and except as to the cost of repair or restoration of damage to the Work caused by force majeure, the Contractor shall bear all losses resulting to him/her on account of the amount or character of the Work, or from any unforeseen obstructions or difficulties which may be encountered, or from any encumbrances on the line of the Work, or because the nature of the ground in or on which the Work is done is different from what is assumed. The Contractor shall bear the risk for any City equipment, material, or supplies with which he/she has been entrusted. Page 20 of 117 B. Materials and Facilities The Contractor shall be responsible for materials and facilities as hereinafter provided and in the event of his/her failure to carry out said responsibilities, the same may be carried out by the City at the expense of the Contractor: 1. The Contractor shall be responsible for any materials so furnished and for the care of all Work until its completion and final acceptance, and he/she shall at his/her own expense replace damaged or lost materials and repair damaged parts of the Work. 2. The Contractor shall protect City facilities from damage resulting from his/her Work. City facilities damaged by, or as a result of, the Contractor's Work under this Contract shall be repaired or replaced, as directed by the Director, at the Contractor's expense. 3. The Contractor shall remove from the vicinity of the completed Work all buildings, rubbish, unused material, concrete forms, and other materials belonging or used under his/her direction during construction. If Contractor fails to completely remove such items within a reasonable time the City may do so at the Contractor’s expense. C. Laws and Regulations 1.The Contractor shall obey all laws, ordinances, and regulations in any manner affecting those engaged or employed on the Work, or the materials used in the Work, or in any way affecting the conduct of the Work, and of all court orders and decrees having any jurisdiction or authority over the same. If any discrepancy or inconsistency should be discovered in this Contract, or in the Drawings or Specifications herein referred to, in relation to any such law, ordinance, regulation, order, or decree, he/she shall immediately report the same in writing to the Director. 2. Contractor shall, at all times, cause all his/her agents and employees to observe and comply with all such applicable laws, ordinances, regulations, orders, and decrees in effect or which may become effective before Final Completion of this Contract. 3. Nothing in the Contract Documents shall be construed to permit Work not conforming to such laws, ordinances, and regulations. If the Contractor ascertains at any time that any requirement of this Contract is at variance with such applicable law requirement, he/she shall immediately notify the Director. 4. If such applicable law requirement was not in effect on the date of submission of bids, any necessary adjustment of the Contract price shall be made as provided in Article 6 herein. If such applicable law requirement was in effect on said date of bid submission, no adjustment of Contract price will be considered. 5. The Contractor, at his/her own expense, shall pay all taxes properly assessed against his/her equipment, materials, or property used or required in connection with the Work. 2.15 WARRANTY AND CORRECTIONS A. Warranty 1.Warranty.The Contractor warrants to the City that: (i) materials and equipment furnished under the Contract will be of good quality and new unless otherwise required or permitted by Page 21 of 117 the Contract Documents; (ii) the Work will be of good quality and free from defects; (iii) the Work will conform to the requirements of the Contract Documents; and (iv) Contractor will deliver the Project free of stop notice claims. Work not conforming to these requirements, including substitutions not accepted by the City, will be deemed defective. The Contractor’s warranty excludes improper or insufficient maintenance, improper operation, or normal wear and tear and normal usage. If required by the City, the Contractor shall furnish satisfactory evidence as to the kind and quality of materials and equipment. This warranty is not limited by the correction obligation of Paragraph 2.04 herein. 2.Overlap.Where any warranties provided under the Contract Documents overlap, conflict, or are duplicative, Contractor will be bound by the more stringent requirements. 3.Procurement and Assignment of Warranties:Contractor shall obtain in the name of City, or transfer or assign to City or City’s designee prior to the time of Final Completion of the Work, any and all warranties or guarantees which Contractor is required to obtain pursuant to the contract Documents and which Contractor obtained from any other personor entity other than Contractor including, but not limited to, Subcontractors and manufacturers, and further agrees to perform the Work in such a manner so as to preserve any and all such warranties. Contractor shall secure written warranties from all Subcontractors. Contractor and its Subcontractors shall offer any warranty upgrades or extensions that are offered by manufacturers of any equipment or system installed in the Work to the City. Contractor shall deliver to City all warranty and guarantee documents and policies. 4.Survival of Warranties:The provisions of this paragraph 2.15 will survive Contractor’s completion of the Work or termination of Contractor’s performance of the Work. B. Correction of Work 1.Before or After Final Completion. The Contractor shall promptly correct Work rejected by the City or City’s designee, as failing to conform to the requirements of the Contract Documents, whether discovered before or after Final Completion and whether or not fabricated, installed, or completed. Costs of correcting such rejected Work, including additional testing, inspections, and compensation for the City’s services and expenses made necessary thereby, will be at the Contractor’s expense within the Contract Price. 2. After Final Completion. (a) In addition to the Contractor’s warranty obligations under Paragraph 2.15-A, if, within one (1) year after the date of Final Completion of the Work or within the time period established by any applicable special warranty required by the Contract Documents, any of the Work is found to be not in accordance with the requirements of the Contract Documents, the Contractor shall commence correction or replacement of such Work within forty-eight (48) hours after receipt of written notice from the City to do so. The Contractor shall perform such corrective work without charge or cost to the City after Final Completion of the Work. The City shall give such notice promptly after discovery of the condition. (b) If the Contractor fails to commence correction or replacement of non-conforming Work within forty-eight (48) hours after receipt of written notice, the City will proceed to have defects repaired or replaced at the expense of the Contractor and its Performance Bond surety, plus fifteen percent (15%) for the City’s overhead Page 22 of 117 and administrative expense. The City may charge such costs against any payment due Contractor. If, in the opinion of the City, defective work creates a dangerous or hazardous condition or requires immediate correction or attention to prevent further loss to the City or to prevent interruption of operations of the City, the City may take immediate action, give notice, make such correction, or provide such attention and the cost of such correction or attention will be charged against the Contractor. Such action by the City will not relieve the Contractor of the warranties provided in this Article or elsewhere in the Contract Documents. 3.Replacement or Removal of Defective or Unauthorized Work.The Contractor shall remove from the Site and replace those portions of the Work which are not in accordance with the requirements of the Contract Documents in a manner acceptable to and as ordered by the Director. No compensation shall be allowed for such removal or replacement. Director shall have authority to cause defective work to be remedied, removed or replaced and to deduct the costs from monies due or to become due to the Contractor. 4.Destruction or Damage.In the event the Contractor destroys or damages any construction of the City or another contractor while correcting or removing Work which is not in accordance with the requirements of these Contract Documents, the Contractor shall bear the cost of repairing or reconstructing that other construction as well. 5.No Limitation. Nothing contained in Paragraph 2.15-B will be construed to establish a period of limitation with respect to other obligations which the Contractor might have under the Contract Documents. Establishment of the one-year period for correction of Work as described in Paragraph 2.15-B relates only to the specific obligation of the Contractor to correct the Work, and has no relationship to the limitations periods established by statute for any construction defect or other causes of action. 2.16 CLEANING AND ENVIRONMENTAL CONTROLS The Contractor, Subcontractors and employees shall comply with all litter and pollution laws and it shall be the responsibility of the Contractor to ensure compliance. The Contractor shall do all of the following: A. Maintain the Site free of waste materials, debris, and rubbish and in a clean and orderly condition; and Remove waste materials, debris and rubbish from site and dispose off-site legally. B. The Contractor shall maintain at his/her disposal any and all equipment necessary to prevent and remediate any sanitary sewer overflow arising out of the Work. The Contractor shall furnish and operate a self-loading motor sweeper with spray nozzles, as directed by the Director, to maintain the affected areas in a condition of cleanliness acceptable to the City at all locations affected by the Contractor’s operations. For purposes of this Paragraph, the affected areas include the project Site as well as all haul routes to and from the project Site and all areas of construction and restoration which have not been completed. C. The Contractor shall take appropriate action to ensure that no dust originates from the project Site. D. Any equipment or vehicles driven and/or operated within or adjacent to a street gutter, storm drain, runoff conveyance or ocean shall be checked and maintained daily to prevent leaks of materials that if introduced to water could be deleterious to aquatic life. E. No debris, soil, silt, sand, bark, trash, sawdust, rubbish, cement or concrete or washings thereof, oil or Page 23 of 117 petroleum products or other organic or earthen material from any construction, or associated activity or whatever nature shall be allowed to enter into or placed where same may be washed by rainfall or runoff into waters of the State. When operations are completed, any excess materials or debris shall be removed from the Work area. 2.17 WATER POLLUTION CONTROL A. The Contractor shall meet all applicable City of Vernon, state and federal clean water laws, rules and regulations including but not limited to all conditions set forth in the Vernon Municipal Code Chapter 21, Article 5 regarding stormwater and urban runoff controls as it relates to public agency activities including, but not limited to storm and/or sanitary sewer system inspection and repair, street sweeping, trash pick-up and disposal, and street and right-of-way construction and repair are required to implement and maintain the activity specific Best Management Practices (BMPs) listed in Table 2-1 below in compliance with the National Pollutant Discharge Elimination System (NPDES) requirements. Contractor shall not discharge any water containing trash, debris, pollutants, fuels, oils, soaps or other non-allowable constituents from its sweeping vehicles upon any city street, to any storm drain or any non-permitted outlet. As part of its submission, contractor shall describe its methods for preventing NPDES violations during sweeping operations within the City. In addition, Contractor shall comply with all NPDES requirements at its maintenance facilities, storage yards and company facilities. Failure to comply with this section may result in termination for cause by the City of any contract resulting from this solicitation. Table2-1.BMPsforPublic AgencyFacilitiesand Activities General and Activity Specific BMPs GeneralBMPs SchedulingandPlanning SpillPreventionandControl Sanitary/SepticWasteManagement MaterialUse SaferAlternativeProducts Vehicle/Equipment Cleaning, Fueling and Maintenance IllicitConnectionDetection,ReportingandRemoval IllegalSpillDischargeControl MaintenanceFacilityHousekeepingPractices FlexiblePavement AsphaltCementCrackandJointGrinding/Sealing AsphaltPaving Structural Pavement Failure (Digouts) Pavement GrindingandPaving EmergencyPotholeRepairs SealingOperations RigidPavement PortlandCementCrackandJointSealing MudjackingandDrilling ConcreteSlaband SpallRepair Slope/Drains/Vegetation ShoulderGrading NonlandscapedChemicalVegetationControl Nonlandscaped Mechanical Vegetation Control/Mowing Nonlandscaped Tree and Shrub Pruning, Brush Chipping, Tree and Shrub Removal Page 24 of 117 Fence Repair Drainage Ditch and Channel Maintenance Drain and Culvert Maintenance Curb and Sidewalk Repair Litter/Debris/Graffiti SweepingOperations LitterandDebrisRemoval EmergencyResponseandCleanupPractices GraffitiRemoval Landscaping ChemicalVegetationControl ManualVegetationControl LandscapedMechanicalVegetationControl/Mowing Landscaped Tree and Shrub Pruning, Brush Chipping, TreeandShrubRemoval IrrigationLineRepairs Irrigation(Watering),PotableandNonpotable Environmental StormDrainStenciling RoadsideSlopeInspection RoadsideStabilization StormwaterTreatmentDevices TractionSandTrapDevices Bridges WeldingandGrinding Sandblasting, Wet Blast with Sand Injection and Hydroblasting Painting BridgeRepairs OtherStructures PumpStationCleaning TubeandTunnelMaintenanceandRepair TowTruckOperations TollBoothLaneScrubbingOperations Electrical SawcuttingforLoopInstallation TrafficGuidance ThermoplasticStripingandMarking PaintStripingandMarking Raised/ Recessed Pavement Marker Application and Removal SignRepairandMaintenance MedianBarrierandGuardRailRepair EmergencyVehicleEnergyAttenuationRepair StormMaintenance MinorSlidesandSlipoutsCleanup/Repair Management and Support BuildingandGroundsMaintenance StorageofHazardousMaterials(WorkingStock) Material Storage Control (Hazardous Waste) Outdoor Storage of Raw Materials Vehicle and Equipment Fueling Vehicle and Equipment Cleaning Vehicle and Equipment Maintenance and Repair Aboveground and Underground Tank Leak and Spill Control Page 25 of 117 B. Water Quality Protection Requirements for Construction Projects with Less than One (1) Acre of Disturbed Soil. All construction projects, regardless of size, will be required to implement best management practices (BMPs) necessary to reduce pollutants to the Maximum Extent Practicable (MEP) to meet the minimum water quality protection requirements and implement all applicable set of BMPs as defined in Table 2-2. Please refer to the California Stormwater Quality Association’s Construction Handbook (available on their website: www.cabmphandbooks.com) for further information regarding the BMPs listed in Table 2-2. All construction projects with Less than One (1) Acre of Disturbed Soil shall submit to the City a signed Statement of Intent to Comply with Minimum Requirements of the Stormwater Permit (Exhibit A5). The Contractor may self-certify that the following training was completed on an annual basis providing they certify they have received all applicable training: x The Contractor shall train all of their employees in targeted positions (whose interactions, jobs, and activities affect stormwater quality) on the requirements of the overall stormwater management program. x When the Work includes the use or have the potential to use pesticides or fertilizers, the Contractor shall train all of their employees (whether or not they normally apply pesticides or fertilizers as part of their work). Training programs shall address: 1) The potential for pesticide-related surface water toxicity 2) Proper use, handling, and disposal of pesticides Table 2-2 Minimum Water Quality Protection Requirements and Applicable Set of BMPs for All Construction Projects Category Minimum Requirements BMPs 1. Sediment Control Sediments generated on the project site shall be retained using adequate Treatment Control or Structural BMPs. Sediment Control 2. Non-Stormwater Management, Waste Management and Materials Pollution Control Construction-related materials, wastes, spills or residues shall be retained at the project site to avoid discharge to streets, drainage facilities, receiving waters, or adjacent properties by wind or runoff. Non-storm water runoff from equipment and vehicle washing and any other activity shall be contained at the project sites. Stormwater Management; Waste Management 3. Erosion Control Erosion from slopes and channels shall be controlled by implementing an effective combination of BMPs, such as the limiting of grading scheduled during the wet season; inspecting graded areas during rain events; planting and maintenance of vegetation on slopes; and covering erosion susceptible slopes. Erosion Control Page 26 of 117 3) Least toxic methods of pest prevention and control, including Integrated Pest Management 4) Reduction of pesticide use C. Water Quality Protection Requirements for Construction Projects with One (1) Acre (or greater) of Disturbed Soil. In addition to the minimum BMPs required in Paragraphs A and B, all construction projects where at least one (1) acre of soil will be disturbed, construction activity that results in land surface disturbances of less than one acre if the activity is part of a larger common plan of development, or the sale of one or more acres of disturbed land surface requires a Construction Activities Storm Water General Permit (2009-0009-DWQ Permit). Prior to commencement of construction activities, the Permit Registration Documents (PRDs) must be submitted electronically in the Storm Water Multi-Application Report Tracking System (SMARTS) (http://smarts.waterboards.ca.gov/smarts/faces/SwSmartsLogin.jsp). PRDs consist of the Notice of Intent, Risk Assessment, Post-Construction Calculations, a Site Map, the Storm Water Pollution Prevention Plan (SWPPP), a signed certification statement by the Legally Responsible Person (LRP), and the first annual fee. See: http://www.swrcb.ca.gov/water_issues/programs/stormwater/construction.shtml for more information. A Waste Discharger Identification (WDID) will be emailed to the LRP after the PRDs have been submitted and are deemed complete. Construction activities cannot begin until a WDID is issued by the State Water Resources Control Board. Contractor shall bear the costs of any delays to the Project caused by a delay in obtaining its WDID. The SWPPP shall include: 1. The name, location, period of construction, and a brief description of the project; 2. Contact information for the owner and contractor; 3. The building permit number for the project; 4. The grading permit number for the project (where applicable); 5. A list of major construction materials, wastes, and activities at the project site; 6. A list of best management practices to be used to control pollutant discharges from major construction materials, wastes, and activities; 7. A site plan (construction plans may be used) indicating the selection of BMPs and their location where appropriate; 8. Non-storm water discharges, their locations, and the BMPs necessary to prevent the discharge; 9. A maintenance and self-inspection schedule of the BMPs to determine the effectiveness and necessary repairs of the BMPs; and 10. A certification statement that all required and selected BMPs will be effectively implemented. Within seven (7) days after the City awards the Contract, the Contractor shall submit seven (7) copies of the proposed SWPPP to the City. The City shall review the SWPPP within 14 days of receipt of the plan. If revisions are required, the Contractor shall revise and re-submit the document within seven (7) days of its receipt of the City’s comments. The City shall then have seven (7) days to consider the revisions made by the Contractor and approve the SWPPP. The Contractor shall maintain a minimum of two (2) readily accessible copies of the SWPPP at the Project site. The SWPPP shall be made available upon request of a representative of the Los Angeles Regional Water Quality Control Board (LARWQCB) or the U.S. Environmental Protection Page 27 of 117 Agency (U.S. EPA). Requests by environmental groups and the public shall be directed to the City. D. Best Management Practices The objective of the SWPPP is to identify potential sources of pollution that may reasonably affect the quality of storm water discharge associated with construction activities. The plan will describe and ensure the implementation of Best Management Practices (BMPs) which will be used to reduce pollutants in the storm water discharges from the construction site. A Best Management Practice is defined as any program, technology, process, operating method, measure, or device that controls, prevents, removes, or reduces pollution. The Contractor shall select appropriate BMPs from the California Stormwater BMP Handbook, Municipal, Industrial, New Development, and Construction Volumes (www.cabmphandbooks.com) in conjunction with all activities and construction operations. Copies of the California Stormwater BMP Handbooks may be obtained from: California Stormwater Quality Association P.O. Box 2313 Livermore, CA 94551 www.cabmphandbooks.com Cashier Los Angeles County DPW 900 South Fremont Avenue Alhambra, CA 91803 Tel. No. (626) 458-6959 E. Implementation The Contractor will be responsible throughout the duration of the Project for the installation, monitoring, inspection and maintenance of the BMPs included in the SWPPP and for removing and disposing of temporary BMPs. The Contractor may be required to implement additional BMPs as a result of changes in actual field conditions, contractor’s activities, or construction operations. The Contractor shall demonstrate the ability and preparedness to fully deploy these SWPPP control measures to protect soil-disturbed areas of the project site before the onset of precipitation and shall maintain a detailed plan for the mobilization of sufficient labor and equipment to fully deploy these control measures. Throughout the winter season, active soil-disturbed areas of the project site shall be fully protected at the end of each day with these control measures unless fair weather is predicted through the following day. The Contractor shall monitor daily weather forecasts. If precipitation is predicted prior to the end of the following workday, construction scheduling shall be modified, as required, and the Contractor shall deploy functioning control measures prior to the onset of the precipitation. The City may order the suspension of construction operations which are creating water pollution if the Contractor fails to conform to the requirements of this Paragraph 2.17. Unless otherwise directed by the City, the Contractor’s responsibility for SWPPP implementation shall continue throughout any temporary suspension of the Work. F. Sewage Spill Prevention. The Contractor’s attention is directed to the sewer bypass operation required during any sewer construction pursuant to the 2012 edition of the “Greenbook” Standard Specifications for Public Works Construction, Section 500.1.2.4 or as that section is subsequently amended. The Contractor shall exercise extraordinary care to prevent the cause of events that may lead to a sewage spill. In the event of a sewage spill, the Contractor shall make arrangements for an emergency response unit comprised of emergency response equipment and trained personnel to be immediately dispatched to the project site. Page 28 of 117 The Contractor shall be fully responsible for preventing and containing sewage spills as well as recovering and properly disposing of raw sewage. In addition, the Contractor is responsible for any fines, penalties and liabilities arising from negligently causing a sewage spill. Any utility that is damaged by the contractor shall be immediately repaired at the Contractor’s expense. The Contractor shall take all measures necessary to prevent further damage or service interruption and to contain and clean up the sewage spills. G. Sewage Spill Telephone Notification Should a sewage spill occur, the Contractor shall immediately report the incident to both of these two City Departments: Sewer Maintenance Services .................................City of Vernon Control Center (323) 826-1461 Fire Department Dispatch Center ……………………………………………………… (323) 262-2111 The Contractor is encouraged to obtain telephone numbers, pager numbers and cellular telephone numbers of City representatives such as Project Managers and Inspectors. However, if these City representatives are not available, then the Contractor shall immediately call: Mark Aumentado …………………………………………………………….………… (323) 583-8811 ext. 309 H. Sewage Spill Written Notification The Contractor shall prepare and submit a written report to the Director within three (3) Working Days from the occurrence of a spill to the City. This report shall describe all of the following: 1. The exact location on the Thomas Guide map. 2. The nature and volume. 3. The date, time and duration. 4. The cause. 5. The type of remedial and/or cleanup measures taken and date and time implemented. 6. The corrective and preventive action taken. 7. The water body impacted and results of necessary monitoring. I. Enforcement The City is subject to enforcement actions by the LARWQCB, U.S. EPA, environmental groups and private citizens. The Contractor shall indemnify, defend and hold City, its officers, agents and employees harmless from Contractor’s failure to comply and/or fulfill the requirements set forth in this Paragraph 2.17. Contractor shall be responsible for all costs and liabilities imposed by law as result of Contractor’s failure to comply and/or fulfill the requirements set forth in this Paragraph 2.17. The costs and liabilities include, but are not limited to fines, penalties and damages whether assessed against the City or the Contractor. Page 29 of 117 In addition to any remedy authorized by law, any money due to the Contractor under this contract shall be retained by the City until all costs and liabilities imposed by law against the City or Contractor have been satisfied. J. Maintenance The Contractor shall ensure the proper implementation and functioning of BMP control measures and shall regularly inspect and maintain the construction site for the BMPs identified in the SWPPP. The Contractor shall identify corrective actions and time frames in order to properly address any damaged measure, or reinitiate any BMPs that have been discontinued. If the City identifies a deficiency in the deployment or functioning of identified control measures, the deficiency shall be corrected by the Contractor immediately or by a later date and time if agreed to by Director and if requested in writing, but not later than the onset of the subsequent precipitation events. The correction of deficiencies shall be at no additional cost to the City. K. Payment All costs involved in the implementation of the SWPPP, including furnishing all labor, materials, tools, equipment and all incidentals; and for doing all the work involved in installing, constructing, maintaining, removing, and disposing of control measures, except those that were installed as a part of another structure, shall be included in the unit prices bid for the various related items of work and no additional compensation will be made therefor. 2.18 SOLID WASTE DISPOSAL AND DIVERSION The Contractor shall submit to the Director the following summary of solid waste generated by the Work, disposed in Class III landfills, or diverted from disposal through recycling. Report disposal in inert fill separately. This form must be accompanied by legible copies of weight tickets, receipts, or invoices that specifically identify the project generating the material. Said documents must be from recyclers and/or disposal site operators that are acceptable to the Director. Further, the documents must be submitted to the Director with each application for progress payment. Failure to submit the form and its supporting documentation will render the application for progress payment incomplete and delay progress payments. Page 30 of 117 SUMMARY OF SOLID WASTE DISPOSAL AND DIVERSION Project Title: ______________________________ Specification No. ___________ Type of Material (a) Disposed in Class III Landfills (b) Diverted from Class III Landfills by (c) [Leave This Column Blank] (d) Disposed in Inert Fills Tons/CY Tons/CY Tons/CY Tons/CY Asphalt Concrete Metal Other Segregated Materials (Describe): Miscellaneous Construction Waste Total Form to be submitted to the City SIGNATURE: TITLE: DATE: 2.19 RECYCLED, REUSABLE AND RECYCLABLE PRODUCTS The Contractor is encouraged to propose recycled, reusable and recyclable products for use by the City. Those items should be clearly identified. The City may require further information or documentation to ascertain the suitability/appropriateness of a proposed product. [END OF ARTICLE] Page 31 of 117 ARTICLE 3 - TIME OF COMMENCEMENT AND COMPLETION 3.01 COMMENCEMENT, PROSECUTION, AND COMPLETION OF WORK A. Notice to Proceed The Contractor is not authorized to perform any Work the Contract Documents until he/she has received from the City an official notification to commence Work. The date on which the notification is received by the Contractor is herein referred to as the Notice to Proceed. The Contractor shall commence Work on the Date of Commencement established in the Notice to Proceed is issued. The Notice to Proceed shall be issued after the Contract is properly executed, bonds are furnished and approved, and insurance has been submitted and approved. B. Prosecution of the Work Work shall be continued at all times with such force and equipment as will be sufficient to complete it within the specified time. The Contractor expressly proposes that he/she has taken into consideration and made allowances for all ordinary delays and hindrances to the Work to be performed and that he/she will complete the Work within the specified time. C. Required Contract Completion Time is of the essence in the completion of this Contract. The Work shall be completed in its entirety and made ready for service within three hundred twenty (320) calendar days following the Date of Commencement established in the Notice to Proceed (“Contract Time”). By executing the Contract, Contractor confirms that the Contract Time is a reasonable period for performing the Work. 3.02 CITY'S DISCRETION TO EXTEND CONTRACT TIME In the event the Work required hereunder is not satisfactorily completed in all parts and in compliance with the Contract Documents, City shall have the right, in its sole discretion, to increase the number of Working Days or not, as may seem best to serve the interest of City. A change order extending the Contract Time only will be issued by the City should the City decide to increase the number of Working Days. 3.03 SUBSTANTIAL COMPLETION A. Contractor Request for Inspection and Punch List When the Contractor considers that it has achieved Substantial Completion of the Work, or designated portion thereof, Contractor shall prepare and submit to the Director a request for inspection and a comprehensive punch list of items to be completed or corrected prior to Final Payment. Failure to include an item on such punch list does not alter the responsibility of the Contractor to complete all Work in accordance with the Contract Documents. B. City Inspection Upon receipt of the Contractor's punch list, the Director will make an inspection to determine whether the Work or designated portion thereof is Substantially Complete. If the inspection discloses any item, whether or not included on the Contractor's punch list, which is not sufficiently complete in accordance with the Contract Documents so that the City can occupy or utilize the Work or designated portion thereof for its intended use, the Contractor shall, before City's issuance of the Certificate of Substantial Completion, complete or correct such item upon notification by City. Page 32 of 117 The Contractor shall then submit a request for another inspection by City to determine Substantial Completion. C. Certificate of Substantial Completion When the Work or designated portion thereof is substantially complete, the Director will prepare a Certificate of Substantial Completion which shall establish the date of Substantial Completion, shall establish responsibilities of the City and Contractor for security, maintenance, utilities, damage to the Work, and insurance, and shall fix the time within which the Contractor shall finish all items on the Contractor’s punch list accompanying the Certificate. Warranties required by the Contract Documents shall commence on the date of Substantial Completion of the Work. Contractor shall deliver to City all warranty and guarantee documents and policies. 3.04 DELAYS AND EXTENSIONS OF TIME FOR CONTRACTOR A. The Contractor shall take reasonable precautions to foresee and prevent delays to the Work. In the event of any delay to the Work, the Contractor shall revise his/her sequence of operations, to the extent possible under the terms of the Contract, to offset the delay. B. If any delay to the Work is caused by circumstances within the Contractor's control, it is not excusable and not compensable, and the Contractor will not be entitled to any extension of time or to any other compensation for damages resulting directly or indirectly therefrom. C. If any delay having a direct effect on the Work is caused by circumstances beyond the control of the Contractor except for causes of delay specified in Paragraph 3.04-D., such delay may be excusable and may entitle the Contractor to an equivalent extension of time, but not to any other compensation. Excusable but not compensable causes include but are not limited to labor disputes, weather conditions unfavorable for prosecution of the Work, and force majeure. D. If any delay having a direct effect on the Work is caused by failure of the City to provide information as specified, or necessary instructions for carrying on the Work, or to provide the necessary right of way or site for installation, or failure of a utility to remove or relocate an existing facility such delay may be compensable and may entitle the Contractor to an equivalent extension of time, and to compensation for damages resulting directly from any of the causes of delay specified in this paragraph. E. The Contractor shall notify the Director in writing of any delay having a direct effect on the Work and the causes thereof within 15 days from the beginning of such delay. F. Any claim for an extension of time or for compensation for damages resulting from delay shall be made in writing to the Director not more than 30 days after the ending of such delay. The Contractor shall provide a written report evaluating the impact of the delay which shall include, at a minimum, all of the following: 1. a narrative description of the delay and its impact on the critical path to Substantial Completion of the Work or a portion of the Work designated by City; 2. a detailed breakdown of the Allowable Costs, if any, sought by Contractor due to the delay; 3. the number of days of extension sought by Contractor as an adjustment to the Contract time; 4. a statement that Contractor has complied with the requirements of the General Conditions for written notice of delays, along with the dates and copies of such notices; 5. the measures taken by Contractor and Subcontractors to prevent or minimize the delay; and Page 33 of 117 6. the Contactor’s recommendations for reordering or re-sequencing the Work to avoid or minimize further delay. No extension of time or compensation for damages resulting from delay will be granted unless the delay affects the timely completion of the overall Work under the Contract or the timely completion of a portion of the Work for which a time of completion is specified. G. The Director will investigate the facts and ascertain the extent of the delay, and his/her findings thereon shall be final and conclusive. H. Failure of the Contractor to give written notice of a delay, or to submit or document a claim for an extension of time or for damages resulting from delay in the manner and within the times stated above shall constitute a waiver of all claims thereto. I. When a Contractor experiences two concurrent delays, one compensable and the other excusable, no compensation other than an extension of time will be allowed. J. An extension of time must be approved by the Director to be effective, but an extension of time whether with or without consent of the sureties, shall not release the sureties from their obligations, which shall remain in full force until the discharge of the Contract. 3.05 CLIMATIC CONDITIONS A. The Director may suspend the Work whenever weather conditions or conditions resulting from inclement weather are unfavorable for the prosecution of the Work. The delay caused by such suspension may entitle the Contractor to an extension of time but not to any other compensation. B. If the Contractor believes that Work should be suspended under this Paragraph 3.05, he/she may request such suspension. The delay caused by such suspension may entitle the Contractor to an extension of time but not to any other compensation. C. No extension of time will be granted for suspension of Work unless the suspension affects the timely completion of all Work under the Contract or the timely completion of a portion of the Work for which a time of completion is specified. Determination that the suspension for inclement weather conditions or conditions resulting from inclement weather affects timely completion and entitles the Contractor to an extension of time shall be made and agreed to in writing by the Director and the Contractor on each day that Work is suspended. In the event of failure to agree, the Contractor may protest under the provisions of Paragraph 7.07. D. If Work is suspended and an extension of time is granted under this Paragraph 3.05 the Contractor will be entitled to a one day extension of time for each day that he/she is unable to Work at least one-half of his/her current normal Work day; and if the Work is suspended at the regular starting time on any Work day and the Contractor's Workforce is dismissed as a result thereof, then he/she will be entitled to a one day extension of time whether or not conditions change thereafter and the major portion of the day is suitable for Work. 3.06 COMPLETION AND ACCEPTANCE A. Upon request by the Contractor, the Director shall conduct a final inspection of the Work. If, in the Director’s opinion, Final Completion has been achieved, the Director will accept the Work by issuing a “Notice of Completion” of the Work to the Contractor. Upon the issuance of the Notice of Completion the Contractor will be relieved from responsibility to protect the Work. B. Within 15 calendar days after issuing the Notice of Completion, the Director will record the Notice of Page 34 of 117 Completion with the County Recorder. 3.07 LIQUIDATED DAMAGES A. Contractor and City agree to liquidate damages in the amount of five hundred dollars ($500.00) per day, with respect to Contractor’s failure to achieve Substantial Completion of the Work within the Contract Time. The Parties intend for the liquidated damages set forth herein to apply to this Contract as set forth in Government Code Section 53069.85. The Contractor acknowledges and agrees that the liquidated damages are intended to compensate City solely for the Contractor’s failure to meet the deadline for Substantial Completion and shall not excuse Contractor from liability from any other breach, including any failure of the Work to conform to the requirements of the Contract Documents. B. In the event that Contractor fails to achieve Substantial Completion of the Work within the Contract Time, Contractor agrees to pay City the amount specified in the Contract form for each calendar day that Substantial Completion is delayed. C. Contractor and City acknowledge and agree that the foregoing liquidated damages have been set based on an evaluation of damages that the City will incur in the event of late completion of the Work. Contractor and City acknowledge and agree that the amount of such damages are impossible to ascertain as of the effective date hereof and have agreed to such liquidated damages to fix City’s damages and to avoid later disputes. It is understood and agreed by Contractor that liquidated damages payable pursuant to this Agreement are not a penalty and that such amount are not manifestly unreasonable under the circumstances existing as of the effective date of this Agreement. D. It is further mutually agreed that City shall have the right to deduct liquidated damages against progress payments or retainage and that the City will issue a Construction Change Directive and reduce the Contract Sum accordingly. In the event the remaining unpaid Contract Sum is insufficient to cover the full amount of liquidated damages. Contractor shall pay the difference to City. [END OF ARTICLE] Page 35 of 117 ARTICLE 4 - CONSTRUCTION SCHEDULES 4.01 BASELINE PROJECT SCHEDULE The Contractor shall submit his/her work Baseline Project Schedule, in electronic as well as hard-copy format, to the Director at the pre-construction meeting showing in detail how the Contractor plans to execute and coordinate the Work. The construction schedule shall show the sequence of work, critical path and estimated time for completion of each segment of work. This schedule must be reviewed and accepted by the Director before the Contractor will be permitted to begin work. In addition, the Contractorshall submit a detailed schedule forecasting two (2) weeks of work describing each day’s work. This schedule shall be updated and submitted to the City every other Monday during the construction period. The Contractor shall give 48 hours notice to the City Engineer prior to the start of the work. A. Format 1. At a minimum, the Baseline Project Schedule activities shall be coded on a work discipline basis and by geographic area or location on the Project. The Baseline Project Schedule shall include a detailed description of each activity code. The Baseline Project Schedule shall be based on and incorporate contract milestone and completion dates specified in the Contract Documents. It shall depict events, jobs, and their interrelationships and shall recognize the progress that must be made on one task before subsequent tasks can begin. The schedule shall be comprehensive and shall include all logical interdependencies and interactions required to perform the Work of the Project. 2. Overall time of completion and time of completion for each milestone shown on the Schedule shall adhere to the specified Contract Time, unless an earlier (advanced) time of completion is requested by Contractor, agreed to by the City and formalized by Change Order. 3. Contractor shall use the latest version of Microsoft Project or equivalent software agreed to by the parties. 4. The City will review the submitted Baseline Project Schedule for conformance with these scheduling requirements. Within fourteen (14) calendar days after receipt, the City will accept the proposed Baseline Project Schedule or will return it with comments. If the proposed Baseline Project Schedule is accepted by the City, it shall be deemed part of the Contract Documents. If the Baseline Project Schedule is not accepted by City, Contractor shall revise the Baseline Project Schedule, in accordance with the recommendations of the City, and re-submit same for acceptance, no later than seven (7) calendar days after receipt of said recommendation. 5. Acceptance of Baseline Project Schedule by City, failure to include an element of work, or inaccuracy in Baseline Project Schedule shall not relieve Contractor from the responsibility for accomplishing the Work in accordance with the Contract Documents. B. Float 1. Critical Work activities are defined as Work activities which, if delayed or extended, will delay the scheduled completion of the milestones and/or time of completion. All other Work activities are defined as non-critical Work activities and are considered to have float. Float is defined as the time that a non-critical Work activity can be delayed or extended without delaying the scheduled completion of the milestones and/or time of completion. Float is considered a Project resource available to either party or both parties as needed. Once identified, Contractor shall monitor, account for, and maintain float in accordance with Critical Path Methodology. Page 36 of 117 2. Delays of any non-critical Work shall not be the basis for an extension of Contract Time until the delays consume all float associated with that non-critical Work activity and cause the Work activity to become critical. 3. It is acknowledged that City-caused time savings (i.e., critical path submittal reviews returned in less time than allowed by the Contract Documents, approval of substitution requests which result in a savings of time for Contractor, etc.) create shared float. Accordingly, City-caused delays may be offset by City-caused time savings. C. Weather (This section applies only to projects of one (1) year duration or longer) The completion time contemplated by this Contract anticipates zero lost days (Work Days) due to normal weather conditions annually and prorated for any duration less than twelve months. Only unusual or extreme weather conditions, as determined by the National Oceanic and Atmospheric Administration, for the time of year will be considered as justification for an extension of time to complete the Project, and only after the zero weather days have been utilized. Annual weather days are not cumulative, and unused days shall become “float” for the benefit of the project, and the schedule adjusted accordingly. The use of weather days by the Contractor shall be subject to all the conditions of claim for an extension of time. The Contractor shall notify the City in writing within ten (10) days of the commencement of each rain event. D. Early Completion While the Contractor may schedule completion of the Project earlier than the date established by the Contract Documents, no additional compensation shall become due the Contractor for the use of float time between the Contractor’s projected early completion date and the date for Substantial Completion established by the Contract Documents, unless an earlier (advanced) time of completion is requested by Contractor, agreed to by the City, and formalized by Change Order. 4.02 SCHEDULE UPDATES A. With each Application for Payment submitted by Contractor (other than the final Application for Payment), the Contractor shall submit to the City an updated Project Schedule revised to indicate the Work completed, status of Work in progress, all progress slippages, corrective actions taken, or slippage carry-over, for all anticipated delays or difficulties, and all other information required to accurately present the actual status of the progress of the Work as of the date of the Application for Payment. If the Contractor does not submit an updated Project Schedule with an Application for Payment, City may withhold payment, in whole or in part, until the updated Project Schedule is submitted. In the event that an update to the Project Schedule indicates a delay to the Contract Time the Contractor shall propose an affirmative plan to correct each such delay, including overtime and/or additional labor, if necessary. In no event shall any Project Schedule update constitute an adjustment in the Contract Time, any deadline, or the Contract Sum unless any such adjustment is agreed to by the City and authorized pursuant to Change Order or Work Directive. B. At no time shall historical data contained within the updated Project Schedule (i.e. completed activities) be removed and/or altered in any way. This historical data is to be preserved within each of the updated Project Schedules and submitted with the final schedule update to reflect the actual start and finish dates for each activity within the Schedule. C. Any work stoppages within individual work activities that exceed seven (7) calendar days in duration shall be clearly indicated within the updated Project Schedule. In cases where unplanned activity work Page 37 of 117 stoppages exceed seven (7) calendar days activities shall be added to the Project Schedule to clearly indicate the work stoppage period and identify forecasted resumption and completion of the activity where work has stopped. Contractor shall clearly note all schedule revisions when Project Schedule updates are submitted, as required in this Paragraph 4.02 above. 4.03 NONCOMPENSABLE EXTRAORDINARY MEASURES A. Should the City determine, in its sole judgment, that the performance of the Work has not progressed to the level of completion required by the Contract Documents, City shall have the right to order the Contractor to take corrective measures to expedite the progress of construction, at no additional cost to the City, including, without limitation, the following: 1. Working additional shifts of overtime. 2. Supplying additional manpower, equipment, and/or facilities. 3. Reschedule activities to maximize practical concurrence of accomplishment of activities. 4. Submitting a Recovery Schedule discussed above, for resequencing performance of the Work or other similar measures. 5. Any other actions that may be necessary to mitigate delays. B. Such Extraordinary Measures shall continue until the progress of the Work is no longer behind schedule and/or reaches the stage of completion required by the Contract Documents. Contractor shall not be entitled to an adjustment in the Contract Sum in connection with the performance of any such Extraordinary Measures required by the City under this Paragraph. The City may exercise the rights furnished the City pursuant to this Paragraph as frequently as the City deems necessary to ensure that the Contractor’s performance of the Work will comply with the Contract Time or interim completion dates set forth in the Contract Documents. If Contractor or its Subcontractors fail to implement or commence Extraordinary Measures within ten (10) calendar days of City’s written demand, City may, without prejudice to other remedies, take corrective action at the expense of the Contractor which shall reduce the Contract Sum accordingly. 4.04 CONDITION OF PAYMENT Compliance by Contractor with the requirements of the Contract Documents pertaining to preparation, submission, revising and updating ofthe Schedule is a condition precedent to City’s obligation to make payment to Contractor of any or all sums that might otherwise be due to Contractor in the absence of such noncompliance. Payment by City under circumstances in which City, for any reason,fails or elects not to assert its right to withhold payment for noncompliance with this Paragraph shall not be construed as a waiver of the right to withhold future payments on account of such noncompliance or any other noncompliance. [END OF ARTICLE] Page 38 of 117 ARTICLE 5 - SUSPENSION OR TERMINATION OF CONTRACT 5.01 TERMINATION BY THE CONTRACTOR A. Contractor shall have the right to terminate its performance of the Contract only upon the occurrence of one of the following: 1. The Work is stopped for a period of ninety (90) consecutive days through no act or fault of the Contractor, any Subcontractor, Sub-subcontractor, their agents or employees, or any other persons or entities performing portions of the Work under direct or indirect contract with the Contractor, due to: a. the issuance of an order of a court or other public authority having jurisdiction; or b. an act of government, such as a declaration of national emergency making material unavailable; and Contractor has given City written notice within ten (10) days of the occurrence of such ground for termination, then the Contractor may, upon thirty (30) additional calendar days written notice to City, unless the reason has theretofore been cured, terminate its performance of the Work. 2. The Work is stopped for a period of 120 consecutive days through no act or fault of Contractor, any Subcontractor, Sub-subcontractor, their agents or employees, or any other persons or entities performing portions of the Work under direct or indirect contract with the Contractor, because the City has persistently failed to perform any material obligation under the Contract Documents and fails to cure such default within ninety (90) days after the receipt of notice from Contractor stating the nature of such default. B. If Contractor terminates its performance of the Contract in accordance with this Paragraph 5.01, the City shall pay Contractor for the Work executed through the date of termination as set forth in Paragraph 5.04-C below. 5.02 TERMINATION BY THE CITY FOR CAUSE A. Grounds The City shall have the right to terminate the Contractor’s performance of the Contract, in whole or in part, without liability to City if: 1. Contractor fails promptly to begin the Work under the Contract Documents; or 2. Contractor refuses or fails to supply enough properly skilled workers or proper materials; or 3. Contractor fails to perform the Work in accordance with the Contract Documents, including conforming to applicable standards set forth therein in constructing the Project, or refuses to remove and replace rejected materials or unacceptable Work; or 4. Contractor discontinues the prosecution of the Work (exclusive of work stoppage: (a) due to termination by City; or (b) due to and during the continuance of a Force Majeure event or suspension by City); or Page 39 of 117 5. Contractor fails to resume performance of Work which has been suspended or stopped, within a reasonable time after receipt of notice from City to do so or (if applicable) after cessation of the event preventing performance; or 6. Any representation or warranty made by Contractor in the Contract Documents or any certificate, schedule, instrument, or other document delivered by Contractor pursuant to the Contract Documents shall have been false or materially misleading when made; or 7. Contractor fails to make payment to Subcontractors or Material Suppliers for materials or labor in accordance with the respective Contract Documents and applicable law; or 8. Contractor disregards laws, ordinances, or rules, regulations, or orders of a public authority having jurisdiction; or 9. Contractor is guilty of breach of a provision of the Contract Documents; or 10. Contractor becomes insolvent, is adjudicated bankrupt, or makes a general assignment for the benefit of creditors and fails to provide City with adequate assurances of Contractor’s ability to satisfy its contractual obligations. A receiver, trustee, or other judicial officer shall not have any right, title, or interest in or to the Contract. Upon that person’s appointment, City has, at its option and sole discretion, the right to immediately cancel the Contract and declare it null and void. B. City’s Rights. When any of the reasons specified in Paragraph 5.02-A exist, the City may, in addition to and without prejudice to any other rights or remedies of the City, and after giving the Contractor five (5) calendar days written notice, terminate Contractor’s performance of the Work, in whole or in part, and may: 1. Take possession of the site and all materials, equipment, tools, construction equipment, and machinery thereon owned by the Contractor; 2. Withhold from Contractor amounts unpaid hereunder and to offset such amounts against damages or losses incurred by City; 3. Accept assignment of subcontracts from Contractor, at the sole discretion of City, and 4. Finish the Work by whatever reasonable method the City may deem expedient. Upon request of the Contractor, the City shall furnish to the Contractor a detailed accounting of the costs incurred by the City in finishing the Work. C. Costs If City’s costs to complete and damages incurred due to Contractor’s default exceed the unpaid Contract balance, the Contractor shall pay the difference to the City. D. Wrongful Termination If it has been adjudicated or otherwise determined that City has wrongfully terminated the Contractor Page 40 of 117 for cause, then said termination shall be deemed converted to a termination for convenience as set forth in Paragraph 5.04 and Contractor’s remedy for wrongful termination in such event shall be limited to the recovery of the payments permitted for termination for convenience as set forth in Paragraph 5.04. 5.03 PARTIAL DELETION OR SUSPENSION OF WORK BY THE CITY A. Contractor agrees that the City may determine whether any or all of the Work described in the Contract Documents shall be deleted or performance suspended without electing to terminate the Contractor’s performance under the Contract and without any penalty being incurred by the City. B. Any such partial deletion or suspension of the Work shall in no way void or invalidate the Contract nor shall it provide Contractor with any basis for seeking payment from City for Work deleted or suspended except to the extent such Work has already been performed and is otherwise compensable under the Contract. C. The City shall have the right to later have any such suspended or deleted Work performed by Contractor or others without any penalty to the City. D. In the event of any partial or complete deletion or suspension of Work, the City shall furnish Contractor with prompt written notice thereof, and the City shall be entitled to take possession of and have as its property all Record Documents, Accounting Records, and other data prepared by Contractor or its Subcontractors. E. Suspension for Convenience. 1. The City may at any time and from time to time, without cause, order the Contractor, in writing, to suspend, delay, or interrupt the Work in whole or in part for such period of time as the City may determine. Such order shall be specifically identified as a “Work Suspension Directive” under this Section. 2. Upon receipt of a Work Suspension Directive, Contractor shall, at the City’s expense, comply with its terms and take all reasonable steps to minimize costs allocable to the Work covered by the Work Suspension Directive during the period of Work stoppage. 3. Within the period of suspension, or such extension to that period as is agreed upon by Contractor and the City, the City shall either cancel the Work Suspension Directive or delete the Work covered by such Work Suspension Directive by issuing a Change Order or Construction Change Directive. 4. If a Work Suspension Directive is cancelled or expires, Contractor shall continue the Work. A Change Order or Construction Change Directive will be issued to cover any adjustments of the Contract Sum and Contract Time necessarily caused by such suspension. No adjustment shall be made to the extent: (a) That performance is, was, or would have been so suspended, delayed, or interrupted by another cause for which the Contractor is responsible; or (b) That an equitable adjustment is made or denied under another provision of the Contract. F. Suspensions for Cause City has the authority by written order to suspend the Work, in whole or in part, without liability to City Page 41 of 117 for Contractor’s failure to: 1. Correct conditions unsafe for the Project personnel or general public, or 2. Carry out the Contract; or 3. Carry out orders of City. G. Responsibilities of Contractor During Suspension Periods During periods that Work is suspended, Contractor shall continue to be responsible for the Work and shall prevent damage or injury to the Project, provide for drainage, and shall erect necessary temporary structures, signs or other facilities required to maintain the Project and continue to perform according to the Contract Documents. 5.04 TERMINATION BY THE CITY FOR CONVENIENCE A. Grounds Without limiting any rights which City may have by reason of any default by Contractor hereunder, City may terminate Contractor’s performance of the Contract, in whole or in part, at any time, for convenience upon fifteen (15) calendar days written notice to Contractor. B. Contractor Actions Upon receipt of such notice, Contractor shall perform the duties required by Paragraph 5.05 below. At the election of and as directed by the City, any or all of the subcontracts and purchase orders entered in to by Contractor prior to the effective date of termination shall be terminated or shall be assigned to City. C. Compensation 1. If the Parties are unable to agree on the amount of a termination settlement, the City shall pay the Contractor the following amounts: a. For Work performed before the effective date of termination, the total (without duplication of any items) of: i. The cost of the Work; and ii. A sum, as overhead and profit on the cost of the Work, determined by the City to be fair and reasonable. In no event shall Contractor be entitled to recover overhead or profit on Work not performed. b. The reasonable costs of settlement of the Work terminated, including: i. Accounting, clerical, and other expenses reasonably necessary for the preparation of termination settlement proposals and supporting data, if any; and ii. Storage, transportation, and other costs reasonably necessary for the preservation, protection, or disposition of inventory. Page 42 of 117 2. Such payment shall be Contractor’s exclusive remedy for termination for convenience and will be due and payable on the same conditions as set forth for final payment to the extent applicable. Upon receipt of such payment, the Contractor and City shall have no further obligations to each other except for Contractor’s obligations with respect to warranties, representations, indemnity, maintenance of insurance, and other obligations that survive termination or Final Completion as provided for herein. 3. It is understood and agreed that no fee, anticipated profit, compensation for lost opportunity costs, or other compensation or payment of any kind or character shall be due or payable for unperformed Work regardless of the basis of termination and the inclusion of this provision within this subparagraph shall in no way limit its application to termination under this Paragraph. 4. Contractor agrees that each of its subcontracts will reserve for the Contractor the same right of termination for convenience provided by this Paragraph 5.04. D. No Consequential Damages Under no circumstances shall Contractor be entitled to anticipatory or unearned profits or consequential or other damages as a result of a termination or partial termination under this Article 5. The payment to Contractor determined in accordance with this Article constitutes Contractor’s exclusive remedy for a termination hereunder. 5.05 CONTRACTOR’S DUTIES UPON TERMINATION FOR CAUSE OR CONVENIENCE If the City terminates Contractor’s performance of Work under the Contract, for cause or convenience or if Contractor terminates a Subcontractor with the City’s approval, Contractor shall: (1) cease performance of the Work to the extent specified in the notice; (2) take actions necessary or that the City may direct, for the protection and preservation of the Work; (3) settle outstanding liabilities, as directed by City; (4) transfer title and deliver to City Work in progress, specialized equipment necessary to perform the Work; (5) submit all Record Documents, Accounting Records and other data prepared pursuant to the Contract by Contractor and/or its Subcontractors, as applicable, to the City with fifteen (15) calendar days after the City’s notice of termination in an organized, usable form, in both hard copy and electronic/digital form, with all items properly labeled to the degree of detail specified by the City; and, (6) except for Work directed by City to be performed prior to the effective date of termination stated in the notice, incur no further costs or expenses and enter into no further subcontracts and purchase orders. No compensation shall be due Contractor, if any, until Contractor complies with the requirements of this Paragraph. [END OF ARTICLE] Page 43 of 117 ARTICLE 6 – CHANGES 6.01 CITY'S RIGHT TO ORDER CHANGES The City, without invalidating the Contract, may authorize changes in the Work consisting of additions, deletions, or other revisions, with the Contract Sum and Contract Time being adjusted accordingly, if necessary. All such changes in the Work shall be authorized by Change Order or Construction Change Directive and Contractor shall perform such changes in the Work according to the applicable requirements of the Contract Documents. 6.02 APPLICABLE PROVISIONS Changes in the Work shall be performed under applicable provisions of the Contract Documents. The Contractor shall proceed promptly and diligently with the change, unless otherwise provided in the Change Order or Construction Change Directive. It is of the essence to this Contract that all scope changes in the Work that form the basis of an adjustment of the Contract Sum or Contract Time must be authorized in advance in writing through either a Change Order or Construction Change Directive. A change in the Contract Sum or the Contract Time shall be accomplished only by Change Order or Construction Change Directive. Accordingly, no verbal directions, course of conduct or dealings between the Parties, express or implied acceptance of alterations or additions to the Work, or claim that the Contract has been abandoned or the City has been unjustly enriched by any alteration or addition to the Work shall be the basis of any claim for an increase in any amounts due under the Contract Documents or a change in any time period provided in the Contract Documents. 6.03 NOTICE OF SCOPE CHANGE Contractor shall submit written notice of any change in scope to the Director if, in the Contractor’s opinion, any instruction, request, Drawings, Specifications, action, condition, omission, default, or other situation occurs that the Contractor believes constitutes a scope change or other matter resulting in Extra Work, for which Contractor believes it is entitled to an adjustment of the Contract Sum or Contract Time. Such notice shall be provided prior to performance of the Work affected by such occurrence and within seven (7) calendar days after the discovery date of the circumstances of such scope change or other matters. The written notice shall state the date, circumstances, extent of adjustment to the Contact Sum or the Contract Time, if any, requested. The mere presentation of such notice shall not establish the existence of any right by Contractor to adjustment of the Contract Sum or Contract Time. Failure to provide such timely written notice described herein shall constitute a waiver by Contractor of the right to any adjustment to the Contract Sum or Contract Time on account thereof. 6.04 CHANGE ORDERS A. Computation Methods used in determining adjustments to the Contract Sum by Change Order may include those listed in Paragraph 6.06 below. B. Accord and Satisfaction Agreement on any Change Order shall be a full compromise and settlement of all adjustments to Contract Time and Contract Sum, and compensation for any and all delay, extended or additional field and home office overhead, disruption, acceleration, inefficiencies, lost labor or equipment productivity, differing Site conditions, construction interferences and other extraordinary or Page 44 of 117 consequential damages (hereinafter called "Impacts"), including any ripple or cumulative effects of said Impacts on the overall Work under the Contract arising directly or indirectly from the performance of Work described in the Change Order. By execution of any Change Order, Contractor agrees that the Change Order constitutes a complete accord and satisfaction with respect to all claims for schedule extension, Impacts, or any costs of whatever nature, character or kind arising out of or incidental to the Change Order. No action, conduct, omission, product failure or course of dealing by the City shall act to waive, modify, change, or alter the requirement that (i) Change Order's must be in writing, signed by the City and Contractor and; (ii) that such written Change Orders are the exclusive method for effectuating any change to the Contract Sum and/or Contract Time. 6.05 CONSTRUCTION CHANGE DIRECTIVE (FIELD DIRECTIVE) A. A Construction Change Directive shall be used in the absence of total agreement on the terms of a Change Order. The City may by Construction Change Directive, without invalidating the Contract, order changes in the Work within the general scope of the Contract consisting of additions, deletion, or other revisions, the Contract Sum and Contract Time being adjusted accordingly. B. If the Construction Change Directive provides for an adjustment to the Contract Sum, the adjustment shall be calculated in accordance with Paragraph 6.06 herein (Pricing Changes in the Work). C. Upon receipt of the Construction Change Directive, the Contractor shall promptly proceed with the change in the Work involved and advise the City of the Contractor’s agreement or disagreement with the method, if any, provided in the Construction Change Directive, for determining the proposed adjustment in the Contract Sum or Contract Time. D. If Contractor believes a Construction Change Directive constitutes a basis for adjustment to the Contract Sum or Contract Time, then Contractor shall give a Notice of Scope Change provided in Paragraph 6.03, followed by a submission of a Change Order Request as required by Paragraph 6.08. Contractor shall, if requested by City in such Construction Change Directive or in a subsequent Construction Change Directive, proceed with the performance of the Work as described in the Construction Change Directive. Failure of Contractor to proceed with the performance of Work, as described in the Construction Change Directive shall give the City the right to carry out the Work, as set forth in Paragraph 2.05. E. A Construction Change Directive signed by the Contractor indicates the Contractor’s agreement therewith, including adjustment in Contract Sum and Contract Time or the method for determining them. Such agreement shall be effective immediately and shall be recorded as a Change Order. F. If the Contractor does not respond promptly or disagrees with the method for adjustment in the Contract Sum, the method and the adjustment shall be determined by the City on the basis of reasonable expenditures and savings of those performing the Work attributable to the change, including, in the case of an increase in the Contract Sum, Allowable Mark-Ups in accordance with Paragraph 6.06(E) herein. 6.06 PRICING CHANGES IN THE WORK A. Alternative Methods of Pricing The amount of any adjustment by Change Order or Construction Change Directive increasing or decreasing the Contract Sum shall be determined by the Director using one or a combination of the following methods: Page 45 of 117 1. Lump Sum. By mutual acceptance of a lump sum proposal from Contractor properly itemized and supported by sufficient substantiating data to permit evaluation. Such proposal shall be based solely on Allowable Costs, as defined in Subparagraph 6.06-C, and Allowable Mark-Ups, as defined in Subparagraph 6.06-E, and shall not include any costs or expense that is not permitted by the terms of any provision of the Contract Documents. 2. Unit Prices. By unit prices contained in Contractor’s original Bid and incorporated in the Contract Documents or fixed by subsequent agreement between City and Contractor. Unless otherwise stated in the Bidding Documents, unit prices stated in the Contract Documents or agreed upon by the County and Contractor shall be deemed to include and encompass all Allowable Markups. 3. Time and Materials. By calculating the actual Allowable Costs directly incurred, plus a sum for Allowable Mark-Ups on such Allowable Costs. 4. Deletion of Work. By Unit Prices contained in Contractor’s original Bid and incorporated in the Contract Documents, or by using the Schedule of Values to determine the value of the decrease of the Contract Sum, less the value of any Work performed, plus a reasonable percentage of the decrease for the Contractor’s saved overhead unless the Schedule of Values allocates general conditions costs to individual line items, in which case no percentage of the decrease shall be added. When a change consists of both addition and deletion of Work, the added costs and deleted costs shall be calculated separately, and then added together, resulting in the net cost for the change. The Allowable Mark-Up shall be applied to this net cost. B. Contractor Maintenance of Daily Records for Changes 1. In the event that Contractor is directed to perform any Extra Work, or should Contractor encounter conditions which the Contractor believes would obligate the City to adjust the Contract Sum and/or the Contract Time, Contractor shall maintain detailed records of the cost of such changes on a daily basis summarized in a daily report supplemented by back-up records. Such records shall include without limitation: a. Labor. At the close of each day on which such Extra Work is performed, Contractor shall submit an Extra Work labor report, on forms provided by Director, to Director that sets forth a list of the actual hours spent in performing the Extra Work, that clearly differentiates between the labor expended on the Extra Work and other Work, and the Allowable Costs for such Extra Work performed that day showing the names of workers, their classifications, hours worked and hourly rates. b. Materials, Equipment. A list of Allowable Costs of materials and equipment consumed in the performance of the Extra Work on the day on which such Extra Work is performed, together with copies of applicable delivery tickets and unit prices for all materials and for all equipment used the type of equipment, identification number, hours of operation (including loading and transportation) and hourly/daily rates involved for that day. c. Other Services or Expenditures. A list of other services and expenditures constituting Allowable Costs incurred in performance of the Extra Work on the day on which such Extra Work is performed, along with documentation verifying the amounts thereof in such detail as Director may require. Page 46 of 117 2. In the event thatmore than one change to the Work is performed by the Contractor in a calendar day, Contractor shall maintain separate records of labor, construction equipment, materials, and equipment for each such change. In the event that any Subcontractor of any tier shall provide or perform any portion of any change to the Work, Contractor shall require that each such Subcontractor maintain records in accordance with this Section. 3. Each daily record maintained hereunder shall be signed by Contractor; such signature shall be deemed Contractor’s representation and warranty that all information contained therein is true, accurate, complete, and relates only to the change referenced therein. All records maintained by Subcontractors of any tier, relating to the costs of a change in the Work shall be signed by such Subcontractor’s authorized project manager or superintendent. All such records shall be forwarded to the Director on the day the Work is performed (same day) for independent verification. The Director shall attempt to review and reconcile costs for changes on a daily basis. Records not available on the day on which the Extra Work is performed, such as, but not limited to, material invoices, shall be submitted as soon as they are available but not later than five (5) calendar days after the earlier of the day of delivery or incorporation of the particular item of Extra Work at the Site. 4. The Director may additionally require authentication of all time and material tickets and invoices by persons designated by the Director for such purpose. In the event that Contractor shall fail or refuse, for any reason, to maintain or make available for inspection, review, and/or reproduction such records, adjustments to the Contract Sum or Contract Time, if any, on account of any change to the Work may be deemed waived for that day. Contractor’s obligation to maintain back-up records hereunder is in addition to, and not in lieu of, any other Contractor obligation under the Contract Documents with respect to changes to the Work. 5. Waiver by Contractor. Failure to submit such records as are required by this Paragraph daily shall waive any rights for recovery of Allowable Costs incurred for Extra Work performed that day. The failure of the Contractor to secure any required authentication shall, if the City elects in its sole discretion to treat it as such, constitute a waiver by the Contractor of any right to adjustment of the Contract Sum for the Allowable Cost of all or that portion of the Extra Work covered by such non-authenticated ticket or invoice. C. Allowable Costs The term “Allowable Costs” shall mean in the case of Extra Work actual costs incurred by Contractor and/or any Subcontractor, regardless of tier, and necessarily involved in direct performance of the Extra Work, or in the case of deleted work the actual costs that would have been incurred in performing deleted work by Contractor and/or any Subcontractor, regardless of tier, and shall be limited to the following costs: 1. Labor. Straight-time wages or salaries, and overtime wages and salaries specifically authorized by City in writing, for employees employed at the site, or at fabrication sites off the site, in the direct performance of the Extra Work or that would have been incurred in the direct performance of the deleted work, based on the actual cost for wages prevailing locally for each craft or type of workers at the time the Extra Work is done or the deleted work is ordered eliminated. Labor costs for equipment operators and helpers shall be reported only when such costs are not included in the invoice for equipment rental. The use of labor classification which would increase the Allowable Cost for Extra Work will not be permitted unless Contractor establishes the necessity for such additional costs. Page 47 of 117 2. Benefits. Payroll taxes, insurance, health and welfare, pension, vacation, apprenticeship funds and benefits required by lawful collective bargaining agreements for employees on straight-time wages or salaries, and on overtime wages and salaries specifically authorized by City in writing, for employees employed at the site, or at fabrication sites off the site, in the direct performance of the Extra Work or that would have been incurred in the direct performance of the deleted work. 3. Materials, Consumables. Costs of materials and consumable items which are furnished and incorporated into the Work, as approved by City, or that would have been incorporated into the Work in the case of deleted work shall be at the lowest price available to Contractor but in no event shall such costs exceed competitive wholesale prices obtainable from other Subcontractors, suppliers, manufacturers and distributors in the general vicinity of the site. If City determines, in its discretion, that the cost of materials is excessive, or if Contractor fails to furnish satisfactory evidence of the cost from the actual supplier thereof, then in either case the cost of the materials shall be deemed to be the lowest wholesale price at which similar materials are available in the quantities required at the time they were needed. The City reserves the right to furnish such materials as it deems advisable, and Contractor shall have no claim for costs or profits on materials so furnished. Material invoices must be included with the extra work report to obtain payment. 4. Taxes. Sales taxes on the costs of materials and consumable items described in Paragraph 5.04-C.3 above. 5. Tool, Equipment Rental. Rental charges for necessary machinery and equipment, whether owned or hired, as authorized in writing by City, exclusive of hand tools, used directly in the performance of the Extra Work or that would have been used in the direct performance of the deleted work. Regardless of ownership, such rental charges shall not exceed the hourly rate derived from the most recently published “Rental Rate Blue Book for Construction Equipment” or the “Rental Rate Blue Book for Older Construction Equipment,” as published by K-111, San Jose, California, which is in effect at the time of commencement of the changed work. The Contractor shall attach a copy of the rate schedule to the daily reports required by Paragraph 6.06-B, above. The charges for any machinery and equipment shall cease when the use thereof is no longer necessary for the Extra Work or deleted work. No charge shall be allowed for use of equipment or tools which have a replacement value of $500 or less. The allowable rental rates shall include the cost of fuel, power oil, lubrication, supplies, small tools, necessary attachments, loading, transportation, repairs and maintenance of any kind, depreciation, storage, insurance, and all incidentals. Notwithstanding the provisions of Paragraph 6.06-E below, no mark-up shall be allowed for overhead, profit or bond premiums for use of equipment if the equipment is supplied by an equipment rental firm. If equipment is used intermittently and, when not in use, could be returned to its rental source at less expense to City than holding it at the Site, it shall be returned, unless Contractor elects to keep it at the Site at no expense to City. Costs incurred while equipment is inoperative due to breakdowns, regular maintenance, or for non-Working Days shall not be allowed. The rental time shall include the time required to move the equipment to the Work from the nearest available source for rental of such equipment and to return it to the source. If such equipment is not moved by its own power, then loading and transportation will be allowed. Neither moving time nor loading and transportation costs will be paid if the equipment is for use on the Project unrelated to the Extra Work. All equipment shall be acceptable to City, in good working condition, and suitable for the purpose for which it is to be used. Page 48 of 117 6. Royalties. Additional or saved costs of royalties due to the performance of the Extra Work or deleted work. 7. Insurance, Bonds. Additional or saved costs of insurance and bonds, provided, however, that for Extra Work such costs shall not exceed one percent (1%) of Items 1 through 6 above. D. Costs Not Allowed Allowable Costs shall not include any of the following: 1. Wages, salaries, fringe benefits and payroll taxes of Contractor’s and all Subcontractor’s non- craft labor (above a Foreman level); 2. Overhead (including home office overhead), administrative or general expenses of any kind including engineering, estimating, scheduling, drafting, detailing, etc., incurred in connection with Extra Work; 3. Vehicles not dedicated solely for the performance of the extra of deleted work; 4. Small tools (replacement value not exceeding $500); 5. Office expenses, including secretarial and administrative staff, materials and supplies; 6. On-site and off-site trailer and storage rental and expenses; 7. Site fencing; 8. Utilities, including gas, electric, sewer, water, telephone, telefax, copier equipment; 9. Computer and data processing personnel, equipment and software; 10. Federal, state of local business income and franchise taxes; 11. Losses of efficiency or productivity; and 12. Costs and expenses of any kind or item not specifically and expressly included in Paragraph 6.06-C. E.Allowable Mark-Up 1. If the Net Cost of Extra Work is less than or equal to $25,000, the Allowable Mark-Up shall be computed as follows: (a) For Extra Work performed directly by the Contractor’s forces, the added cost for all expenses of overhead, profit, bond and insurance (“Allowable Mark-Up”)shall not exceed fifteen percent (15%) of the net cost of the Extra Work. (b) For Extra Work performed by a Subcontractor, the added cost of combined expenses, Allowable Mark-Up for Contractor and all Subcontractor(s) shall not exceed twenty (20%) of the net cost of all Subcontractor(s)’s Extra Work. Page 49 of 117 2. If the net cost of Extra Work is greater than $25,000 and less than or equal to $100,000, the Allowable Mark-up shall be computed as follows: (a) For Extra Work performed directly by the Contractor’s forces the added cost for Allowable Mark-Up shall not exceed twelve (12%) of the net cost of the Extra Work. (b) For Extra Work performed by a Subcontractor, the added cost of combined expenses for Allowable Mark-Up for Contractor and all Subcontractor(s) shall not exceed seventeen (17%) of the net cost of all Subcontractor(s)’s Extra Work. 3. If the net cost of Extra Work is greater than $100,000, the Allowable Mark-up shall be computed as follows: (a) For Extra Work performed directly by the Contractor’s forces the added cost for Allowable Mark-Up shall not exceed ten percent (10%) of the net cost of the Extra Work. (b) For Extra Work performed by a Subcontractor, the added cost of combined expenses for Allowable Mark-Up for Contractor and all Subcontractor(s) shall not exceed fifteen (15%) of the net cost of all Subcontractor(s)’s Extra Work. F. Net Allowable Costs If anyone scope change involves both Extra Work and deleted work in the same portion of the Work and the additive allowable costs exceed the deductive allowable costs, the Allowable Markups on the Extra Work will be only the difference between the two amounts. 6.07 CITY ORIGINATED REQUEST FOR ITEMIZED CHANGE ORDER PROPOSAL REQUEST City may issue a Construction Change Directive or other written request to Contractor describing a proposed change to the Work and requesting the Contractor submit an itemized change order proposal in a format acceptable to City within ten (10) calendar days after City issues the request. The Contractor's change order proposal shall include an analysis of impacts to cost and time, if any, to perform additional work, change Work or delete Work, as applicable, including the effects and impacts, if any, on unchanged Work, estimates of costs (broken down by the cost categories listed in this Paragraph), and Contractor's proposed methods to minimize costs, delay, and disruption to the performance of the Work. If Contractor fails to submit a written change order proposal within such period of time, it shall be presumed that the change described in the City's original proposal request will not result in an increase to the Contract Sum or Contract Time and the change shall be performed by Contractor without additional compensation to Contractor. City's request for itemized change order proposal request does not authorize the Contractor to commence performance of the change. If City desires that the proposed change be performed, the Work shall be authorized according to the Change Order or Construction Change Directive procedures set forth herein. 6.08 CONTRACTOR ORIGINATED CHANGE ORDER REQUEST (COR) If the Contractor believes that instructions issued by the City after the effective date of the Contract will result in changes to the Contract Sum or Contract Time or if the Contractor otherwise becomes aware of the need for or desirability of a change in the Work, Contractor may submit a written Change Order Request ("COR") to the City in writing, in a format acceptable to City and in accordance with the notice provisions and other requirements of Article 7 below for Claims. The COR must specify the reasons for the proposed change, cost impacts and relevant circumstances and impacts on the Construction Schedule. The document shall be complete in its description of the Work, its material and labor quantities and detail, and must support and justify the costs and credits claimed by the Contractor. A Critical Path Method schedule Fragnet is required Page 50 of 117 to support and justify any additional time of performance requested by the Contractor. The City will not review any COR which is incomplete. The Contractor may request additional compensation and/or time through a COR but not for instances that occurred more than ten (10) calendar days prior to the notice date. Contractor's failure to initiate a COR within this ten-day period or to provide detailed back-up documentation to substantiate the COR within thirty (30) calendar days of the initial written notice shall be deemed a waiver of the right to adjustment of the Contract Sum or the Contract Time for the alleged change. Any COR that is approved by the City shall be incorporated in a Change Order or Construction Change Directive. If the COR is denied but the Contractor believes that it does have merit, the Contractor shall proceed with the disputed Work and may submit a Claim in accordance with the procedures set forth herein. 6.09 ISSUANCE OF WORK DIRECTIVE (UNILATERAL). In the event of a dispute as to whether or not Extra Work is required, City shall have the right to unilaterally issue a Work Directive; Contractor shall continue performance of disputed Work pending resolution and shall maintain and submit to City all accounting and cost data necessary to substantiate Contractor’s cost of such disputed Work. [END OF ARTICLE] Page 51 of 117 ARTICLE 7 - CONTRACT PAYMENTS AND CLAIMS 7.01 GENERAL A. Payment will be made at the price for each item listed on the bidding form or as Extra Work as provided in the General Conditions. B. Initial progress payment will not be made prior to approval by the Director of the Schedule of Values, the Construction Progress Schedule, and the Schedule of Submittals. C. No subsequent progress payment will be made prior to receipt by the Director of the monthly revision of the Construction Progress Schedule. 7.02 SCHEDULE OF VALUES FOR PAYMENTS A. Submission Upon City’s request, the three (3) lowest bidders shall complete and submit a Preliminary Schedule of Values, within seven (7) calendar days. In addition, Contractor shall complete and furnish within seven (7) calendar days after receiving the Notice of Award of the Construction Contract a Final Schedule of Values giving a complete breakdown of the Contract Sum for each component of the Work. B. Content The Schedule of Values shall be in sufficient detail as the Director may, in its discretion, deem necessary to evaluate progress at any point in the performance of the Work. Unless otherwise specified in the Contract Documents, the Schedule of Values shall include, without limitation, a breakdown of the general categories of Subcontractor work, direct overhead, profit and contingency, and a further breakdown of the general categories of Subcontractor work into separate trade line items of costs for Subcontractor services, labor and material, which is based on actual Subcontractor contract, subcontract, purchase order or vendor prices. If requested by Director, Contractor shall revise the Schedule of Values to allocate sums for Contractor overhead, profit and/or contingency among the individual line items for trade portions of the Work. No amounts shall be reflected in the Schedule of Values or Application for Payment for Extra Work or Deleted Work for which a Change Order has not been executed by Contractor and City or for which a Construction Change Directive has not been issued by City. Amounts that have been mutually agreed to by Change Order or unilaterally determined by City pursuant to a Construction Change Directive shall be segregated from the cost of the base Contract Work and separately listed by line item in the Schedule of Values. The Schedule of Values must be prepared in sufficient detail and supported by sufficient data to substantiate its accuracy as the Director may require. C. Applications for Payment The Schedule of Values, when approved by the Director, shall be used as a basis for Contractor's Applications for Payment and may be considered as fixing a basis for adjustments to the Contract Sum. Page 52 of 117 D. Revisions If, at any time, it is determined that the Schedule of Values does not allocate the Contract Sum in a manner that reasonably and fairly reflects the actual costs anticipated to be progressively incurred by Contractor, it shall be revised and resubmitted for the Director’s approval. 7.03 APPLICATIONS FOR PAYMENT A. Marked Schedule of Values Five (5) Days prior to the date set forth in Paragraph 7.03-B below for the monthly progress payment meeting, Contractor shall submit to Director a copy of the proposed Schedule of Values, marked to show the percentage of completion certified by Contractor for each line item in the Schedule of Values, including any stored materials approved for payment by City pursuant to Paragraph 7.03-D, below and any withholdings from Contractor proposed by Director. B. Monthly Review For the purpose of expediting the progress payment procedure, Contractor shall meet with the Director on or before the twentieth (20th) day of each month to review the Contractor's marked Schedule of Values prepared in accordance with Paragraph 7.03-A, above. The Director shall revise as appropriate and sign the marked Schedule of Values to verify such review. If any item in the marked Schedule of Values submitted for payment is disputed during this review, Contractor agrees to use its best efforts to resolve the disputed items with the Director before submitting its Application for Payment. If the Director and Contractor cannot agree, then the percentage completion shall be established at such percentage as the Director, in good faith, determines is appropriate to the actual progress of the Work. No inaccuracy or error in the Director’s good faith estimate shall operate to release Contractor or Surety from any responsibility or liability arising from or related to performance of the Work. The Director shall have the right subsequently to correct any error and dispute any item submitted in Contractor's Application for Payment, regardless of whether an item was identified as disputed in the review process provided for herein. C. Certification Each Application for Payment shall be signed and certified by Contractor under penalty of perjury to City that: 1. The data comprising the Application for Payment is accurate and the Work has progressed to the point indicated; 2. To the best of Contractor's knowledge, information and belief, the Work is in accordance with the Contract Documents; 3. Contractor is entitled to payment in the amount certified; and 4. All sums previously applied for by Contractor on account of Work performed by Subcontractors and that have been paid by City have been paid to the Subcontractors performing such Work, without any retention, withholding or backcharge by Contractor. Page 53 of 117 D. Stored Materials Payments may be made by City, at its discretion, on account of materials or equipment not incorporated into the Work but delivered on the ground at the Site and suitably stored by Contractor or stored off-Site under the control of City. Such payments shall only be considered upon submission by Contractor of satisfactory evidence that it has acquired title to same, that the material or equipment will be utilized in the Work and that the material is satisfactorily stored, protected and insured, and that such other procedures are in place satisfactory to City to protect City's interests. To be considered for payment, materials or equipment stored off-Site shall, in addition to the above requirements and unless otherwise specifically approved by City in writing, be stored in a bonded warehouse, fully insured, and available to City for inspection. City shall have sole discretion to determine the amount of material and equipment that may be stored on the Site at any given time. 7.04 PROGRESS PAYMENTS A. Conditions to Progress Payments Contractor shall submit its Application for Payment to the Director, using such forms as required by City, once a month on or before the first (1st) Day of the month following the month in which the Work that is the subject of such Application for Payment was performed. Without limitation to any other provisions of the Contract Documents, the following shall be conditions precedent to a proper submission and to the Director approval of each Application for Payment: 1. Submission of a Schedule of Values that reflects the percentages of completion either agreed to or determined by Director in accordance with Paragraph 7.03-B, above; 2. Submission of the Contractor's certification required by Paragraph 7.03-C, above; 3. Submission of conditional releases of stop notice, if any, and bond rights upon progress payment, complying with California Civil Code Section 8132, for all Work performed during the time period covered by the current Application for Payment, signed by Contractor, its Subcontractors of every tier, and all material suppliers to each, and (2) forms of unconditional release of stop notice and bond rights upon progress payment, complying with California Civil Code Section 8134 for all Work performed during the time period covered by the previous Application for Payment, signed by Contractor, its Subcontractors of every tier and all material suppliers to each; 4. Compliance by Contractor with its obligation for maintenance of As-Builts as required by the Contract Documents; 5. Compliance by Contractor with its obligation for submission of monthly and daily reports as required by the Contract Documents; 6. Compliance by Contractor with its obligations for submission of scheduling information and updating of the Construction Schedule as required by Article 4, above and other provisions of the Contract Documents pertaining to preparation or updating of schedule information; 7. Submission of certified payroll records as required by the Contract Documents; 8. Submission of certifications by Contractor and each Subcontractor as required by applicable collective bargaining agreements certifying that all employee benefit contributions due and Page 54 of 117 owed pursuant to any applicable collective bargaining agreement have been paid in full; and 9. Compliance by Contractor with all of its other obligations for submission of documentation or performance of conditions which, by the terms of the Contract Documents, constitute conditions to Contractor's right to receive payment for Work performed. B. Payments by City Pursuant to California Public Contract Code Section 20104.50, City shall make progress payment of undisputed sums due within thirty (30) Days after receipt by Director of an undisputed and properly submitted Application for Payment, calculated on the basis of ninety-five percent (95%) of value determined pursuant to Paragraph 7.03-B above of the following: 1. The portion of the Work permanently installed and in place; 2. Plus, the value of materials delivered on the ground or in storage as approved by City pursuant to Paragraph 7.03-D, above, 3. Less, the aggregate of previous payments, and 4. Less, any other withholdings authorized by the Contract Documents. C. Rejection by City Any Application for Payment determined not to be undisputed, proper and suitable for payment shall be returned to Contractor as soon as practicable, but not later than seven (7) Days, after receipt by City accompanied by an written explanation of the reasons why the payment request was rejected. Failure by City or Director to either timely reject an Application for Payment or specify any grounds for rejection shall not constitute a waiver of any rights by City. Applications for Payment that are rejected shall be corrected and resubmitted within seven (7) Days after receipt by Contractor. D. Interest If City fails to make a progress payment to Contractor as required by Paragraph 7.04-B, above, City shall pay interest to Contractor equivalent to the legal rate set forth in subdivision (a) of California Code of Civil Procedure Section 685.010. The number of Days available to City to make payment pursuant to Paragraph 7.04-B, above without incurring interest pursuant to this Paragraph shall be reduced by the number of Days by which City exceeds the seven (7) Day return requirement applicable to City as set forth in Paragraph 7.04-C, above. 7.05 FINAL PAYMENT A. Retention ln addition to withholdings permitted by Paragraph 7.09 below, a sum equal to five percent (5%) of all sums otherwise due to Contractor as progress payments shall be withheld by city pursuant to Paragraph 7.04-B from each progress payment (“Retention”) and retained until such time as it is due as described herein. A higher Retention amount may be approved by the City Council where project is deemed “substantially complex” by City Council. B. Conditions to Final Payment Page 55 of 117 Contractor shall submit its Application for Final Payment, using such forms as required by Director, prior to requesting a final inspection of the Work in accordance with Paragraph 3.06 above. Such Application for Final Payment shall be accompanied by all the following: 1. An affidavit that payrolls, bills for materials and equipment, and other indebtedness connected with the Project for which City or City's property or funds might be liable have been paid or otherwise satisfied; 2. Contractor’s certification as required by Paragraph 7.03-C, above; 3. Consent of surety, if any, to Final Payment; 4. A certificate evidencing that the insurance required by the Contract Documents is in force; 5. Conditional Waiver and Release Upon Final Payment in the form required by California Civil Code Section 8136 executed by Contractor, all Subcontractors of every tier and by all material suppliers of each, covering the final payment period; 6. Unconditional Waiver and Release Upon Progress Payment in the form required by California Civil Code Section 8136 executed by Contractor, all Subcontractors of every tier and by all material suppliers of each, covering the previous payment period; 7. All Record Documents (including, without limitation, complete and accurate As-Built drawings which shall be kept up to date during the performance of the Work); 8. Documentation that Contractor has inspected, tested, and adjusted performance if every system or facility of the Work to ensure that overall performance is in compliance with the terms of the Contract Documents; 9. Four (4) copies of all warranties from vendors and Subcontractors, operation and maintenance manuals, instructions and related agreements, and equipment certifications and similar documents; 10. Certifications by Contractor and each Subcontractor as required by applicable collective bargaining agreements that all employee benefit contributions due and owing pursuant to any applicable collective bargaining agreement have been paid in full; 11. Releases of rights and claims relating to patents and trademarks, as required by the Contract Documents; and 12. Any other documents or information required by the Contract Documents as a condition of Final Payment or Final Completion. C. Final Payment Pursuant to the Public Contract Code Section 7107, within sixty (60) Days after City issues the Notice Page 56 of 117 of Completion to Contractor, the Final Payment, including Retention, shall be released to Contractor, subject to the City’s right to withhold 150% of any disputed amounts. D. Disputed Amounts Pursuant to California Public Contract Code 7107, City may deduct and withhold from the Final Payment due under Paragraph 7.05-C, above, an amount up to 150% of any disputed amounts, including, without limitation, amounts to protect City against any loss caused or threatened as a result of Contractor's failing to fully perform all of those obligations that are required to be fulfilled by Contractor as a condition to Final Completion and Final Payment. Alternatively, City may elect, in its sole discretion, to accept the Work without correction or completion and adjust the Contract Sum pursuant to the Contract Documents. E. Acceptance of Final Payment Acceptance of Final Payment by Contractor shall constitute a waiver of all rights by Contractor against City for recovery of any loss, excepting only those Claims that have been submitted by Contractor in the manner required by the Contract Documents prior to or at the time of the Final Payment. 7.06 MISCELLANEOUS A. Joint Payment City shall have the right, if deemed necessary in its sole discretion, to issue joint checks made payable to Contractor and any Subcontractor(s) of any Tier. The joint check payees shall be solely responsible for the allocation and disbursement of funds included as part of any such joint payment. Endorsement on such check by a payee shall be conclusively presumed to constitute receipt of payment by such payee. In no event shall any joint check payment be construed to create any contract between City and a Subcontractor of any Tier, any obligation from City to such Subcontractor or any third party rights against City or Director. B. Withholding/Duty to Proceed The payment, withholding or retention of all or any portion of any payment claimed to be due and owing to Contractor shall not operate in any way to relieve Contractor from its obligations under the Contract Documents. Contractor shall continue diligently to prosecute the Work without reference to the payment, withholding or retention of any payment. The partial payment, withholding or retention by City in good faith of any disputed portion of a payment, whether ultimately determined to be correctly or incorrectly asserted, shall not constitute a breach by City of the Construction Contract and shall not be grounds for an adjustment of the Contract Sum or Contract Time. C. No Acceptance No payment by City or partial or entire use of the Work by City shall be construed as approval or acceptance of the Work, or any portion thereof. D. Contractor Payment Warranty Submission of an Application for Payment shall constitute a representation and warranty by Contractor that: Page 57 of 117 1. Title to Work covered by an Application for Payment will pass to City either by incorporation into the construction or upon receipt of payment by Contractor, whichever occurs first; and 2. Work covered by previous Applications for Payment are free and clear of liens, stop notices, claims, security interests or encumbrances imposed by the Contractor or any other person. E. Corrections No inaccuracy or error in any Application for Payment provided by Contractor shall operate to release Contractor from the error, or from losses arising from the Work, or from any obligation imposed by the Contract Documents. City retains the right to subsequently correct any error made in any previously approved Application for Payment, or progress payment issued, by adjustments to subsequent payments. 7.07 PAYMENTS BY CONTRACTOR Contractor shall not include in its Applications for Payment sums on account of any Subcontractor's portion of the Work that it does not intend to pay to such Subcontractor. Upon receipt of payment from City, Contractor shall pay the Subcontractor performing Work on the Project, out of the amount paid to Contractor on account of such Subcontractor's portion of the Work, the amount to which said Subcontractor is entitled in accordance with the terms of its contract with Contractor and applicable laws, including, without limitation, California Public Contract Code Section 7107. Contractor shall remain responsible notwithstanding a withholding by City pursuant to the terms of these Contract Documents, to promptly satisfy from its own funds sums due to all Subcontractors who have performed Work that is included in Contractor's Application for Payment. Contractor shall, by appropriate agreement, require each Subcontractor to make payments to its subcontractors and material suppliers in similar manner. City shall have no obligation to pay or be responsible in any way for payment to a Subcontractor of any tier or material supplier. 7.08 PAYMENTS WITHHELD A. Withholding by City In addition to any other amounts which City may have the right to retain under the Contract Documents, City may withhold a sufficient amount of any payment otherwise due to Contractor as City, in its sole discretion, may deem necessary to cover actual or threatened loss due to any of the following: 1. Third Party Claims. Third-party claims or stop notices filed or reasonable evidence indicating probable filing of such claims or stop notices. City shall promptly inform Contractor of any third party claims related to this Contract; 2. Defective Work. Defective Work not remedied; 3. Nonpayment. Failure of Contractor to make proper payments to its Subcontractors for services, labor, materials or equipment; 4. Inability to Complete. Reasonable doubt that the Work can be completed for the then unpaid balance of the Contract Sum or within the Contract Time; Page 58 of 117 5. Violation of Applicable Laws. Failure of Contractor or its Subcontractors to comply with applicable laws or lawful orders of governmental authorities; 6. Penalty. Any claim or penalty asserted against City by virtue of Contractor’s failure to comply with applicable laws or lawful orders of governmental authorities (including, without limitation labor laws); 7. Failure to Meet Contract Time. Any damages which may accrue as a result of Contractor failing to meet the Construction Schedule or failing to perform within the Contract Time; 8. Setoff. Any reason specified elsewhere in the Contract Documents as grounds for a withholding offset or set off or that would legally entitle City to a set-off or recoupment; 9. Consultant Services. Additional professional, consultant or inspection services required due to Contractor’s failure to comply with the Contract Documents; 10. Liquidated Damages. Liquidated damages assessed against Contractor; 11. Materials. Materials ordered by City pursuant to the Contract Documents; 12. Damages. Loss caused by Contractor or Subcontractor to City, Separate Contractors or any other person or entity under contract to City; 13. Clean Up. Clean up performed by City and chargeable to Contractor pursuant to the Contract Documents; 14. Employee Benefits. Failure of Contractor to pay contributions due and owing to employee benefits funds pursuant to any applicable collective bargaining agreement or trust agreement; 15. Required Documents. Failure of Contractor to submit on a timely basis, proper and sufficient documentation required by the Contract Documents, including, without limitation, Construction Schedule updates, ‘look ahead’ schedules, Submittals, Schedules of Values, information on Subcontractors, Change Orders, certifications and other required reports or documentation; and 16. Other Breach. A breach of any obligation or provision of the Contract Documents. B. Release of Withholding If and when City determines, in its sole discretion, that the above grounds for withholding have been removed and that all losses incurred or threatened have been paid, credited or otherwise satisfied, then payment shall be made for amounts withheld because of them. C. Application of Withholding City may apply sums withheld pursuant to Paragraph 7.08-A above, in payment of any loss or threatened loss as City determines, in its sole discretion, to be appropriate. Such payments may be made without a prior judicial determination of City’s actual rights with respect to such loss. Contractor agrees and hereby designates City as its agent for such purposes, and agrees that such payments shall be considered as payments made under Construction Contract by City to Contractor. City shall not be liable to Contractor for such payments made in good faith. City shall submit to Contractor an accounting of such funds disbursed on behalf of Contractor. As an alternative to such payment, City Page 59 of 117 may, in its sole discretion, elect to exercise its right to adjust the Contract Sum as provided in the Contract Documents. D. Continuous Performance Provided City pays the undisputed portion, if any, of funds withheld in good faith, Contractor shall maintain continuous and uninterrupted performance of the Work during the pendency of any disputes or disagreements with City. 7.09 SUBSTITUTION OF SECURITIES A. Public Contract Code Pursuant to the requirements of California Public Contract Code Section 22300, upon Contractor’s request, City will make payment to Contractor of any funds withheld from payments to ensure performance under the Contract Documents if Contractor deposits with City, or in escrow with a California or federally chartered bank in California acceptable to City (“Escrow Agent”), securities eligible for the investment of State Funds under Government Code Section 16430, or bank or savings and loan certificates of deposit, interest-bearing demand deposit accounts, standby letters of credit, or any other security mutually agreed to by the Contractor and the City, upon the following conditions: 1. Contractor shall be the beneficial owner or any securities substituted for monies withheld for the purpose of receiving any interest thereon. 2. All expenses relating to the substitution of securities under Public Contract Code Section 22300 and under this Paragraph 7.04, including, but not limited to City’s overhead and administrative expenses, and expenses of Escrow Agent shall be the responsibility of Contractor. 3. Securities or certificates of deposit substituted for monies withheld shall be of a value of at least equivalent to the amounts of retention to be paid to Contractor pursuant to the Contract Documents. 4. If Contractor chooses to deposit securities in lieu of monies withheld with an Escrow Agent, Contractor, City and Escrow Agent shall, as a prerequisite to such deposit, enter into an escrow agreement, using the City’s form, “Escrow Agreement for Deposit of Securities in Lieu of Retention.” 5. Contactor shall obtain the written consent of Surety to such agreement. 6. Securities, if any, shall be returned to Contractor only upon satisfactory Final Completion of the Work. B. Substitute Security To minimize the expense caused by such substitution of securities, Contractor shall, prior to or at the time Contractor requests to substitute security, deposit sufficient security to cover the entire amount to be withheld. Should the current market value of such substituted security fall below the amount for which it was substituted, or any other amounts which the City withholds pursuant to the Contract Documents, Contractor shall immediately and at Contractor’s expense and at no cost to City deposit additional security qualifying under Public Contract Code Section 22300 until the current market value of the total security deposited is no less than the amount subject to withholding under the Contract Page 60 of 117 Documents. Securities shall be valued as often as conditions of the securities market warrant, but in no case less frequently than once per month. C. Deposit of Retentions Alternatively, subject to the conditions set forth in Paragraph 7.04-A above, upon request of Contractor, City shall make payment of retentions directly to Escrow Agent at the expense of Contractor, provided that Contractor, City and Escrow Agent shall, as a prerequisite such payment, enter into an escrow agreement in the same form as prescribed in Part 4 of Paragraph A, above. At the expense of Contractor and at no cost to City, Contractor may direct the investment of the payments into securities and interest bearing accounts, and Contractor shall receive the interest earned on the investments. Escrow Agent shall hold such direct payments by City under the same terms provided herein for securities deposited by Contractor. Upon satisfactory Final Completion of the Work, Contractor shall receive from Escrow Agent all securities, interest and payments received by Escrow Agent from City, less escrow fees and charges of the Escrow Account, according to the terms of Public Contract Code Section 22300 and the Contract Documents. D. Time for Election of Substitution of Securities Notwithstanding the provision of 7.04 A, B, and C above and California Public Contract Code Section 22300, the failure of Contractor to request the Substitution of eligible securities for monies to be withheld by City within ten (10) days of the award of Contract to Contractor shall be deemed to be a waiver of all such rights. 7.10 CLAIMS A. Arising of Claim. 1. Scope Change. When Contractor has a claim for an increase in the Contract Sum or Contract Time due to a scope change which has not yet become final, a “claim” will be deemed to arise once the Director has issued a decision denying, in whole or in part, the Contractor’s Change Order Request. 2. Other Claims. In the case of a Claim by Contractor that does not involve an adjustment to the Contract Sum or Contract Time due to a scope change and which has not become final, the Claim may be asserted if, and only if, Contractor gives written notice to City of intent to file the Claim within three (3) days of the date of discovery relative to such circumstances (even if Contractor has not yet been damaged or delayed). Such written notice of intent to file a Claim shall be valid if, and only if, it identifies the event or condition giving rise to the Claim, states its probable effect, if any with respect to Contractor's entitlement to an adjustment of the Contract Sum or Contract Time and complies with the requirements of Paragraph 7.11-B, below. For purposes of this Paragraph 7.11, a Claim for which such written notice is required and has been given by Contractor shall be deemed to arise on the date that such written notice is received by City. B. Content of Claim A Claim by Contractor must include all of the following: 1. A statement that it is a Claim and a request for a decision on the Claim; Page 61 of 117 2. A detailed description of the act, error, omission, unforeseen condition, event or other circumstance giving rise to the Claim. 3. If the Claim involves an adjustment to the Contract Sum or Contract Time due to a change in scope, a statement demonstrating that all requisite notices were provided, including, without limitation, timely written notice and a Change Order Request as required by Article 6 of these General Conditions and timely notice of delay and request for extension of time in accordance with Article 3. If the Claim does not involve an adjustment to the Contract Sum or Contract Time due to a change in scope, a statement demonstrating that a notice of intent to file the Claim was timely submitted as required by Paragraph 7.10-A.2, above; 4. A detailed justification for any remedy or relief sought by the Claim including without limitation, a detailed cost breakdown in the form' required for submittal of Change Order Requests and actual job cost records demonstrating that the costs have been incurred; 5. If the Claim involves a request for adjustment of the Contract Time, written documentation demonstrating that Contractor has complied with the requirements of the Contract Documents and written substantiation (including, without limitation, a Time Impact Analysis) demonstrating that Contractor is entitled to an extension of time under the Contract Documents; and 6. A written certification signed by a managing officer of Contractor's organization, who has the authority to sign contracts and purchase orders on behalf of Contractor and who has personally investigated and confirmed the truth and accuracy of the matters set forth in such certification, in the 'following form: "I hereby certify under penalty of perjury that I am a managing officer of (Contractor's name) and that I have reviewed the Claim presented herewith on Contractor's behalf and/or on behalf of (Subcontractor's name) and that, to the best of my knowledge after conducting a diligent inquiry into the facts of the Claim, the following statements are true and correct: The facts alleged in or that form the basis for the Claim are, to the best of my knowledge following diligent inquiry, true and accurate; and, (a) I do not know of any facts or circumstances, not alleged in the Claim,that by reason of their not being alleged render any fact or statement alleged in the Claim materially misleading; and, (b) I have, with respect to any request for money or damages alleged in or that forms the basis for the Claim, reviewed the job cost records (including those maintained by Contractor and by any Subcontractor, of any tier, that is asserting all or any portion of the Claim) and confirmed with reasonable certainty that the losses or damages suffered by Contractor and/or such Subcontractor were in fact suffered in the amounts and for the reasons alleged in the Claim; and, (c) I have, with respect to any request for extension of time or claim of delay, disruption, hindrance or interference alleged in or that forms the basis for the Claim, reviewed the job schedules (including those maintained by Contractor and the Subcontractor, of any tier, that is asserting all or any portion of the Claim) and confirmed on an event-by-event basis that the delays or disruption suffered by Contractor and/or such Subcontractor were in fact experienced for the durations, in the manner, and with the consequent effects on the time and/or sequence of Page 62 of 117 performance of the Work, as alleged in the Claim; and, (d) I have not received payment from City for, nor has Contractor previously released City from, any portion of the Claim.” Signature: Date: Name: Title: Company C. Noncompliance Failure to submit any of the information, documentation or certifications required by Paragraph 7.10- B, above, shall result in the Claim being returned to Contractor without any decision. D. Submission of Claims 1. Director. Claims shall be first submitted to the City for decision by the Director. 2. Continuous Work. Notwithstanding the making of any Claim or the existence of any dispute regarding any Claim, unless otherwise directed by City, Contractor shall not delay, slow or stop performance of the Work, but shall diligently proceed with performance in accordance with the Contract Documents and City will continue, to make undisputed payments as by the Contract Documents. 3. Time for Filing. All Claims and supporting documentation and certifications must be filed within thirty (30) days after the Claim arises. No Claims shall be filed after Final Payment. 4. Conditions Precedent. No Claim may be asserted unless Contractor has strictly complied with the requirements of this Paragraph 7.10-D, which shall be considered conditions precedent to Contractor’s right to assert the Claim and to initiate the Dispute Resolution Process with respect to such Claim. E. Response to Claims, Meet and Confer 1. Claims less than $50,000. Claims less than $50,000 shall be responded to by City in writing within forty-five (45) days of receipt of the Claim, unless City requests additional information or documentation of the Claim within thirty (30) days of receipt of the Claim, in which case City shall respond to the Claim within fifteen (15) days after receipt of the further information or documentation or within a period of time no greater than that taken by Contractor in producing the additional information or documentation, whichever is greater. 2. Claims $50,000 or more. Claims $50,000 or more shall be responded to by City in writing within (60) days of receipt of the Claim, unless City requests additional information or documentation of the Claim within thirty (30) days of receipt of the Claim, in which case City shall respond to the Claim within thirty(30) days after receipt of the further information or documentation or within a period of time no greater than that taken by Contractor in producing the additional information or documentation, whichever is greater. Page 63 of 117 3. Meet and Confer. If Contractor disputes City's response, or if City fails to respond within the prescribed time set forth in Paragraph 7.10-E.1 and 7.10-E.2, above, Contractor may so notify City, in writing, within fifteen (15) days of City's response, or within fifteen (15) days of City’s response due date in the event of a failure to respond, and demand an informal conference to meet and confer for settlement of the issues in dispute. Upon such demand, City shall schedule a meet and confer conference within thirty (30) days of such demand, for discussion of settlement of the dispute. F. Finality of Decision If Contractor disputes the Director’s decision under this Article, it shall commence the Dispute Resolution Process as set forth in Article 15 of these General Conditions by filing a Statement of Dispute within seven (7) days after receipt of the Director’s response. G. Continuing Contract Performance/Duty to Proceed with Disputed Work Contractor shall not delay or postpone any Work pending resolution of any claims, disputes or disagreements. Pending final resolution of a claim, the Contactor shall proceed diligently with performance of the Contract and the City shall continue to make payments for undisputed Work in accordance with the Contract Documents. In the event of disputed Work, City shall have the right to unilaterally issue a Work Directive and Contractor shall continue performance pending resolution of the dispute and shall maintain the accounting and cost data to substantiate the cost of such disputed work. [END OF ARTICLE] Page 64 of 117 ARTICLE 8 - MATERIALS AND EQUIPMENT 8.01 GENERAL A. The Contractor shall furnish all materials and equipment needed to complete the Work and installations required under the terms of this Contract, except those materials and equipment specified to be furnished by the City. B. The Contractor shall submit satisfactory evidence that the materials and equipment to be furnished and used in the work are in compliance with the Specifications. Materials and equipment incorporated in the Work and not specifically covered in the Specifications shall be the best of their kind. Unless otherwise specified, all materials and equipment incorporated in the Work under the Contract shall be new. 8.02 QUALITY AND WORKMANSHIP All material and equipment furnished by the Contractor shall be new, high grade, and free from defects and imperfections, unless otherwise hereinafter specified. Workmanship shall be in accordance with the best standard practices. All materials and equipment must be of the specified quality and equal to approved samples, if samples have been required. All Work shall be done and completed in a thorough, workmanlike manner, notwithstanding any omission from the Specifications or Drawings, and it shall be the duty of the Contractor to call attention to apparent errors or omissions and request instructions before proceeding with the Work. The Director may, by appropriate instructions, correct errors and supply omissions, which instructions shall be binding upon the Contractor as though contained in the original Specifications or Drawings. All Work performed under the Specifications will be inspected by the Director as provided in Paragraph 8.04. All materials and equipment furnished and all Work done must be satisfactory to the Director. Work, material, or equipment not in accordance with the Specifications, in the opinion of the Director shall be made to conform thereto. Unsatisfactory materials and equipment will be rejected, and if so ordered by the Director, shall, at the Contractor's expense, be immediately removed from the vicinity of the Work. 8.03 TRADE NAMES AND "OR APPROVED EQUAL" PROVISION Whenever in the Specifications or Drawings the name or brand of a manufactured article is used it is intended to indicate a measure of quality and utility or a standard. Except in those instances where the product is designated to match others in use on a particular improvement either completed or in the course of completion, the Contractor may substitute any other brand or manufacture of equal appearance, quality, and utility on approval of the Director, provided the use of such brand or manufacture involves no additional cost to the City. 8.04 APPROVAL OF MATERIALS A. The Contractor shall furnish without additional cost to the City such quantities of construction materials as may be required by the Director for test purposes. He/she shall place at the Director's disposal all available facilities for and cooperate with him in the sampling and testing of all materials and workmanship. The Contractor shall prepay all shipping charges on samples. No samples are to be submitted with the bids unless otherwise specified. B. Each sample submitted shall be labeled. A letter, in duplicate, submitting each shipment of samples shall be mailed to the Director by the Contractor. Both the label on the sample and the letter of transmittal shall indicate the material represented, its place of origin, the names of the producer and the Contractor, the Specifications number and title, and a reference to the applicable Drawings and Specifications paragraphs. Page 65 of 117 C. Materials or equipment of which samples are required shall not be used on the Work until approval has been given by the Director in writing. Approval of any sample shall be only for the characteristics of the uses named in such approval and no other. No approval of a sample shall be taken in itself to change or modify any Contract requirement. D. Failure of any material to pass the specified tests, including life cycle maintenance data may be sufficient cause for refusal to consider under this Contract, any further sample of the same brand or make of that material. 8.05 ORDERING MATERIALS AND EQUIPMENT One copy of each of the Contractor's purchase orders for materials and equipment forminga portion of the Work must be furnished to the Director, if requested. Each such purchase order shall contain a statement that the materials and equipment included in the order are subject to inspection by the City. Materials and equipment purchased locally will, at the City’s discretion, be inspected at the point of manufacture or supply, and materials and equipment supplied from points outside the Los Angeles area will be inspected upon arrival at the job, except when other inspection requirements are provided for specific materials in other sections of the Contract Documents. 8.06 AUTHORITY OF THE DIRECTOR A. On all questions concerning the acceptability of materials or machinery, the classification of materials, the execution of the Work, and conflicting interests of Contractors performing related work, the decision of the Director shall be final and binding. B. The Director will make periodic observations of materials and completed work to observe their compliance with Drawings, Specifications, and design and planning concepts, but he/she is not responsible for the superintendence of construction processes, site conditions, operations, equipment, personnel, or the maintenance of a safe place to work or any safety in, on, or about the site of work. 8.07 INSPECTION All materials furnished and work done under this Contract will be subject to rigid inspection. The Contractor shall furnish, without extra charge, the necessary test pieces and samples, including facilities and labor for obtaining them, as requested by the Director. The Director, or his/her authorized agent or agents, at all times shall have access to all parts of the shop and the works where such materials under his/her inspection is being manufactured or the work performed. Work or material that does not conform to the Specifications, although accepted through oversight, may be rejected at any stage of the Work. Whenever the Contractor is permitted or directed to do night work or to vary the period during which work is carried on each day, he/she shall give the Director due notice, so that inspection may be provided. Such work shall be done under regulations to be furnished in writing by the Director. 8.08 INFRINGEMENT OF PATENTS The Contractor shall hold and save the City, its officers, agents, servants, and employees harmless from and against all and every demand or demands, of any nature or kind, for or on account of the use of any patented invention, process, equipment, article, or appliance employed in the execution of the Work or included in the materials or supplies agreed to be furnished under this Contract, and should the Contractor, his/her agents, servants, or employees, or any of them, be enjoined from furnishing or using any invention, process, equipment, article, materials, supplies or appliance supplied or required to be supplied or used under this Contract, the Contractor shall promptly substitute other inventions, processes, equipment, articles, materials, supplies, or Page 66 of 117 appliances in lieu thereof, of equal efficiency, quality, finish, suitability, and market value, and satisfactory in all respects to the Director. Or in the event that the Director elects, in lieu of such substitution, to have, supplied, and to retainand use, any such invention, process, equipment, article, materials, supplies, or appliances, as may by this Contract be required to be supplied and used, in that event the Contractor shall at his/her expense pay such royalties and secure such valid licenses as may be requisite and necessary to enable the City, its officers, agents, servants, and employees, or any of them, to use such invention, process, equipment, article, materials, supplies, or appliances without being disturbed or in way interfered with by any proceeding in law or equity on account thereof. Should the Contractor neglect or refuse promptly to make the substitution hereinbefore required, or to pay such royalties and secure such licenses as may be necessary and requisite for the purpose aforesaid, then in that event the Director shall have the right to make such substitution, or the City may pay such royalties and secure such licenses and charge the cost thereof against any money due the Contractor from the City, or recover the amount thereof from him/her and his/her surety, notwithstanding final payment under this Contract may have been made. [END OF ARTICLE] Page 67 of 117 ARTICLE 9 – SUBMITTALS 9.01 GENERAL A. The Contractor shall submit samples, drawings, and data for the Director's approval which demonstrate fully that the construction, and the materials and equipment to be furnished will comply with the provisions and intent of the Drawings and Specifications. B. Specific items to be covered by the submittals shall include, as a minimum, the following: 1. For structures, submit all shop, setting, equipment, miscellaneous iron and reinforcement drawings and schedules necessary. 2. For conduits, submit a detailed layout of the conduit with details of bends and fabricated specials and furnish any other details necessary. Show location of shop and field welds. 3. For equipment which requires electrical service, submit detailed information to show power supply requirements, wiring diagrams, control and protection schematics, shop test data, operation and maintenance procedures, outline drawings, and manufacturer's recommendation of the interface/interlock among the equipment. 4. For mechanical equipment submit all data pertinent to the installation and maintenance of the equipment including shop drawings, manufacturer's recommended installation procedure, detailed installation drawings, test data and curves, maintenance manuals, and other details necessary. 5. Samples 6. Colors 7. Substitutions 8. Manuals 9. As-built drawings 10. Safety plans required by Article 10 9.02 PRODUCT HANDLING A. Submittals shall be accompanied by a letter of transmittal and shall be in strict accordance with the provisions of this Article. B. Submit priority of processing when appropriate. 9.03 SCHEDULE OF SUBMITTALS A. The Contractor shall prepare and submit a schedule of submittals. The schedule of submittals shall be in the form of a submittal log. Refer to Paragraph 9.12. Page 68 of 117 9.04 SHOP DRAWINGS A. All shop drawings shall be produced to a scale sufficiently large to show all pertinent features of the item and its method of connection to the Work. B. All shop drawing prints shall be made in blue or black line on white background. Reproductions of City/Contract Drawings are not acceptable. C. The overall dimensions of each drawing submitted to the Director shall be equal to one of the City's standard sheet sizes as listed below. The title block shall be located in the lower right hand corner of each drawing and shall be clear of all line Work, dimensions, details, and notes. Sheet Sizes Height X Width 11" X 8 1/2" 11" X 17" 24" X 36" 30” X 42” 9.05 COLORS Unless the precise color and pattern are specified elsewhere, submit accurate color charts and pattern charts to the Director for his/her review and selection whenever a choice of color or pattern is available in a specified product. Label each chart naming the source, the proposed location of use on the project, and the project. 9.06 MANUFACTURERS' LITERATURE Where contents of submitted literature from manufacturers includes data not pertinent to the submittal, clearly show which portions of the contents are being submitted for review. 9.07 SUBSTITUTIONS A. The Contract is based on the materials, equipment, and methods described in the Contract Documents. Any Contractor proposed substitutions are subject to the Director’s approval. The Director will consider proposals for substitution of materials, equipment, and methods only when such proposals are accompanied by full and complete technical data, and all other information, including life cycle maintenance data, required by the Director to evaluate the proposed substitution. B. Any requests for substitutions by the Contractor must be made within forty-five (45) calendar days from the Issuance Date on the Notice to Proceed. Otherwise, such requests will not be considered. C. Trade names and "or approved equal" provision as set forth in Paragraph 8.03. 9.08 MANUALS A. When manuals are required to be submitted covering items included in this Work, prepare and submit such manuals in approximately 8-1/2" X 11" format in durable plastic binders. In addition, manuals shall be submitted in electronic format. Manuals shall contain at least the following: 1. Identification on, or readable through, the front cover stating general nature of the manual. Page 69 of 117 2. Neatly typewritten index near the front of the manual, furnishing immediate information as to location in the manual of all emergency data regarding the installation. 3. Complete instructions regarding operation and maintenance of all equipment involved. 4. Complete nomenclature of all replaceable parts, their part numbers, current cost, and name and address of nearest vendor of parts. 5. Copy of all guarantees and warranties issued. 6. Copy of drawings with all data concerning changes made during construction. B. Where contents of manuals include manufacturers' catalog pages, clearly indicate the precise items included in this installation and delete, or otherwise clearly indicate, all manufacturers' data with which this installation is not concerned. 9.09 AS-BUILT DRAWINGS A. When required to be submitted covering items included in this Work, the Contractor shall deliver to the City one complete set of final As-Built hard copy drawings together with a set of AutoCAD drawing files in electronic format showing completed building, “as-built” for City records before the Contract will be accepted by the City. B. The drawings shall be duplicates and at the same size and dimensional scale as the originals. They shall be on a polyester translucent base material with a minimum sheet thickness of .003 inch (.08mm). C. The legibility and contrast of each drawing submitted to the City shall be such that every line, number, letter, and character is clearly readable in a full size blow back from a 35 mm microfilm negative of the drawing. 9.10 SUBMITTALS QUANTITIES A. Submit seven (7) copies of all data and drawings unless specified otherwise. B. Submit all samples, unless specified otherwise, in the quantity to be returned, plus two, which will be retained by the Director. 9.11 IDENTIFICATION OF SUBMITTALS Completely identify each submittal and re-submittal by showing at least the following information: A. Name and address of submitter, plus name and telephone number of the individual who may be contacted for further information. B. Name of project as it appears in the Contract Documents and Specification No. C. Drawing number and Specifications section number other than this section to which the submittal applies. D. Whether this is an original submittal or re-submittal. E. For samples, indicate the source of the sample. Page 70 of 117 9.12 SCHEDULE OF SUBMITTALS A. Submit initial schedule of submittals within five (5) Working Days after the Issuance Date on Notice to Proceed. B. Submit revised schedule of submittals within five (5) Working Days after date of request from the Director. C. The Director will review schedule of submittals and will notify Contractor that schedule is acceptable or not acceptable within five (5) Working Days after receipt. 9.13 COORDINATION OF SUBMITTALS A. Prior to submittal for the Director’s review, use all means necessary to fully coordinate all material, including the following procedures: 1. Determine and verify all field dimensions and conditions, materials, catalog numbers, and similar data. 2. Coordinate as required with all trades and with all public agencies involved. 3. Secure all necessary approvals from public agencies and others and signify by stamp, or other means, that they have been secured. 4. Clearly indicate all deviations from the Specifications. B. Unless otherwise specifically permitted by the Director, make all submittals in groups containing all associated items; the Director may reject partial submittals as not complying with the provisions of the Specifications. 9.14 TIMING FOR SUBMITTALS A. Make all submittals far enough in advance of scheduled dates of installation to provide all required time for reviews, for securing necessary approvals, for possible revision and re-submittal, and for placing orders and securing delivery. B. In scheduling, allow at least 15 Working Days for the Director’s review, plus the transit time to and from the City office. C. Manuals shall be submitted prior to performing functional tests. 9.15 APPROVAL BY CITY A. Up to three (3) copies of each submittal, except manuals, schedule of costs for progress payments, and as-built drawings will be returned to the Contractor marked "No Exceptions Taken," “Make Corrections Noted - Do Not Resubmit,” or “Make Corrections Noted - Resubmit.” Manuals, schedule of costs, and as-built drawings will be returned for re-submittal if incomplete or unacceptable. B. Submittals marked "Approved as Noted" need not be resubmitted, but the notes shall be followed. C. If submittal is returned for correction, it will be marked to indicate what is unsatisfactory. Page 71 of 117 D. Resubmit revised drawings or data as indicated, in five (5) copies. E. Approval of each submittal by the Director will be general only and shall not be construed as: 1. Permitting any departures from the Specifications requirements. 2. Relieving the Contractor of the responsibility for any errors and omissions in details, dimensions, or of other nature that may exist. 3. Approving departures from additional details or instructions previously furnished by the Director. 9.16 CHANGES TO APPROVED SUBMITTALS A. A re-submittal is required for any proposed change to an approved submittal. Changes which require re-submittal include, but are not necessarily limited to, drawing revisions, changes in materials and equipment, installation procedures and test data. All re-submittals shall include an explanation of the necessity for the change. B. Minor corrections to an approved submittal may be accomplished by submitting a "Corrected Copy". [END OF ARTICLE] Page 72 of 117 ARTICLE 10 – SAFETY 10.01 PROTECTION OF PERSONS AND PROPERTY A. Contractor's Responsibility: Notwithstanding any other provision of the Contract Documents, the Contractor shall be solely and completely responsible for conditions of the job site, including safety of all persons and property, during performance of the Work. This requirement will apply continuously and will not be limited to normal working hours. Safety and sanitary provisions shall conform to all applicable Federal, State, County, and local laws, regulations, ordinances, standards, and codes. Where any of these are in conflict, the more stringent requirement shall be followed. B. Sanitary Facilities. The Contractor shall furnish and maintain sanitary facilities by the worksites for the entire construction period. C. Protection of the Public. The Contractor shall take such steps and precautions as his/her operations warrant to protect the public from danger, loss of life, loss of property or interruption of public services. Unforeseen conditions may arise which will require that immediate provisions be made to protect the public from danger or loss, or damage to life and property, due directly or indirectly to prosecution of work under this contract. Whenever, in the opinion of the Director, a condition exists which the Contractor has not taken sufficient precaution of public safety, protection of utilities and/or protection of adjacent structures or property, the Director will order the Contractor to provide a remedy for the condition. If the Contractor fails to act on the situation within a reasonable time period as determined by the Director, or in the event of an emergency situation, the Director may provide suitable protection by causing such work to be done and material to be furnished as, in the opinion of the Director, may seem reasonable and necessary. The cost and expense of all repairs (including labor and materials) as are deemed necessary, shall be borne by the Contractor. All expenses incurred by the City for emergency repairs will be deducted from the final payment due to the Contractor. 10.02 PROTECTION FROM HAZARDS A. Trench Excavation Excavation for any trench four (4) feet or more in depth shall not begin until the Contractor has received approval from the Director of the Contractor's detailed plan for worker protection from the hazards of caving ground during the excavation of such trench. Such plan shall show the details of the design of shoring, bracing, sloping or other provisions to be made for worker protection during such excavation. No such plan shall allow the use of shoring, sloping or protective system less effective than that required by the Construction Safety Orders of the Division of Occupational Safety and Health, and if such plan varies from the shoring system standards established by the Construction Safety Orders, the plan shall be prepared and signed by an engineer who is registered as a Civil or Structural Director in the State of California. B. Confined Spaces Contractor shall comply with all of the provisions of General Industry Safety Orders of the California Code of Regulations. Entry of a confined space shall not be allowed until the Contractor has received approval from the Director of the Contractor’s program for confined space entry. Confined space means a space that (1) Is large enough and so configured that an employee can bodily enter and perform assigned Work; and (2) Has limited or restricted means for entry or exit (for example, tanks, vessels, silos, storage bins, hoppers, vaults, and pits are spaces that may have limited means of entry); and (3) Is not designed for continuous employee occupancy. Failure to submit a confined space entry program Page 73 of 117 may result in actions as provided in Article 5: “Suspension or Termination of Contract.” C. Material Safety Data Sheet Contractor shall comply with all of the provisions of General Industry Safety Orders of the California Administrative Code. The Contractor shall submit to the Director a Material Safety Data Sheet (MSDS) for each hazardous substance proposed to be used, ten (10) days prior to the delivery of such materials to the job site or use of such materials at a manufacturing plant where the Director is to perform an inspection. For materials which are to be tested in City laboratories, the MSDS shall be submitted with the sample(s). Hazardous substance is defined as any substance included in the list (Director's List) of hazardous substances prepared by the Director, California Department of Industrial Relations, pursuant to Labor Code Section 6382. Failure to submit an MSDS for any hazardous substance may result in actions as provided in Article 5, "Suspension or Termination of Contract". 10.03 DIFFERING SITE CONDITIONS A. Differing Site Conditions Defined. The Contractor shall promptly, and before such conditions are disturbed, notify the Director in writing of any Differing Site Conditions. Differing Site Conditions are those conditions, located at the project site or in existing improvements and not otherwise ascertainable by Contractor through the exercise of due diligence in the performance of its inspection obligations in the Contract Documents, encountered by Contractor in digging trenches or other excavations(s) that extend deeper than four feet below the surface of the ground that constitute: 1. Material that the Contractor believes may be material that is hazardous waste as defined in Section 25117 of the Health and Safety Code, which is required to be removed to a Class I, Class II, or Class III disposal site in accordance with provisions of existing law. 2. Subsurface or latent physical conditions at the site differing materially from those indicated in these Contract Documents. 3. Unknown physical conditions at the site, of any unusual nature, different materially from those ordinarily encountered and generally recognized as inherent in Work of the character provided for in these Contract Documents. B. Notice by Contractor. If the Contractor encounters conditions it believes constitute Differing Site Conditions, then notice of such conditions shall, before such conditions are disturbed, be promptly reported to the Director followed within twenty-four (24) hours by a further written notice stating a detailed description of the conditions encountered. C. The Director will promptly investigate the conditions and If he/she finds that such conditions do materially differ, or do involve hazardous waste, and do cause an increase or decrease in the Contractor's cost of, or time required for, performance of any part of the Work under this Contract, an equitable adjustment will be made, as determined by the Director. D. Change Order Request. If Contractor intends to seek an adjustment to the Contract Sum or Contract Time based upon Differing Site Conditions, it must, within ten (10) Days after the Discovery Date relative to such conditions, submit a Change Order Request setting forth a detailed cost breakdown and Time Impact Analysis, in the form required by Article 6 of these General Conditions, of the additional Allowable Costs and Excusable Delay resulting from such Differing Site Conditions. E. Failure to Comply. Failure by Contractor to strictly comply with the requirements of this Paragraph Page 74 of 117 10.03 concerning the timing and content of any notice of Differing Site Conditions or request for adjustment in Contract Sum or Contract Time based on Differing Site Conditions shall be deemed waiver of any right by the Contractor for an adjustment in the Contract Sum or Contract Time by reason of such conditions. F. Final Completion. No claim by the Contractor for additional compensation for Differing Site Conditions shall be allowed if asserted after Final Payment. G. In the event of disagreement between the Contractor and the Director whether the conditions do materially differ or whether a hazardous waste is involved or whether the conditions cause an increase or decrease in the Contractor's cost of, or time required for, performance of any part of the Work, the Contractor shall not be excused from any completion date required by the Contract, but shall proceed with all Work to be performed under the Contract Documents. H. The Contractor shall retain all rights provided by, and shall be subject to all requirements of, this Contract which pertain to the resolution of disputes and protests. I. Contractor Responsibility. Except as otherwise provided in this Paragraph 10.03 for Differing Site Conditions, Contractor agrees to solely bear the risk of additional cost and Delay due to concealed or unknown conditions,surface or subsurface, at the Site or in Existing Improvements, without adjustment to the Contract Sum or Contract Time. 10.04 TRAFFIC REGULATION A. During the performance of the Work the Contractor shall erect and maintain necessary temporary fences, bridges, railings, lights, signals, barriers, or other safeguards as shall be appropriate under the circumstance in his/her judgment for the prevention of accidents; and he/she shall take other precautions as necessary for public safety including, but not limited to, traffic control. Traffic control shall be conducted in accordance with the latest edition of the Work Area Traffic Control (“WATCH”) handbook, published by BNi Books, and as directed and approved by the City Traffic and Transportation Administrator. B. Contractor shall submit at least ten (10) Working Days prior to Work a detailed traffic control plan, that is approved by all agencies having jurisdiction and that conforms to all requirements of the Specifications. C. No changes or deviations from the approved detailed traffic control plan shall be made, except temporary changes in emergency situations, without prior approval of the City Traffic and Transportation Administrator and all agencies having jurisdiction. Contractor shall immediately notify the Director, the City Traffic and Transportation Administrator and the agencies having jurisdiction of occurrences that necessitate modification of the approved traffic control plan. D. Contractor’s failure to comply with this provision may result in actions as provided in Article 5: “Suspension or Termination of Contract” of these General Conditions. 10.05 TRAFFIC CONTROL DEVICES A. Traffic signs, flashing lights, barricades and other traffic safety devices used to control traffic shall Page 75 of 117 conform to the requirements of the WATCH handbook or the manual of traffic control, whichever is more stringent, and as approved by the City Traffic and Transportation Administrator. 1. Portable signals shall not be used unless permission is given in writing by the agency having jurisdiction. 2. Warning signs used for nighttime conditions shall be reflectorized or illuminated. "Reflectorized signs" shall have a reflectorized background and shall conform to the current State of California Department of Transportation specification for reflective sheeting on highway signs. B. If the Contractor fails to provide and install any of the signs or traffic control devices required herby or ordered by the City staff, staff may cause such signs or traffic control devices to be placed by others, charge the costs therefore against the Contractor, and deduct the same from the next progress payment. 10.06 EXECUTION A. The Contractor shall provide written notification to the Police Department, Traffic Bureau (323) 587- 5171, at least two (2) weeks prior to the beginning of construction at any particular location. Notification will include the specific location, project dates, what lanes of the roadway will be closed and when. Also the construction project manager’s name and business phone number and the construction inspector’s name and business phone number. B. The Contractor shall notify, by telephone, the Police Department, (323) 587-5171 at the completion of any posting of temporary no parking signs. Notification will include the times, dates and locations of the posting. When vehicles must be towed for violation of temporary no parking signs, the person who actually posted the signs, or on-view supervisor of that posting, will be present to answer pertinent questions that may be asked by the parking enforcement officer or police officer towing the vehicles. C. The Contractor shall notify the Fire Department, on a daily basis during the entire period that construction is in progress whenever roadways are reduced in width or blocked. Notification shall be made to the Fire Dispatch (323) 881-6183 and the Contractor shall provide the information required to identify which roadways would have accessibility problems due to his/her operations. The Contractor shall submit to Fire Department schedule of Work for their use and files. D. Roads subject to interference from the Work covered by this Contract shall be kept open, and the fences subject to interference shall be kept up by the Contractor until the Work is finished. Except where public roads have been approved for closure, traffic shall be permitted to pass through designated traffic lanes with as little inconvenience and delay as possible. E. Where alternating one-way traffic has been authorized, the maximum time that traffic will be delayed shall be posted at each end of the one-way traffic section. The maximum delay time shall be approved by the agency having jurisdiction. F. Contractor shall install temporary traffic markings where required to direct the flow of traffic and shall maintain the traffic markings for the duration of need. Contractor shall remove the markings by abrasive blasting when no longer required. G. Convenient access to driveways and buildings in the vicinity of Work shall be maintained as much as Page 76 of 117 possible. Temporary approaches to, and crossing of, intersecting traffic lanes shall be provided and kept in good condition. H. When leaving a Work area and entering a roadway carrying public traffic, the Contractor's equipment, whether empty or loaded, shall in all cases yield to public traffic. 10.07 FLAGGING A. Contractor shall provide flaggers to control traffic where required by the approved traffic control plan. 1. Flaggers shall perform their duties and shall be provided with the necessary equipment in accordance with the current "Instructions to Flaggers" of the California Department of Transportation. 2. Flaggers shall be employed full time on traffic control and shall have no other duties. 10.08 PEDESTRIAN CANOPIES OR BARRICADE IMPROVEMENTS Refer to City of Vernon for requirements for building or access road safety improvements that the Contractor shall construct during construction period. These devices or improvements, as the City deems necessary or prudent, shall be at the expense of the Contractor. [END OF ARTICLE] Page 77 of 117 ARTICLE 11 - INDEMNITY 11.01 INDEMNITY To the maximum extent permitted by law, the Contractor shall fully indemnify, hold harmless, protect, and defend the City, its officers, employees, agents, representatives and their successors and assigns (“Indemnitees”) from and against any and all demands, liability, loss, suit, claim, action, cause of action, damage, cost, judgment, settlement, decree, arbitration award, stop notice, penalty, loss of revenue, and expense (including any fees of accountants, attorneys, experts or other professionals, and costs of investigation, mediation, arbitration, litigation and appeal), in law or in equity, of every kind and nature whatsoever, arising out of or in connection with, resulting from or related to, or claimed to be arising out of the Work performed by Contractor, or any of its officers, agents, employees, Subcontractors, Sub-Subcontractors, design consultants or any person for whose acts any of them may be liable, regardless of whether such claim, suit or demand is caused, or alleged to be caused, in part, by an Indemnitee, including but not limited to: A. Bodily injury, emotional injury, sickness or disease, or death to any persons; B. Infringement of any patent rights, licenses, copyrights or intellectual property which may be brought against the Contractor or City arising out of Contractor’s Work, for which the Contractor is responsible; C. Stop notices and claims for labor performed or materials used or furnished to be used in the Work, including all incidental or consequential damages resulting to City from such stop notices and claims; D. Failure of Contractor or its Subcontractors to comply with the provisions for insurance; E. Failure to comply with any Governmental Approval or similar authorization or order; F. Misrepresentation, misstatement, or omission with respect to any statement made in or any document furnished by the Contractor in connection therewith; G. Breach of any duty, obligation, or requirement under the Contract Documents; H. Failure to provide notice to any Party as required under the Contract Documents; I. Failure to protect the property of any utility provider or adjacent property owner; or J. Failure to make payment of all employee benefits. This indemnity provision is effective regardless of any prior, concurrent, or subsequent active or passive negligence by Indemnitees, except that, to the limited extent mandated by California Civil Code Section 2782, the Contractor shall not be responsible for liabilities which arise from the sole negligence or willful misconduct of Indemnitees or arise from the active negligence of City. 11.02 ENFORCEMENT Contractor’s obligations under this Article extend to claims occurring after termination of the Contractor’s performance of the Contract or Final Payment to Contractor. The obligations apply regardless of any actual or alleged negligent act or omission of Indemnitees. Contractor, however, shall not be obligated under this Agreement to indemnify an Indemnitee for claims arising from the sole active negligence or willful misconduct of the Indemnitee or independent contractors who are directly responsible to Indemnitees. Contractor’s obligations under this Article are in addition to any other rights or remedies which the Indemnitees may have under the law Page 78 of 117 or under the Contract Documents. In the event of any claim, suit or demand made against any Indemnitees, the City may in its sole discretion reserve, retain or apply any monies due to the Contractor under the Contract for the purpose of resolving such claims; provided, however, that the City may release such funds if the Contractor provides the City with reasonable assurance of protection of the City’s interests. The City shall in its sole discretion determine whether such assurances are reasonable. 11.03 NO LIMITATIONS Contractor’s indemnification and defense obligations set forth in this Article are separate and independent from the insurance provisions set forth in Article 12 herein; and do not limit, in any way, the applicability, scope, or obligations set forth in those insurance provisions. In claims, suits, or demands against any Indemnitee by an employee of the Contractor, a Subcontractor, anyone directly or indirectly employed by them, or anyone for whose acts they may be liable, the Contractor’s indemnification and defense obligations shall not be limited by a limitation on amount or type of damages, compensation, or benefits payable by or for the Contractor or a Subcontractor under workers’ compensation acts, disability benefits acts, or other employee benefits acts. [END OF ARTICLE] Page 79 of 117 ARTICLE 12 – INSURANCE 12.01 CONDITION TO COMMENCEMENT Contractor shall not commence Work under this Contract until Contractor has obtained all insurance required hereunder from a company or companies acceptable to City, nor shall the Contractor allow any Subcontractor to commence Work on a subcontract until all insurance required of said Subcontractor has been obtained. Proof of insurance including insurance certificates and endorsements as set forth in Exhibit A4 must be submitted by the Contractor prior to the City’s execution of the Contract. 12.02 MINIMUM COVERAGE AND LIMITS Contractor shall maintain the insurance coverage as set forth in Exhibit A4 throughout the term of the Contract. 12.03 CONDITIONS REGARDING INSURANCE COVERAGE AND LIMITS City and Contractor agree as follows: A. All insurance coverage and limits provided pursuant to the Contract Documents shall apply to the full extent of the policies involved, available or applicable. Nothing contained in the Contract Documents or any other agreement relating to City or its operations limits the application of such insurance coverage. B. None of the policies required by this Contract shall be in compliance with these requirements if they include any limiting endorsement that has not been first submitted to City and approved in writing by the City’s Risk Manager. 12.04 INSURANCE OBLIGATION IS SEPARATE FROM INDEMNITY OBLIGATION This Agreement’s insurance provisions: A. Are separate and independent from the indemnification and defense provisions in Article 12 of the Agreement; and B. Do not limit, in any way, the applicability, scope, or obligations of the indemnification and defense provisions in Article 12 of the Agreement. [END OF ARTICLE] Page 80 of 117 ARTICLE 13 – BONDS 13.01 REQUIRED BONDS A. Contractor shall furnish the following bonds: 1. APerformance Bond in an amount equal to one hundred percent (100%) of the total Contract price in the form shown in Exhibit "A1" attached hereto. 2. A Payment Bond (Labor and Material) in an amount equal to one hundred percent (100%) of the total Contract price in the form shown in Exhibit "A2" attached hereto. 3. A Maintenance Bond in an amount equal to ten percent (10%) of the total Contract price in the form shown in Exhibit "A3" attached hereto. 13.02 POWER OF ATTORNEY All bonds shall be accompanied by a power of attorney from the surety company authorizing the person executing the bond to sign on behalf of the company. If the bonds are executed outside the State of California, all copies of the bonds must be countersigned by a California representative of the surety. The signature of the person executing the bond on behalf of Surety shall be acknowledged by a Notary Public as the signature of the person designated in the power of attorney. 13.03 APPROVED SURETY All bonds must be issued by a California admitted surety insurer with the minimum A.M Best Company Financial strength rating of “A: VII”, or better. Bonds issued by a California admitted surety not listed on Treasury Circular 570 will be deemed accepted unless specifically rejected by the City. Bonds issued from admitted surety insurers not listed in Treasury Circular 570 must be accompanied by all documents enumerated in California Code of Civil Procedure Section 995.660. All such bonds must be accompanied by a power of attorney from the surety company authorizing the person executing the bond to sign on behalf of the company. If the bonds are executed outside the State of California, all copies of the bonds must be countersigned by a California representative of the surety. The signature of the person executing the bond on behalf of Surety must be acknowledged by a Notary Public as the signature of the person designated in the power of attorney. 13.04 REQUIRED PROVISIONS Every bond must display the surety’s bond number and incorporate the Contract for construction of the Work by reference. The terms of the bonds shall provide that the surety agrees that no change, extension of time, alteration, or modification of the Contract Documents or the Work to be performed thereunder shall in any way affect its obligations and shall waive notice of any such change, extension of time, alteration, or modification of the Contract Documents. 13.05 NEW OR ADDITIONAL SURETIES If, during the continuance of the Contract, any of the sureties, in the opinion of the City, are or become non- responsible or otherwise unacceptable to City, City may require other new or additional sureties, which the Contractor shall furnish to the satisfaction of City within ten (10) days after notice, and in default thereof the Contract may be suspended and the materials may be purchased or the Work completed as provided in Article 5 herein. Page 81 of 117 13.06 WAIVER OF MODIFICATIONS AND ALTERATIONS No modifications or alterations made in the Work to be performed under the Contract or the time of performance shall operate to release any surety from liability on any bond or bonds required to be given herein. Notice of such events shall be waived by the surety. 13.07 APPROVAL OF BONDS The Contract will not be executed by City nor the Notice to Proceed issued until the required bonds have been received and approved by City. City's decision as to the acceptability of all sureties and bonds is final. No substitution of the form of the documents will be permitted without the prior written consent of City. [END OF ARTICLE] Page 82 of 117 ARTICLE 14 - LABOR PROVISIONS 14.01 WORKING HOURS A. Work or activity of any kind shall be limited to the hours from 7:00 a.m. to 7:00 p.m. No construction noise shall be permitted between the hours of 7:00 p.m. and 7:00 a.m. of the next day. B. Work in excess of eight (8) hours per day, on Saturdays, Sundays, or on City holidays requires prior consent of the Director and is subject to Cost of Overtime Construction Inspection. C. Night, Sunday and Holiday Work. No Work shall be performed at night, Sunday, or the ten (10) legal holidays to wit: New Year’s Day, Martin Luther King, Jr. Day, President’s Day, Cesar Chavez Day, Memorial Day, Independence Day, Labor Day, Indigenous People’s Day, Veteran’s Day, Thanksgiving Day, Christmas Eve, Christmas Day and New Year’s Eve, except Work pertaining to the public safety or with the permission of the Director, and accordance with such regulations as he/she shall furnish in writing. Before performing any Work at said times, except Work pertaining to the public safety, the Contractor shall give written notice to the Director so that proper inspection may be provided. “Night” as used in this paragraph shall be deemed to include the hours from 7:00 P.M. to 7:00 A.M. of the next succeeding day. 14.02 COST OF OVERTIME CONSTRUCTION SERVICES AND INSPECTIONS A. Overtime construction Work performed at the option of, or for the convenience of, the Contractor will be inspected by the City at the expense of the Contractor. For any such overtime beyond the regular 8-hour day and for any time worked on Saturday, Sunday, or holidays the charges will be determined by the City, and submitted to the Contractor for payment. B. Equipment, materials, or services provided by the City, in connection with Contractor-initiated overtime construction Work described in Paragraph 14.02(A), will also be at the expense of the Contractor. The charges will be determined by the City, and submitted to the Contractor for payment. C. There will be no charges to the Contractor for the inspection of overtime Work ordered by the Director or required by the Contract Documents. 14.03 COMPLIANCE WITH STATE LABOR CODE A. Contractor shall comply with the provisions of the Labor Code of the State of California and any amendments thereof. 1. The time of service of any worker employed upon the Work shall be limited and restricted to eight (8) hours during any one-calendar day, and 40 hours during any one-calendar week. 2. Work performed by employees of the Contractor in excess of eight (8) hours per day, and 40 hours during any one calendar week, shall be permitted upon compensation for all hours worked in excess of eight (8) hours per day at not less than one and one-half times the basic rate of pay. 3. The Contractor and every Subcontractor shall keep an accurate record showing the name of and the actual hours worked each calendar day and each calendar week by each worker employed by him/her in connection with the Work; the record shall be kept open at all reasonable hours to the inspection of the City andto the Division of Labor Standards Enforcement of the State of California. Page 83 of 117 4. In the event City deems Contractor is in violation of this Paragraph 14.03, the Contractor shall, as a penalty, forfeit Fifty Dollars ($50.00) for each worker employed in the execution of the Contract by the Contractor or by any Subcontractor for each calendar day for which the employee was underpaid in addition to an amount sufficient to recover underpaid wages. For each subsequent violation, a (one hundred dollar) $100 penalty shall apply for each underpaid employee for each pay period for which the employee was underpaid in addition to an amount sufficient to cover underpaid wages. This subparagraph is effective to the extent it does not directly conflict with the overtime penalty provision of California Labor Code Section 558. In the event of such conflict, the California Labor Code governs over this Paragraph 14.03(A)(4). 14.04 WAGE RATES A. Prevailing Wages 1. Contractor shall comply with the general prevailing rates of per diem wages and the general prevailing rates for holiday and overtime Work in the locality in which the Work is to be performed, for each craft, classification, or type of worker needed to execute the Contract. The Director of the Department of Industrial Relations of the State of California (pursuant to California Labor Code) and the United States Secretary of Labor (pursuant to the Davis-Bacon Act) have determined the general prevailing rates of wages in the locality in which the Work is to be performed. The rates are available online at www.dir.ca.gov/DLSR/PWD/. To the extent that there are any differences in the federal and state prevailing wage rates for similar classifications of labor, the Contractor and its Subcontractors shall pay the highest wage rate. 2. The Contractor shall post a copy of the general prevailing rate of per diem wages at the job site. 3. The Contractor and any Subcontractor under him/her shall pay not less than the specified prevailing rate of wages to all workers employed in the execution of the Contract. 4. The holidays upon which such rates shall be paid shall be all holidays recognized in the collective bargaining Contract applicable to the particular craft, classification, or type of worker employed on the project. 5. The Contractor shall, as a penalty to the State or the City, forfeit not more than Fifty Dollars ($50) for each calendar day, or portion thereof, for each worker paid less than the prevailing rates for the Work or craft in which the worker is employed under the Contract by the Contractor or by any Subcontractor under him. The difference between the prevailing wage rates and the amount paid to each worker for each calendar day or portion thereof for which such worker was paid less than the stipulated prevailing wage rate shall be paid to such worker by the Contractor. 6. The specified wage rates are minimum rates only and the City will not consider and shall not be liable for any claims for additional compensation made by the Contractor because of payment by him/her of any wage rate in excess of the general prevailing rates. All disputes in regard to the payment of wages in excess of those specified herein shall be adjusted by the Contractor at his/her own expense. B. Payroll Records 1. Pursuant to California Labor Code Section 1776, the Contractor and each Subcontractor shall keep an accurate payroll record, showing the name, address, social security number, Work classification, straight time and overtime hours worked each day and week, and the actual per Page 84 of 117 diem wages paid to each journeyman, apprentice, worker or other employee employed in connection with the Work. The payroll records shall be certified and shall be available for inspection. 2. The Contractor shall inform the City of the location of the payroll records, including the street address, city and county, and shall, within five (5) Working Days, provide a notice of change in location and address. 3. Upon request by the Director, the Contractor shall provide a copy of the certified payroll records along with a statement of compliance. 14.05 APPRENTICESHIP STANDARDS A. Compliance with California Labor Code Section 1777.5 requires all public works contractors and subcontractors to: 1. Prior to commencing work on a public works contract, submit Contract Award information to the applicable joint apprenticeship committee, including an estimate of the journeyman hours to be performed under the Contract, the number of apprentices to be employed, and the approximate dates the apprentices will be employed. Use Form DAS-140 from the State Department of Industrial Relations. The City reserves the right to require Contractor and Subcontractors to submit a copy of said forms to the City. 2. Employ apprentices for the public work at a ratio of no less than one (1) hour or apprentice work for every five (5) hours or labor performed by a journeyman. To request dispatch of apprentices, use Form DAS-142 from the State Department of Industrial Relations. The City reserves the right to require Contractor and Subcontractors to submit a copy of said forms to the City. 3. Pay the apprentice rate on public works projects only to those apprentices who are registered, as defined in Labor Code Section 3077. 4. Contribute to the training fund in the amount identified in the Prevailing Wage Rate publication for journeyman and apprentices. Contractors who choose not to contribute to the local training trust fund must make their contributions to the California Apprenticeship Council, P.O. Box 420603, San Francisco, CA 94142. B. Failure to comply with the provisions of California Labor Code Section 1777.5 may result in the loss of the right to bid or perform work on all public works projects for a period of one to three years and the imposition of a civil penalty of One Hundred Dollars ($100.00) for each calendar day of noncompliance for the first violation and up to Three Hundred Dollars ($300.00) for each calendar day of noncompliance for a second or subsequent violation. Contractor should make a separate copy of this material for each of his/her Subcontractors. C. Payroll Records. The Contractor and each Subcontractor shall keep an accurate payroll record, showing the name, address, social security number, work classification, straight time and overtime hours worked each day and week, and the actual per diem wages paid to each journeyman apprentice, worker or other employee employed in connection with the work. The payroll records shall be certified and shall be submitted to the Project Manager every two weeks. Page 85 of 117 D. Statement of Employer Fringe Benefit Payments. Within five (5) calendar days of signing the Contract or Subcontract, as applicable, the Statement of Employer Payments (DLSE Form PW 26 from the State Department of Industrial Relations) shall be completed for each Contractor and Subcontractor of any tier who pays benefits to a third party trust, plan or fund for health and welfare benefits, vacation funds or makes pension contributions. The form must contain, for each worker classification, the fund, plan or trust name, address, administrator, the amount per hour contributed and the frequency of contributions. Training fund contributions shall also be reported in this form. City reserves the right to require Contractors and Subcontractors to submit a copy of said forms to the City. 14.06 EMPLOYMENT OF APPRENTICES A. In the performance of this Contract, the Contractor and any Subcontractor shall comply with the provisions concerning the employment of apprentices in the Labor Code of the State of California and any amendments thereof. B. In the event the Contractor or any Subcontractor willfully fails to comply with the aforesaid provisions of the Labor Code, such Contractor or Subcontractor shall be subject to the penalties for noncompliance in the Labor Code of the State of California and any amendments thereof. 14.07 REGISTRATION WITH THE STATE DEPARTMENT OF INDUSTRIAL RELATIONS In the performance of this Contract, Contractor and/or any Subcontractor must be currently registered and qualified (including payment of any required fee) with the State Department of Industrial Relations pursuant to Labor Code section 1725.5. This project is subject to compliance monitoring and enforcement by the State Department of Industrial Relations. 14.08 CHARACTER OF WORKERS The Contractor shall not allow his/her agents or employees, Subcontractors, or any agent or employee thereof, to trespass on premises or lands in the vicinity of the Work. Only skilled foremen and workers shall be employed on Work requiring special qualifications, and when required by the Director, the Contractor shall discharge any person who commits trespass, or in the opinion of the Director, acts in a disorderly, dangerous, insubordinate, incompetent, or otherwise objectionable manner. Any employee being intoxicated or bringing or having intoxicating liquors or controlled substances on the Work shall be discharged. Such discharge shall not be the basis of any claim for compensation of damages against the City or any of its officers, agents, and employees. 14.09 NO SMOKING – STATE LABOR CODE SECTION 6404.5 The Contractor and its agents, employees, Subcontractors, representatives, and any person under Contractor’s control, are prohibited from smoking in— or within a 20-foot distance from— the Site, which is a "place of employment" under California Labor Code § 6404.5. [END OF ARTICLE] Page 86 of 117 ARTICLE 15 - DISPUTE RESOLUTION 15.01 SUBMISSION OF CLAIMS A. By Contractor Contractor’s right to commence the Claims Dispute Resolution Process shall arise upon the Director’s written response denying all or part of a Claim. Contractor shall submit a written Statement of Dispute to the Director within seven (7) Days after the Director rejects all or a portion of Contractor’s Claim. Contractor’s Statement of Dispute shall be signed under penalty of perjury and shall state with specificity the events or circumstances giving rise to the Claim, the dates of their occurrence and the effect, if any, on the compensation due or performance obligations of Contractor under the Construction Contract. Such Statement of Dispute shall include adequate supporting data to substantiate the disputed Claim. Adequate supporting data for a Claim relating to the adjustment of the Contractor’s obligations relative to time of performance shall include a detailed, event-by-event description of the impact of each delay on Contractor’s time for performance. Adequate supporting data to a Statement of Dispute submitted by Contractor involving Contractor’s compensation shall include a detailed cost breakdown and supporting cost data in such form and including such detailed information and other supporting data as required to demonstrate the grounds for, and precise amount of, the Claim. B. By City City’s right to commence the Claims Dispute Resolution Process shall arise at any time following the City’s actual discovery of the circumstances giving rise to the Claim. Nothing contained herein shall preclude City from asserting Claims in response to a Claim asserted by Contractor. A Statement of Dispute submitted by City shall state the events or circumstances giving rise to the Claim, the dates of their occurrence and the damages or other relief claimed by City as a result of such events. C. Claims Defined The term “claims” as used herein shall be as defined in California Public Contract Code § 20104(b)(2). 15.02 CLAIMS DISPUTE RESOLUTION PROCESS The parties shall utilize each of the following steps in the Claims Dispute Resolution Process in the sequence they appear below. Each party shall participate fully and in good faith in each step in the Claims Dispute Resolution Process, which good faith effort shall be a condition precedent to the right of each party to proceed to the next step in the Claims Dispute Resolution Process. A. Direct Negotiations Designated representatives of City and Contractor shall meet as soon as possible (but not later than ten (10) Days after receipt of the Statement of Dispute) in a good faith effort to negotiate a resolution to the Claim. Each party shall be represented in such negotiations by an authorized representative with full knowledge of the details of the Claim or defenses being asserted by such party, and with full authority to resolve such Claim then and there, subject only to City’s right and obligation to obtain City Council [or other City official] approval of any agreed settlement or resolution. In the Claim involves the assertion of a right or claim by a Subcontractor against Contractor that is in turn being asserted by Contractor against City, then such Subcontractor shall also have a representative attend such negotiations, with the same authority and knowledge as just described. Upon completion of the meeting, if the Claim is not resolved, the parties may either continue the negotiations or either party Page 87 of 117 may declare negotiations ended. All discussions that occur during such negotiations and all documents prepared solely for the purpose of such negotiations shall be confidential and privileged pursuant to California Evidence Code Sections 1119 and 1152. B. Deferral of Claims Following the completion of the negotiations required by Paragraph 15.02-A., all unresolved Claims, except those that do not involve parties other than the Contractor and City, shall be deferred pending Final Completion of the Work, subject to City’s right, in its sole and absolute discretion, to require that the claims Dispute Resolution Process proceed prior to Final Completion. In the event that City does not elect to proceed with the Claims Dispute Resolution Process prior to Final Completion of the Work, all Claims that have been deferred until such Final Completion shall be consolidated within a reasonable time after such Final Completion and thereafter pursued to resolution pursuant to the Claims Dispute Resolution Process. Nothing contained in this Article 15 shall be interpreted as limiting the parties’ rights to continue informal negotiations of Claims that have been deferred until such Final Completion; provided, however, that such informal negotiations shall not be interpreted as altering the provisions of this Article 15 deferring final determination and resolution of unresolved Claims until after Final Completion of the Work. C. Legal Proceedings If the Claim is not resolved by direct negotiations then the party wishing to further pursue resolution or determination of the Claim shall submit the Claim for determination by commencing legal proceedings in a court of competent jurisdiction. 15.03 NO WAIVER Participation in the Claims Dispute Resolution Process shall not constitute a waiver, release or compromise of any defense of either party, including, without limitation, any defense based on the assertion that the rights of Contractor that are the basis of a Claim were previously waived by Contractor due to failure to comply with the Contract Documents, including, without limitation, Contractor’s failure to comply with any time periods for providing notices or for submission or supporting documentation of Claims. [END OF ARTICLE] Page 88 of 117 ARTICLE 16 - ACCOUNTING RECORDS 16.01 MAINTENANCE OF RECORDS Contractor shall keep, and shall include in its contracts with its Subcontractors, provisions requiring its Subcontractors to keep full and detailed books and records in accordance with the requirements of the Contract Documents, including the following: all information, materials and data of every kind and character (hard copy, as well as computer readable data if it exists), that have any bearing on or pertain to any matters, rights, dutiesor obligations relating to the Project or the performance of the Work, including, without limitation, agreements, purchase orders, leases, contracts, commitments, arrangements, notes, change orders, change order requests, estimates, field orders, schedules, diaries, logs, reports, shop drawings, samples, exemplars, Drawings, Specifications, invoices, delivery tickets, receipts, vouchers, cancelled checks, memoranda; accounting records; job cost reports; job cost files (including complete documentation covering negotiated settlements); backcharge; general ledgers; documentation of cash and trade discounts earned; insurance rebates and dividends, and other documents relating in way to Claims or Change Orders, Construction Change Directives, Work Directives, or other claims for payment related to the Project asserted by Contractor or any Subcontractor (“Accounting Records”). Contractor shall exercise such controls as may be necessary for proper financial management of the Work. Such accounting and control systems shall comply with prevailing custom and practice for similar projects, be satisfactory to City and shall include preservation of such records for a period of five (5) years after approval of the Notice of Completion and Acceptance by City, or for such longer period as may be required by applicable laws. 16.02 ACCESS TO RECORDS Contractor shall allow, and shall include in its contracts with its Subcontractors provisions requiring its Subcontractors to allow, City and its authorized representative(s), auditors, attorneys and accountants, upon twenty-four (24) hours notice to Contractor, full access to inspect and copy all books and records relating to the Project that Contractor is required to maintain pursuant to Paragraph 16.01, above. 16.03 CONTRACTOR NONCOMPLIANCE, WITHHOLDING Contractor's compliance with Paragraphs 16.01 and 16.02, above, shall be a condition precedent to maintenance of any legal action or arbitration by Contractor against City. In addition to and without limitation upon City'sother rights and remedies for breach, including any other provisions for withholding set forth in the Contract Documents, City shall have the right, exercised in its sole discretion, to withhold from any payment to Contractor due under a current Application for Payment an additional sum of up to ten percent (10%) of the total amount set forth in such Application for Payment, until Contractor and its Subcontractors have complied with any outstanding and unsatisfied request by City under this Article 16. Upon such compliance with this Article 16, any additional monies withheld pursuant to this Paragraph 16.03 shall be released to Contractor. 16.04 SPECIFIC ENFORCEMENT BY CITY Contractor agrees that any failure by Contractor or any Subcontractor to provide access to its books and records as required by this Article 16 shall be specifically enforceable, by issuance of a preliminary and/or permanent mandatory injunction by a court of competent jurisdiction based on affidavits submitted to such court and without the necessity of oral testimony, to compel Contractor to permit access, inspection, audits and/or reproduction of such books and records or to require delivery of such books and records to City for inspection, audit and/or reproduction. [END OF ARTICLE] Page 89 of 117 ARTICLE 17-MISCELLANEOUS PROVISIONS 17.01 COMPLIANCE WITH APPLICABLE LAWS A. Notices, Compliance Contractor shall give all notices required by governmental authorities and comply with all applicable laws and lawful orders of governmental authorities, including but not limited to the provisions of the California Code of Regulations applicable to contractors performing construction and all laws, ordinances, rules, regulations and lawful orders relating to safety, prevailing wage and equal employment opportunities. B. Taxes, Employee Benefits Contractor shall pay at its own expense, at no cost to the City and without adjustment to the Contract Sum, all local, state and federal taxes, including, without limitation all sales, consumer, business license, use and similar taxes on materials, labor or other items furnished for the Work or portions thereof provided by Contractor or Subcontractors, all taxes arising out of its operations under the Contract Documents and all benefits, insurance, taxes and contributions for social security and unemployment insurance which are measured by wages, salaries or other remuneration paid to Contractor's employees. If under federal excise tax law any transaction hereunder constitutes a sale on which a federal excise tax is imposed and the sale is exempt from such excise tax because it is a sale to meat for its exclusive use, then City, upon request, will execute documents necessary to show that is a political subdivision of the State for the purposes of such exemption and that the sale is for the exclusive use of the City, in which case no excise tax for such materials shall be included in the Bid or Contract Sum. C. Notice of Violations Contractor shall immediately notify the City and Director in writing of any instruction received from the City, Director, Architect or other person or entity that, if implemented, would cause a violation of any applicable law or lawful order of a governmental authority. If Contractor fails to provide such notice, then Director shall be entitled to assume that such instruction is in compliance with applicablelaws and lawful orders of governmental authorities. If Contractor observes that any portion of the Drawings and Specifications or Work are at variance with applicable laws or lawful orders of governmental authorities, or should Contractor become aware of conditions not covered by the Contract Documents which will result in Work being at variance therewith, Contractor shall promptly notify Director in writing. If, without such notice to Director, Contractor or any Subcontractor performs any Work which it knew, or through the exercise of reasonable care should have known, was contrary to lawful orders of governmental authorities or applicable laws, then Contractor shall bear all resulting losses at its own expense, at no cost to City and without adjustment to the Contract Sum. 17.02 OWNERSHIP OF DESIGN DOCUMENTS A. Property of City All Design Documents, Contract Documents and Submittals (including, without limitation, all copies thereof) and all designs and building designs depicted therein are and shall remain the sole and exclusive property of the City and the City shall solely and exclusively hold all copyrights thereto. Without derogation the City’s rights under this Paragraph, the Contractor and Subcontractors are Page 90 of 117 granted a limited, non-exclusive license, revocable at will of City, to use and reproduce applicable portions of the Contract Documents and Submittals as appropriate to and for use in the execution of the Work and for no other purpose. B. Documents on Site Contractor shall keep on the Project site, at all times and for use by City, Director, Inspectors of Record and City’s Consultants, a complete set of the Contract Documents that have been approved by applicable Governmental Authorities. C. Delivery to City All Design Documents, Contract Documents and Submittals in the possession of Contractor or Subcontractors shall be returned to the City upon the earlier of Final Completion or termination of the Construction Contract; provided, however, that Contractor and each Subcontractor shall have the right to retain one (1) copy of the Contract Documents and Submittals for its permanent records D. Subcontractors Contractor shall take all necessary steps to assure that a provision is included in all subcontracts with Subcontractors, of every tier, who perform Work on the Project establishing, protecting and preserving the, City’s rights set forth in this Paragraph. 17.03 AMENDMENTS The Contract Documents may be amended only by a written instrument duly executed by the parties or their respective successors or assigns. 17.04 WAIVER Either party's waiver of any breach or failure to enforce any of the terms, covenants, conditions or other provisions of the Contract Documents at any time shall not in any way limit or waive that party's right thereafter to enforce or compel strict compliance with every term, covenant, condition or other provision, any course of dealing or custom of the trade notwithstanding. Furthermore, if the parties make and implement any interpretation of the Contract Documents without documenting such interpretation by an instrument in writing signed by both parties, such interpretation and implementation thereof will not be binding in the event of any future disputes. 17.05 INDEPENDENT CONTRACTOR Contractor is an independent contractor, and nothing contained in the Contract Documents shall be construed as constituting any relationship with City other than that of Project owner and independent contractor. In no event shall the relationship between City and Contractor be construed as creating any relationship whatsoever between City and Contractor's employees. Neither Contractor nor any of its employees is or shall be deemed to be an employee of City. Except as otherwise specified in the Contract Documents, Contractor has sole authority and responsibility to employ, discharge and otherwise control its employees and has complete and sole responsibility as a principal for its agents, for all Subcontractors and for all other Persons that Contractor or any Subcontractor hires to perform or assist in performing the Work. Page 91 of 117 17.06 SUCCESSORS AND ASSIGNS The Contract Documents shall be binding upon and inure to the benefit of City and Contractor and their permitted successors, assigns and legal representatives. A. City may assign all or part of its right, title and interest in and to any Contract Documents, including rights with respect to the Payment and Performance Bonds, to (a) any other governmental person as permitted by governmental rules, provided that the successor or assignee has assumed all of City's obligations, duties and liabilities under the Contract Document then in effect; and (b) any other Person with the prior written approval of Contractor. B. Contractor may collaterally assign its rights to receive payment under the Contract Documents. Contractor may not delegate any of its duties hereunder, except to Subcontractors as expressly otherwise permitted in the Contract Documents. Contractor's assignment or delegation of any of its Work under the Contract Documents shall be ineffective to relieve Contractor of its responsibility for the Work assigned or delegated, unless City, in its sole discretion, has approved such relief from responsibility. Any assignment of money shall be subject to all proper set-offs and withholdings in favor of City and to all deductions provided for in the Contract. All money withheld, whether assigned or not, shall be subject to being used by City for completion of the Work, should Contractor be in default. C. Except for the limited circumstances set forth in Paragraph 17.06-B, above, Contractor may not, without the prior written consent of City in its sole discretion, voluntarily or involuntarily assign, convey, transfer, pledge, mortgage or otherwise encumber its rights or interests under the Contract Documents. No partner, joint venturer, member or shareholder of Contractor may assign, convey, transfer, pledge, mortgage or otherwise encumber its ownership interest in Contractor without the prior written consent of City, in City’s sole discretion. 17.07 SURVIVAL Contractor’s representations and warranties, the dispute resolution provisions contained in Article 15, and all other provisions which by their inherent character should survive termination of the Contract and/or Final Acceptance, shall survive the termination of the Contract and the Final Acceptance Date. 17.08 LIMITATION ON THIRD PARTY BENEFICIARIES It is not intended by any of the provisions of the Contract Documents to create any third party beneficiary hereunder or to authorize anyone not a party hereto to maintain a suit for personal injury or property damage pursuant to the terms or provisions hereof, except to the extent that specific provisions (such as the warranty and indemnity provisions) identify third parties and state that they are entitled to benefits hereunder. The duties, obligations and responsibilities of the parties to the Contract Documents with respect to such third parties shall remain as imposed by law. The Contract Documents shall not be construed to create a contractual relationship of any kind between City and a Subcontractor or any other Person except Contractor. 17.09 PERSONAL LIABILITY OF CITY EMPLOYEES City’s authorized representatives are acting solely as agents and representatives of City when carrying out the provisions of or exercising the power or authority granted to them under the Contract. They shall not be liable either personally or as employees of City for actions in their ordinary course of employment. Page 92 of 117 No agent, consultant, Council member, officer or authorized employee of City, shall be personally responsible for any liability arising under the Contract. 17.10 NO ESTOPPEL City shall not, nor shall any officer thereof, be precluded or estopped by any measurement, estimate or certificate made or given by the City representative or other officer, agent, or employee of City under any provisions of the Contract from at any time (either before or after the final completion and acceptance of the Work and payment therefor) pursuant to any such measurement, estimate or certificate showing the true and correct amount and character of the work done, and materials furnished by Contractor or any person under the Contract or from showing at any time that any such measurement, estimate or certificate is untrue and incorrect, or improperly made in any particular, or that the work and materials, or any part thereof, do not in fact conform to the Contract Documents. Notwithstanding any such measurement, estimate or certificate, or payment made in accordance therewith, City shall not be precluded or estopped from recovering from Contractor and its Sureties such damages as City may sustain by reason of Contractor’s failure to comply or to have complied with the Contract Documents. 17.11 GOVERNING LAW The laws of the State of California govern the construction and interpretation of the Contract Documents, without regard to conflict of law principles. Unless the Contract Documents provide otherwise, any reference to laws, ordinances, rules, or regulations include their later amendment, modifications, and successor legislation. If Contractor or City brings a lawsuit to enforce or interpret one or more provisions of the Contract Documents, jurisdiction is in the Superior Court of the County of Los Angeles, California, or where otherwise appropriate, in the United States District Court, Central District of California. Contractor and City acknowledge that the Contract Documents were negotiated, entered into, and executed—and the Work was performed—in the City of Vernon, California. 17.12 FURTHER ASSURANCES Contractor shall promptly execute and deliver to City all such instruments and other documents and assurances as are reasonably requested by City to further evidence the obligations of Contractor hereunder, including assurances regarding assignments of Subcontractors contained herein. 17.13 SEVERABILITY If any clause, provision, section, paragraph or part of the Contract is ruled invalid by a court having proper jurisdiction, then the parties shall: (a) promptly meet and negotiate a substitute for such clause, provision, section, paragraph or part, which shall, to the greatest extent legally permissible, effect the original intent of the parties, including an equitable adjustment to the Contract Price to account for any change in the Work resulting from such invalidated portion; and (b) if necessary or desirable, apply to the court or other decision maker (as applicable) which declared such invalidity for an interpretation of the invalidated portion to guide the negotiations. The invalidity or unenforceability of any such clause, provision, section, paragraph or part shall not affect the validity or enforceability of the balance of the Contract, which shall be construed and enforced as if the Contract did not contain such invalid or unenforceable clause, provision, section, paragraph or part. Page 93 of 117 17.14 HEADINGS The captions of the sections of the Contract are for convenience only and shall not be deemed part of the Contract or considered in construing the Contract. 17.15 ENTIRE AGREEMENT The Contract Documents contain the entire understanding of the parties with respect to the subject matter hereof and supersede all prior agreements, understandings, statements, representations and negotiations between the parties with respect to its subject matter. 17.16 COUNTERPARTS This instrument may be executed in two or more counterparts, each of which shall be deemed an original, but all of which together shall constitute one and the same instrument. [END OF ARTICLE] Page 94 of 117 EXHIBIT A1 Bond No.: Premium Amount: $ Bond’s Effective Date: PERFORMANCE BOND RECITALS: 1. The City of Vernon, California (“City”), has awarded to (Name, address, and telephone of Contractor) ________________________________________________________________________________ (“Principal”), a Contact (the “Contract) for the Work described as follows: Specification No. : in Vernon, CA. 2. Principal is required under the terms of the Contract and all contract documents referenced in it (“Contract Documents”) to furnish a bond guaranteeing Principal’s faithful performance of the Work. 3. The Contract and Contract Documents, including all their amendments and supplements, are incorporated into this Bond and made a part of it by this reference. OBLIGATION: THEREFORE, for value received, We, Principal and ______________________________________________________________________________________________ (Name, address, and telephone of Surety) ______________________________________________________________________________________ (“Surety”), a duly admitted surety insurer under California’s laws, agree as follows: By this Bond, We jointly and severally obligate and bind ourselves, and our respective heirs, executors, administrators, successors, and assigns to pay City the penal sum of Dollars ($ ) (“the Bonded Sum”), this amount comprising not less than the total Contract Sum, in lawful money of the United States of America. The Licensed Agent for Surety is: (Name, address, and telephone) Registered Agent’s California Department of Insurance License No. . THE CONDITION OF THIS BOND’S OBLIGATION IS THAT, if Principal promptly and faithfully performs the undertakings, terms, covenants, conditions, and agreements in the Contract and Contract Documents (including all their amendments and supplements), all within the time and in the manner that those documents specify, then this obligation becomes null and void. Otherwise, this Bond remains in full force and effect, and the following terms and conditions apply to this Bond: 1. This Bond specifically guarantees Principal’s performance of each obligation and all obligations under the Contract and Contract Documents, as they may be amended and supplemented including, but not limited to, Principal’s liability for liquidated damages, Warranties, Guarantees, Correction, and Maintenance obligations as specified in the Contract and Contract Documents except that Surety’s total obligation, as described here, will not exceed the Bonded Sum. Page 95 of 117 2. For those obligations of Principal that survive Final Completion of the Work described in the Contract and Contract Documents, the guarantees in this Bond also survive Final Completion of the Work. 3. When City declares that Principal is in default under the Contract, or Contract Documents, or both, Surety shall promptly: (a) remedy the default; (b) complete the Project according to the Contract Documents’ terms and conditions then in effect; or (c) using a procurement methodology approved by City, select a contractor or contractors acceptable to City to complete all of the Work, and arrange for a contract between the contractor(s) and City. Surety shall make available, as the Work progresses, sufficient funds to pay the cost of completion less the balance of the Contract Sum, and to pay and perform all obligations of Principal under the Contract and Contract Documents including other costs and damages for which Surety is liable under this Bond except that Surety’s total obligation, as described here, will not exceed the Bonded Sum. 4. An alteration, modification, change, addition, deletion, omission, agreement, or supplement to the Contract, Contract Documents, or the nature of the Work performed under the Contract or Contract Documents including, without limitation, an extension of time for performance does not, in any way, affect Surety’s obligations under this Bond. Surety waives any notice of alteration, modification, change, addition, deletion, omission, agreement, supplement, or extension of time. 5. Surety’s obligations under this Bond are separate, independent from, and not contingent upon any other surety’s guaranteeing Principal’s faithful performance of the Work. 6. No right of action accrues on this Bond to any entity other than City or its successors and assigns. 7. If an action at law or in equity is necessary to enforce or interpret this Bond’s terms, Surety must pay in addition to the Bonded Sum City’s reasonable attorneys’ fees and litigation costs, in an amount the court fixes. 8. Surety shall mail City written notice at least 30 days before: (a) the effective date on which the Surety will cancel, terminate, or withdraw from this Bond; or (b) this Bond becomes void or unenforceable for any reason. [Signatures to this Exhibit A1, Performance Bond, Begin on Next Page]. Page 96 of 117 On the date set forth below, Principal and Surety duly executed this Performance Bond, with the name of each party appearing below and signed by its representative(s) under the authority of its governing body. Date: PRINCIPAL: SURETY: (Company Name) (Company Name) (Signature) (Signature) By: By: (Name and Title) (Name and Title) Address for Serving Notices or Other Documents: Address for Serving Notices or Other Documents: THIS BOND MUST BE EXECUTED IN DUPLICATE. EVIDENCE MUST BE ATTACHED OF THE AUTHORITY OF ANY PERSON SIGNING AS ATTORNEY-IN-FACT. THE ATTORNEY-IN-FACT’S SIGNATURE MUST BE NOTARIZED. A CORPORATE SEAL MUST BE IMPRESSED ON THIS FORM WHEN THE PRINCIPAL, OR THE SURETY, OR BOTH, ARE A CORPORATION. APPROVED AS TO SURETY AND APPROVED AS TO FORM: AMOUNT OF BONDED SUM: By: By: Abraham Alemu, General Manager of Public Utilities Zaynah N. Moussa, Interim City Attorney CORPORATE SEAL CORPORATE SEALCORPORATE SEAL Page 97 of 117 BOND ACKNOWLEDGMENT FOR SURETY’S ATTORNEY-IN-FACT STATE OF CALIFORNIA ) ) ss COUNTY OF ) On this day of , 20 , before me, (name), a Notary Public for said County, personally appeared (name), who proved to me on the basis of satisfactory evidence to be the person whose name is subscribed to this instrument as the attorney in fact of , and acknowledged to me that he/she subscribed the name of thereto as principal, and his/he own name as attorney in fact. I certify under PENALTY OF PERJURY under the laws of the State of California that the foregoing paragraph is true and correct. Notary Public SEAL Page 98 of 117 EXHIBIT A2 Bond No.: Premium Amount: $ Bond’s Effective Date: PAYMENT BOND (LABOR AND MATERIALS) RECITALS: 1. The City of Vernon, California (“City”), has awarded to __________________________________________________________________________________________ (Name, address, and telephone of Design-Builder) ________________________________________________________________________________ (“Principal”), a Contract (the “Contract”) for the Work described as follows: Specification No. : in Vernon, CA. 2. Principal is required under California CivilCode Sections 9550-9566 and the terms of the Contract and all contract documents referenced in it (“Contract Documents”) to furnish a bond guaranteeing Principal’s paying claims, demands, liens, or suits for any work, labor, services, materials, or equipment furnished or used in the Work. 3. The Contract and Contract Documents, including all their amendments and supplements, are incorporated into this Bond and made a part of it by this reference. OBLIGATION: THEREFORE, for value received, We, Principal and ______________________________________________________________________________________________ (Name, address, and telephone of Surety) ______________________________________________________________________________________ (“Surety”), a duly admitted surety insurer under California’s laws, agree as follows: By this Bond, Wejointly and severally obligate and bind ourselves, and our respective heirs, executors, administrators, successors, and assigns to pay City the penal sum of Dollars ($ ) (“the Bonded Sum”), this amount comprising not less than the total Contract Sum, in lawful money of the United States of America. The Licensed Agent for Surety is: (Name, address, and telephone) Registered Agent’s California Department of Insurance License No. . THE CONDITION OF THIS BOND’S OBLIGATION IS THAT, if Principal or a subcontractor fails to pay (a) any person named in California Civil Code Section 9100, or any successor legislation; (b) any amount due under California’s Unemployment Insurance Code, or any successor legislation, for work or labor performed under the Contract or Contract Documents; or (c) any amount under Unemployment Insurance Code Section 13020, or any successor legislation, that Principal or a subcontractor must deduct, withhold, and pay over to the Employment Development Department from the wages of its employees, for work or labor performed under the Contract or Contract Documents, then Surety shall pay for the same in an amount not-to-exceed the Bonded Sum. Otherwise, this obligation becomes null and void. While this Bond remains in full force and effect, the following terms and conditions apply to this Bond: Page 99 of 117 1. This Bond inures to the benefit of any of the persons named in California Civil Code Section 3181, or any successor legislation, giving those persons or their assigns a right of action in any suit brought upon this Bond, unless California Civil Code Section 3267, or any successor legislation, applies. 2. An alteration, modification, change, addition, deletion, omission, agreement, or supplement to the Contract, Contract Documents, or the nature of the Work performed under the Contract or Contract Documents including, without limitation, an extension of time for performance does not, in any way, affect Surety’s obligations under this Bond. Surety waives any notice of alteration, modification, change, addition, deletion, omission, agreement, supplement, or extension of time. 3. Surety’s obligations under this Bond are separate, independent from, and not contingent upon any other surety’s payingclaims, demands, liens, or suits for any work, labor, services, materials, or equipment furnished or used in the Work. 4. If an action at law or in equity is necessary to enforce or interpret this Bond’s terms, Surety must pay in addition to the Bonded Sum City’s reasonable attorneys’ fees and litigation costs, in an amount the court fixes. 5. Surety shall mail City written notice at least 30 days before: (a) the effective date on which the Surety will cancel, terminate, or withdraw from this Bond; or (b) this Bond becomes void or unenforceable for any reason. [Signatures to this Exhibit A2, Payment Bond, Begin on Next Page]. Page 100 of 117 On the date set forth below, Principal and Surety duly executed this Payment Bond, with the name of each party appearing below and signed by its representative(s) under the authority of its governing body. Date: PRINCIPAL: SURETY: (Company Name) (Company Name) (Signature) (Signature) By: By: (Name and Title) (Name and Title) Address for Serving Notices or Other Documents: Address for Serving Notices or Other Documents: THIS BOND MUST BE EXECUTED IN DUPLICATE. EVIDENCE MUST BE ATTACHED OF THE AUTHORITY OF ANY PERSON SIGNING AS ATTORNEY-IN-FACT. THE ATTORNEY-IN-FACT’S SIGNATURE MUST BE NOTARIZED. A CORPORATE SEAL MUST BE IMPRESSED ON THIS FORM WHEN THE PRINCIPAL, OR THE SURETY, OR BOTH, ARE A CORPORATION. APPROVED AS TO SURETY AND APPROVED AS TO FORM: AMOUNT OF BONDED SUM: By: ______ _______ ______ By: Abraham Alemu, General Manager of Public Utilities Zaynah N. Moussa, Interim City Attorney CORPORATE SEAL CORPORATE SEALCORPORATE SEAL CORPORATE SEAL Page 101 of 117 BOND ACKNOWLEDGMENT FOR SURETY’S ATTORNEY-IN-FACT STATE OF CALIFORNIA ) ) ss COUNTY OF ) On this day of , 20 , before me, (name), a Notary Public for said County, personally appeared (name), who proved to me on the basis of satisfactory evidence to be the person whose name is subscribed to this instrument as the attorney in fact of, and acknowledged to me that he/she subscribed the name of thereto as principal, and his/he own name as attorney in fact. I certify under PENALTY OF PERJURY under the laws of the State of California that the foregoing paragraph is true and correct. Notary Public SEAL Page 102 of 117 EXHIBIT A3 Bond No.: Premium Amount: $ Bond’s Effective Date: MAINTENANCE BOND RECITALS: 1. The City of Vernon, California (“City”), has awarded to (Name, address, and telephone of Contractor) _______________________________________________________________________________________ (“Principal”), a Contract (the “Contract”) for the Work described as follows: Specification No. : in Vernon, CA. 2. Principal is required under the terms of the Contract— and all contract documents referenced in it (“Contract Documents”)— after completion of the Work and before the filing and recordation of a Notice of Completion for the Work, to furnish a bond to secure claims for Maintenance equal to ten percent (10%) of the total amount of the Contract Which shall hold good for a period of one (1) year from the date the City’s Notice of Completion and Acceptance of the Work is filed with the County Recorder, to protect the City against the result of faulty material or workmanship during that time. 3. The Contract and Contract Documents, including all their amendments and supplements, are incorporated into this Bond and made a part of it by this reference. OBLIGATION: THEREFORE, for value received, We, Principal and (Name, address, and telephone of Surety) ______________________________________________________________________________________ (“Surety”), a duly admitted surety insurer under California’s laws, agree as follows: By this Bond, We jointly and severally obligate and bind ourselves, and our respective heirs, executors, administrators, successors, and assigns to pay City the penal sum of Dollars ($ ) (“the Bonded Sum”), this amount comprising not less than ten percent (10%) of the total Contract Sum, in lawful money of the United States of America. The Licensed Agent for Surety is: (Name, address, and telephone) Registered Agent’s California Department of Insurance License No. . THE CONDITION OF THIS BOND’S OBLIGATION IS THAT if the said Principal or any of his or her or its subcontractors, or the heirs, executors, administrators, successors, or assigns or assigns of any, all, or either of them, shall fail to execute within a reasonable amount of time, or fail to respond within seven (7) days with a written schedule acceptable to the City for same, repair or replacement of any and all Work, together with any other adjacent Work which may be displaced by so doing, that proves to be defective in its workmanship or material for the period of one (1) year (except when otherwise required in the Contract to be for a longer period) from the date the City’s Notice of Completion and Acceptance, or equivalent, is filed with the County Recorder, ordinary wear and tear and unusual abuse or neglect excepted with respect to such Work and labor, the Surety herein shall pay for the same, in an amount not exceeding the sum specified in this Bond. 1. When City declares that Principal is in default under the Contract, or Contract Documents, or both, Surety shall promptly Page 103 of 117 remedy the default using a procurement methodology approved by City, select a contractor or contractors acceptable to City to complete all of the Work, and arrange for a contract between the contractor(s) and City. Surety shall make available sufficient funds to pay the cost of repair or replacement of any and all Work and to pay and perform all obligations of Principal under the Contract and Contract Documents including other costs and damages for which Surety is liable under this Bond except that Surety’s total obligation, as described here, will not exceed the Bonded Sum. 2. Should the condition of this bond be fully performed, then this obligation shall become null and void, otherwise it shall be and remain in full force and effect. 3. Surety, for value received, hereby stipulates and agrees that no change, extension of time, alteration, or addition to the terms of said Contract or to the Work to be performed thereunder or the specifications accompanying the same shall in any manner affect its obligations on this bond, and it does hereby waive notice of any such change, extension, alteration, or addition. 4. Surety’s obligations under this Bond are separate, independent from, and not contingent upon any other surety’s guaranteeing Principal’s faithful performance of the Work. 5. No right of action accrues on this Bond to any entity other than City or its successors and assigns. 6. If an action at law or in equity is necessary to enforce or interpret this Bond’s terms, Surety must pay, in addition tothe Bonded Sum, City’s reasonable attorneys’ fees and litigation costs, in an amount the court fixes. 7. Surety shall mail City written notice at least 30 days before: (a) the effective date on which the Surety will cancel, terminate, or withdraw from this Bond; or (b) this Bond becomes void or unenforceable for any reason. 8. Death of the Principal shall not relieve Surety of its obligations hereunder. [Signatures to this Exhibit A3, Maintenance Bond, Begin on Next Page]. Page 104 of 117 On the date set forth below, Principal and Surety duly executed this Maintenance Bond, with the name of each party appearing below and signed by its representative(s) under the authority of its governing body. Date: PRINCIPAL: SURETY: (Company Name) (Company Name) (Signature) (Signature) By: By: (Name and Title) (Name and Title) Address for Serving Notices or Other Documents: Address for Serving Notices or Other Documents: THIS BOND MUST BE EXECUTED IN DUPLICATE. EVIDENCE MUST BE ATTACHED OF THE AUTHORITY OF ANY PERSON SIGNING AS ATTORNEY-IN-FACT. THE ATTORNEY-IN-FACT’S SIGNATURE MUST BE NOTARIZED. A CORPORATE SEAL MUST BE IMPRESSED ON THIS FORM WHEN THE PRINCIPAL, OR THE SURETY, OR BOTH, ARE A CORPORATION. APPROVED AS TO SURETY AND APPROVED AS TO FORM: AMOUNT OF BONDED SUM: By: _______ By: Abraham Alemu, General Manager of Public Utilities Zaynah N. Moussa, Interim City Attorney CORPORATE SEAL CORPORATE SEALCORPORATE SEAL CORPORATE SEAL Page 105 of 117 BOND ACKNOWLEDGMENT FOR SURETY’S ATTORNEY-IN-FACT STATE OF CALIFORNIA ) ) ss COUNTY OF ) On this day of , 20 , before me, (name), a Notary Public for said County, personally appeared (name), who proved to me on the basis of satisfactory evidence to be the person whose name is subscribed to this instrument as the attorney in fact of , and acknowledged to me that he/she subscribed the name of thereto as principal, and his/he own name as attorney in fact. I certify under PENALTY OF PERJURY under the laws of the State of California that the foregoing paragraph is true and correct. Notary Public SEAL Page 106 of 117 EXHIBIT A4 INSURANCE REQUIREMENTS 1.0 REQUIRED INSURANCE POLICIES At its own expense, Contractor shall obtain, pay for, and maintain – and shall require each of its Subcontractors to obtain and maintain – for the duration of the Agreement, policies of insurance meeting the following requirements: A. Workers’ Compensation/Employer’s Liability Insurance shall provide workers’ compensation statutory benefits as required by law. 1. Employer’s Liability insurance shall be in an amount not less than: (a) ONE MILLION DOLLARS ($1,000,000) per accident for bodily injury or disease; (b) ONE MILLION DOLLARS ($1,000,000) per employee for bodily injury or disease; and (c) ONE MILLION DOLLARS ($1,000,000) policy limit. B. Commercial General Liability (“CGL”) (primary). City and its employees and agents shall be added as additional insureds, not limiting coverage for the additional insured to “ongoing operations” or in any way excluding coverage for completed operations. Coverage shall apply on a primary, non-contributing basis in relation to any other insurance or self-insurance, primary or excess, available to City or any employee, representative or agent of City. Coverage shall not be limited to the vicarious liability or supervisory role of any additional insured. Coverage shall contain no contractors’ limitation or other endorsement limiting the scope of coverage for liability arising from explosion, collapse, or underground property damage. 1. CGL insurance must not be written for less than the limits of liability specified as follows: (a) ONE MILLION DOLLARS ($1,000,000) per occurrence for bodily injury (including accidental death) to any one person; (b) ONE MILLION DOLLARS ($1,000,000) per occurrence for personal and advertising injury to any one person; (c) ONE MILLION DOLLARS ($1,000,000) per occurrence for property damage; and (d) TWO MILLION DOLLARS ($2,000,000) general aggregate limit. 2. CGL insurance must include all major divisions of coverage and must cover: (a) Premises Operations (including Explosion, Collapse, and Underground [“X,C,U”] coverages as applicable); (b) Independent Contractor’s Protective; Page 107 of 117 (c) Independent Contractors; (d) Products and Completed Operations (maintain same limits as above until five (5) years after recordation of Notice of Completion); (e) Personal and Advertising Injury (with Employer’s Liability Exclusion deleted); (f) Contractual Liability (including specified provision for Contractor’s obligation under Article 11 of the General Conditions); and (g) Broad Form Property Damage. 3. Umbrella or Excess Liability Insurance (over primary), if provided, shall be at least as broad as any underlying coverage. Coverage shall be provided on a “pay on behalf” basis, with defense costs payable in addition to policy limits. There shall be no cross liability exclusion and no contractor’s limitation endorsement. The policy shall have starting and ending dates concurrent with the underlying coverages. The Named Insured may determine the layering of primary and excess liability insurance provided that if such layering differs from that described here, the actual coverage program meets the minimum total required limits and complies with all other requirements listed here. C. Business Automobile Liability Insurance 1. Business Automobile Liability Insurance must cover all vehicles, whether rented, leased, hired, scheduled, owned or non-owned. If Contractor does not own any vehicles, this requirement may be satisfied by a non-owned vehicle endorsement to the general and umbrella liability policies. Business Automobile Liability Insurance coverage amounts shall not be less than the following: (a) ONE MILLION DOLLARS ($1,000,000) per occurrence for bodily injury (including accidental death) to any one person; and (b) ONE MILLION DOLLARS ($1,000,000) per occurrence for property damage; or (c) ONE MILLION DOLLARS ($1,000,000) combined single limit. D. Contractors Pollution Liability Insurance (CPL) 1. Contractor or Subcontractor shall obtain, pay for, and maintain for the duration of the Contract Contractors Pollution Liability insurance that provides coverage for liability caused by pollution conditions arising out of the operations of the Contractor. Coverage shall be included on behalf of the insured for covered claims arising out of the actions of independent contractors. If the insured is using Subcontractors, the policy must include work performed “by or on behalf” of the insured. 2. The policy limit shall provide coverage of no less than one million dollars ($1,000,000) per claim and in the aggregate. Coverage shall apply to bodily injury; property damage, including loss of use of damaged property or of property that has not been physically inured; cleanup costs; and costs of defense, including costs and expenses incurred in the Page 108 of 117 investigation, defense, or settlement of claims. 3. All activities contemplated in the Contract shall be specifically scheduled on the CPL policy as “covered operations.” In addition, the policy shall provide coverage for the hauling of waste from the Project site to the final disposal location, including non-owned disposal sites. 4. The policy shall specifically provide for a duty to defend on the part of the insurer. City, its officers, employees and agents shall be added to the policy as additional insureds by endorsement. 2.0 GENERAL REQUIREMENTS—ALL POLICIES A. Qualifications of Insurer. At all times during the term of this Contract, Contractor’s insurance company must meet all of the following requirements: 1. “Admitted” insurer by the State of California Department of Insurance or be listed on the California Department of Insurance’s “List of Surplus Line Insurers” (“LESLI”); 2. Domiciled within, and organized under the laws of, a State of the United States; and 3. Carry an A.M. Best & Company minimum rating of “A:VII”. B. Continuation Coverage. For insurance coverages that are required to remain in force after the Final Payment, and if reasonably available, Contractor shall submit to City, with the final Application for Payment, all certificates and additional insured endorsements evidencing the continuation of such coverage. C. Deductibles or Self-Insured Retentions. All deductibles or self-insured retentions are subject to City’s review and approval, in its sole discretion. D. Commercial General Liability and Business Automobile insurance policies must be written on an “occurrence” basis and must add the City of Vernon and its officers, agents, employees and representatives as additional insureds. E. Contractor’s Insurance Primary. Other insurance (whether primary, excess, contingent or self- insurance, or any other basis) available to City, or its representatives, or both, is excess over Contractor’s insurance. City’s insurance, or self-insurance, or both, will not contribute with Contractor’s insurance policy. F. Waiver of Subrogation. Contractor and Contractor’s insurance company waive— and shall not exercise— any right of recovery or subrogation that Contractor or the insurer may have against City, or its representatives, or both. Page 109 of 117 G. Separation of Insureds. Contractor’s insurance policy applies separately to each insured or additional insured who is seeking coverage, or against whom a claim is made or suit is brought, except that the naming of multiple insureds will not increase an insurance company’s limits of liability. H. Claims by Other Insureds. Contractor’s insurance policy applies to a claim or suit brought by an additional insured against a Named Insured or other insured, arising out of bodily injury, personal injury, advertising injury, or property damage. I. Premiums. City is not liable for a premium payment or another expense under Contractor’s policy J. At any time during the duration of this Contract, City may do any one or more of the following: 1. Review this Agreement’s insurance coverage requirements; 2. Require that Contractor obtain, pay for, and maintain more insurance depending on City’s assessment of any one or more of the following factors: (a) City’s risk of liability or exposure arising out of, or in any way connected with, the services of Contractor under this Agreement; (b) The nature or number of accidents, claims, or lawsuits arising out of, or in any way connected with, the services of Contractor under this Agreement; or (c) The availability, or affordability, or both, of increased liability insurance coverage. 3. Obtain, pay for, or maintain a bond (as a replacement for an insurance coverage) from a California corporate surety, guaranteeing payment to City for liability, or costs, or both, that City incurs during City’s investigation, administration, or defense of a claim or a suit arising out of this Agreement; or K. Contractor shall maintain the insurance policy without interruption, from the Project’s commencement date to the Final Payment date, or until a date that City specifies for any coverage that Contractor must maintain after the Final Payment. L. Contractor shall not allow any insurance to expire, cancel, terminate, lapse, or non-renew. Contractor’s insurance company shall mail City written notice at least thirty (30) days in advance of the policy’s cancellation, termination, non-renewal, or reduction in coverage and ten (10) days before its insurance policy’s expiration, cancellation, termination, or non-renewal, Contractor shall deliver to City evidence of the required coverage as proof that Contractor’s insurance policy has been renewed or replaced with another insurance policy which, during the duration of this Agreement, meets all of this Agreement’s insurance requirements. M. At any time, upon City’s request, Contractor shall furnish satisfactory proof of each type of insurance coverage required— including a certified copy of the insurance policy or policies; certificates, endorsements, renewals, or replacements; and documents comprising Contractor’s self-insurance program— all in a form and content acceptable to the City Attorney or City’s Risk Manager. N. If Contractor hires, employs, or uses one or more Subcontractor(s) to perform work, services, operations, or activities on Contractor’s behalf, Contractor shall ensure that the Subcontractor complies with the following. 1. Meets, and fully complies with, this Agreement’s insurance requirements; and Page 110 of 117 2. Furnishes City at any time upon its request, with a complete copy of the Subcontractor’s insurance policy or policies for City’s review, or approval, or both. Failure of City to request copies of such documents shall not impose any liability on City, or its employees. O. Contractor’s failure to comply with an insurance provision in this Agreement constitutes a material breach upon which City may immediately terminate or suspend Contractor’s performance of this Agreement, or invoke another remedy that this Agreement or the law allows. At its discretion and without waiving any other rights it may have pursuant to law, City has the right but not a duty to obtain or renew the insurance and pay all or part of the premiums. Upon demand, Contractor shall repay City for all sums or monies that City paid to obtain, renew, or reinstate the insurance, or City may offset the cost of the premium against any sums or monies that City may owe Contractor. 3.0 CONTRACTOR’S SUBMITTAL OF CERTIFICATES AND ENDORSEMENTS A. Contractor shall have its insurance carrier(s) or self-insurance administrator(s) complete and execute the following insurance documents and shall deliver said documents at the same time Contractor delivers this Agreement to City. City will neither sign this Agreement nor issue a “Notice to Proceed” until the City Attorney or City’s Risk Manager has reviewed and approved all insurance documents. City's decision as to the acceptability of all insurance documents is final. Sample insurance documents in the City’s approved format are set forth in this 4. B. Required Submittals for Commercial General Liability and Business Automobile Insurance and Contractor’s Pollution Liability Insurance. The following submittals must be on forms satisfactory to the City Attorney or City’s Risk Manager, and signed by the insurance carrier or its authorized representative – which fully meet the requirements of, and contain provisions entirely consistent with, all of the insurance requirements set forth herein. 1. “Certificate of Insurance” 2. “Additional Insured Endorsement” 3. Subrogation Endorsement: “Waiver of Transfer to Rights of Recover Against Others” Both Certificates of Insurance and Additional Insured Endorsements must read as follows: “The City of Vernon, and its officers, agents, employees and representatives are included as additional insureds under the policy(s). This insurance is primary to all other insurance of the City. The City’s insurance and self-insurance will apply in excess of, and will not contribute with this insurance. This insurance applies separately to each insured or additional insured who is seeking coverage, or against whom a claim is made or a suit is brought. The issuing company shall mail thirty (30) days advance notice to the City for any policy cancellation, termination, non-renewal, or reduction in coverage.” C. Required Submittals for Workers’ Compensation Insurance. Contractor shall provide City with a certificate of insurance and a subrogation endorsement on forms satisfactory to the City Attorney or City’s Risk Manager, and signed by the insurance carrier or its authorized representative – which fully meet the requirements of, and contain provisions entirely consistent with, this Contract’s workers compensation insurance requirements. If Contractor is self-insured for workers’ compensation, a copy of the “Certificate of Consent to Self-insure” from the State of California is required; or if Contractor is lawfully exempt from workers’ compensation laws, an “Affirmation of Exemption from Labor Code §3700” form is required. D. Required Evidence of Builder’s Risk Coverage. City will provide a certificate of insurance and a declarations page on a form satisfactory to the City Attorney or City’s Risk Manager, and signed by the insurance carrier or its authorized representative. The policy terms must fully meet the requirements of, and contain provisions entirely consistent with, all of the insurance requirements set forth herein. The City shall be named as a loss payee on the insurance policy for the full replacement value of all buildings, structures, fixtures and materials to be constructed, maintained, repaired or supplied pursuant to this Contract. E. Contractor agrees to monitor and review all such coverage and assumes all responsibility for Page 111 of 117 ensuring that all required coverage is provided. Contractor agrees to obtain certificates evidencing such coverage. F. Contractor agrees to provide immediate notice to City of any claim or loss against Contractor that includes City or any other indemnitee as a defendant. City assumes no obligation or liability by such notice, but has the right (but not the duty) to monitor the handling of any such claim or claims if they are likely to involve City. G. No liability policy shall contain any provision or definition that would serve to eliminate so-called “third party action over” claims, including any exclusion for bodily injury to an employee of the insured or of any contractor or subcontractor. H. Any “self-insured retention” must be declared and approved by City. City reserves the right to require the self-insured retention to be eliminated or replaced by a deductible. Self-funding, policy fronting or other mechanisms to avoid risk transfer are not acceptable. If Contractor has such a program, Contractor must fully disclose such program to City. Page 112 of 117 EXHIBIT A5 Statement of Intent to Comply with Minimum Requirements of the Stormwater Permit CITY OF VERNON VERNON PUBLIC UTILITIES Construction Stormwater Program Permit Number: Date: Applicant: Phone: Project Address: Property Owner: Contractor: Contractor’s Address: The National Pollutant Discharge Elimination System (NPDES) is a portion of the Clean Water Act that applies to the protection of receiving waters. Under permits from the Los Angeles Regional Water Quality Control Board (RWQCB), certain activities are subject to RWQCB enforcement. To meet the standards of the Waste Discharge Requirements for Municipal Separate Storm Sewer System (MS4) Discharges within the Coastal Watershed of Los Angeles County, Except those Discharges Originating from the City of Long Beach MS4 (CAS004001), the City of Vernon has adopted minimum standards for stormwater runoff from development construction activities. These minimum standards require the implementation of an effective combination of erosion and sediment control Best Management Practices (BMPs) to prevent erosion and sediment loss, and the discharge of construction waste at each site. At a minimum, the construction activity associated with the construction project identified above shall be conducted in such a manner that: ¾Prevents illicit construction-related discharges of pollutants into the MS4 and receiving waters. ¾Implements and maintains structural and non-structural BMPs to reduce pollutants in stormwater runoff from construction sites. ¾Reduces construction site discharges of pollutants to the MS4 to the maximum extent practicable. ¾Prevents construction site discharges to the MS4 from causing or contributing to a violation of water quality standards. Note: The Stormwater BMP Construction Handbook sheets developed by the California Stormwater Quality Association shall be used as guidance in determining and implementing required BMPs. The BMP sheets may be reviewed at the [Insert Department] counter during regular business hours. A General Construction Permit shall be obtained and maintained for all construction sites one (1) acre or greater. Additional conditions may be required for these sites. Page 113 of 117 I have read and understand the requirements listed above and certify that I will comply with the minimum requirements above. Signature: Print Name: Title: Property Owner: Page 114 of 117 EXHIBIT A6 Statement of Intent to Comply with Minimum Requirements of the California Covid-19 Industry Guidance: Construction CITY OF VERNON VERNON PUBLIC UTILITIES Project Address: Property Owner: Contractor: Contractor’s Address: The latest COVID-19 industry guidelines can be accessed at the following web address: https://www.dir.ca.gov/dosh/coronavirus/Guidance-by-Industry.html This document provides guidance for the construction industry to support a safe, clean environment for workers. The guidance is not intended to revoke or repeal any worker rights, either statutory, regulatory or collectively bargained, and is not exhaustive, as it does not include county health orders, nor is it a substitute for any existing safety and health-related regulatory requirements such as those of Cal/OSHA.1 Stay current on changes to public health guidance and state/local orders, as the COVID-19 situation continues. Cal/OSHA has more safety and health guidance on their Cal/OSHA COVID-19 Infection Prevention for Construction 2 Employers and Workers webpage. CDC has additional guidance for businesses and employers. I have read and understand the requirements listed above and certify that I will comply with the minimum requirements above. Signature: Date: ___________________ Print Name: Title: Page 115 of 117 EXHIBIT B SPECIAL PROVISIONS SPECIFIC FOR THIS PROJECT WĂŐĞϭŽĨϴ (;+,%,7% 63(&,$/3529,6,216±63(&,),&)257+,6352-(&7 *(1(5$/ %3XUSRVHDQG6FRSH 7KHSXUSRVHRIWKLVGRFXPHQWLVWRSURYLGHGHWDLOHGWHFKQLFDOVSHFLILFDWLRQVIRUWKHUHKDELOLWDWLRQ DQGUHSDLUVRIWKUHH0*DERYHJURXQGVWHHOUHVHUYRLUVZKLFKDUHRZQHGDQGRSHUDWHGE\WKH &LW\RI9HUQRQ3XEOLF8WLOLWLHV'HSDUWPHQWKHUHLQDIWHUUHIHUUHGWRDVWKH³&LW\´5HVHUYRLUV DQGDUHORFDWHGDW3XPSLQJ3ODQWDW'RZQH\5RDGDQG9HUQRQ$YHQXHLQ 9HUQRQ&$ 7KHFRQWUDFWRUVKDOOIXUQLVKDOOODERUPDWHULDOVHTXLSPHQWVHUYLFHVDQGVSHFLDOL]HGVNLOOVWR SHUIRUPDOO:RUNLQYROYHGLQWKH3URMHFW7KH:RUNLQWKH6FKHGXOHRI%LG3ULFHVLVGHILQHGLQ WKH7HFKQLFDO3URYLVLRQVDQGWKH3URMHFW'UDZLQJVLIVRSURYLGHGDQGZLOOJHQHUDOO\LQFOXGHWKH IROORZLQJ $SSOLFDWLRQRISURWHFWLYHFRDWLQJVWRLQWHULRUVXUIDFHVDQGSDLQWWRH[WHULRUVXUIDFHLQFOXGLQJ VXUIDFHSUHSDUDWLRQKDQGOLQJRIKD]DUGRXVDQGQRQKD]DUGRXVPDWHULDOVZDVWHVGLVLQIHFWLRQRI LQWHULRUVXUIDFHVDQGPRGLILFDWLRQVRIPLVFHOODQHRXVVWUXFWXUDOLWHPVWREULQJWKHVWUXFWXUHVLQWR FRPSOLDQFHZLWKFXUUHQWVDIHW\DQGKHDOWKFRGHVVWDQGDUGVDQGUHJXODWLRQVDQGRWKHUZRUN QHFHVVDU\WRDFFRPSOLVKWKHDSSURYHGHQGUHVXOWRIWRWDOO\SURWHFWHGDQGXVDEOHVWUXFWXUHV LQFOXGLQJDWWDFKPHQWVDFFHVVRULHVDQGDSSXUWHQDQFHV5HPRYDORIH[LVWLQJLQWHULRUDQGH[WHULRU FRDWLQJVXUIDFHVRIDERYHJURXQGVWHHOUHVHUYRLUV$GGLWLRQDOHTXLSPHQWDQGDFFHVVRULHVLQFOXGH EXWQRWOLPLWHGWRQHZUHVHUYRLUPL[LQJXQLWV :RUNVKDOOEHSHUIRUPHGRQHDFKWDQNRQHDWDWLPH$WOHDVWRQHWDQNPXVWUHPDLQLQRSHUDWLRQDO VHUYLFHDWDOOWLPHVGXULQJWKHGXUDWLRQRIWKHSURMHFW %3HUPLWVDQG$SSOLFDEOH/DZV $W&RQWUDFWRU¶VRZQH[SHQVH&RQWUDFWRUVKDOOSURFXUHDOOQHFHVVDU\SHUPLWVFHUWLILFDWHVDQG OLFHQVHVUHTXLUHGRI&RQWUDFWRUE\ODZIRUH[HFXWLRQRIWKH:RUN&RQWUDFWRUVKDOOFRPSO\ZLWK DOOIHGHUDOVWDWHDQGORFDOODZVRUGLQDQFHVDQGUXOHVDQGUHJXODWLRQVUHODWLQJWRWKH SHUIRUPDQFHRIWKH:RUN7KHFRQWUDFWRUVKDOOEHUHTXLUHGWRDELGHE\DQ\DQGDOODSSOLFDEOH SHUPLWVDQGODZVIURPUHJXODWRU\DQGJRYHUQPHQWDODJHQFLHVDWDOOWLPHVGXULQJH[HFXWLRQRIWKH :RUNDQGVSHFLILFDOO\IRUGLVFKDUJHRIZDWHUGXULQJWKHYDULRXVWHVWLQJSKDVHVLQFOXGLQJDOO UHTXLUHPHQWVRIWKH5HJLRQDO:DWHU4XDOLW\&RQWURO%RDUGDQGWKH&LW\¶V1DWLRQDO3ROOXWDQW 'LVFKDUJH(OLPLQDWLRQ6\VWHP13'(63HUPLW $OOHTXLSPHQWXVHGE\WKHFRQWUDFWRUDQGLWVVXEFRQWUDFWRUVGXULQJWKHH[HFXWLRQRIWKH:RUN VKDOOEHDSSURSULDWHO\SHUPLWWHGDQGRUUHJLVWHUHGZLWKWKH&DOLIRUQLD$LU5HVRXUFHV%RDUG &$5%DQGWKH6RXWK&RDVW$LU4XDOLW\0DQDJHPHQW'LVWULFW6&$40'8SRQUHTXHVWSURRI RIWKHVHUHTXLUHPHQWVVKDOOEHVXEPLWWHGWRWKH&LW\¶VUHSUHVHQWDWLYHV WĂŐĞϮŽĨϴ %%RXQGDU\RI:RUN 5HVHUYRLUVDQGDUHORFDWHGDW3XPSLQJ3ODQWDW'RZQH\5RDGDQG 9HUQRQ$YHQXHLQ9HUQRQ&$7KHVLWHVDUHDFFHVVLEOHWKURXJKDSDVVFRGHSURWHFWHGVHFXULW\ JDWH'XULQJFRQVWUXFWLRQKRXUVWKHFRQWUDFWRUZLOOEHJUDQWHGDFFHVVWRWKHUHVHUYRLUVLWH2WKHU FRQWUDFWRUVHPSOR\HHVDQGRUDJHQWVRIWKH&LW\PD\IRUDQ\UHDVRQDQGDWDQ\WLPHHQWHUXSRQ WKHSURMHFWVLWH %3URWHFWLRQRI6LWH'LVSRVDODQG&RQWURORI:DVWH:DWHU :RUNDFWLYLWLHVVKDOOEHFRQGXFWHGLQVXFKDZD\DVWRSUHYHQWWKHLQWURGXFWLRQRISROOXWDQWVWR WKHJURXQGVXUIDFHRURIIVLWHGUDLQDJHVGXULQJWKH:RUN$FFRUGLQJO\DQ\HTXLSPHQWDQGRU PDWHULDOVEURXJKWWRWKHSURMHFWVLWHPXVWEHPDQDJHGLQDFFRUGDQFHZLWKWKHIROORZLQJ SURFHGXUHV D'ULSSDQVDQGRUSODVWLFVKHHWLQJWKDWLVEHUPHGPXVWEHXVHGXQGHUDOOVWDWLRQDU\ HTXLSPHQWWRFDWFKOHDNVDQGUHVLGXDOPDWHULDOLQKRVHVDQGVSLJRWV7KHSODVWLFVKHHWLQJ DQGRUGULSSDQVPXVWEHLQVSHFWHGE\&RQWUDFWRUGDLO\DQGHPSWLHGRUUHSODFHGDVQHHGHG E\UHXVLQJWKHVXEVWDQFHRUGLVSRVLQJRILWSURSHUO\DWWKHFRQWUDFWRU¶VH[SHQVH E6SLOOHGKD]DUGRXVPDWHULDOVPXVWEHFRQWDLQHGLPPHGLDWHO\LQDFFRUGDQFHZLWKDOOODZV DQGUHJXODWLRQVXVLQJVDQGGLUWDQGRURWKHUDEVRUEHQWPDWHULDOV6XFKVSLOOVPXVWEH FOHDQHGXSSURPSWO\DORQJZLWKWKHFRQWDLQLQJPDWHULDOVDJHQWVDQGPXVWEHGLVSRVHGRI SURSHUO\DWWKHFRQWUDFWRU¶VH[SHQVH F2XWGRRUVWRUDJHRIDOOIXHOVRLOVVROYHQWVFOHDQHUVDQGRWKHUOLTXLGPDWHULDOVVKDOOEH VWRUHGZLWKVHFRQGDU\FRQWDLQPHQW6XFKDUHDVVKRXOGEHFRYHUHGDVQHFHVVDU\WR SUHYHQWVWRUPZDWHUDFFXPXODWLRQLQWKHFRQWDLQPHQW G%HQWRQLWHFHPHQWDQGDQ\RWKHUSRZGHUHGSURGXFWVVKDOOEHVWRUHGRQSDOOHWVDQGDZD\ IURPDOOGUDLQDJHSDWKV7KHVWRUDJHDUHDVKRXOGEHFRYHUHGDQGSURWHFWHGLIQHFHVVDU\ WRSUHYHQWSROOXWLRQUXQRIIE\ZLQGRUVWRUPZDWHU H&KHPLFDOVEDJJHGPDWHULDODQGGUXPVVKDOOEHVWRUHGRQSDOOHWVZLWKVHFRQGDU\ FRQWDLQPHQW :DVWH3URGXFWVJHQHUDWHGGXULQJWKH:RUNPXVWEHPDQDJHGLQDFFRUGDQFHZLWKWKHIROORZLQJ SURFHGXUHV D&RQWDLQHUL]HGZDVWHPXVWQRWEHDOORZHGWRRYHUIORZ$Q\ZDVWHWKDWUHTXLUHVVWRUDJHLQ FRQWDLQHUVVKDOOEHUHPRYHGIURPWKHSURMHFWDUHDRQDUHJXODUEDVLVDQGGLVSRVHGRIDWDQ DSSURYHGIDFLOLW\DWWKHFRQWUDFWRU¶VH[SHQVH E&OHDQLQJRIWKHSXPSKRLVWWUHPLHSLSHDQGDQ\RWKHUHTXLSPHQWVKDOOEHFRQGXFWHG ZLWKLQDIXOO\FRQWDLQHGDUHDDQGZLWKLQWKHDUHDRIWKHZHOOVLWHRQO\$Q\GHYLDWLRQPXVW EHDSSURYHGE\WKH&LW\LQDGYDQFH F$OOZDVWHSURGXFWVPXVWEHUHPRYHGIURPWKHSURMHFWDUHDSULRUWRFRPSOHWLRQRIWKH :RUN 7KHFRQWUDFWRUVKDOOSURWHFWLQSODFHDOOSLSHOLQHVWUHHVODQGVFDSLQJFXUEVDQGDOORWKHUH[LVWLQJ LPSURYHPHQWVORFDWHGZLWKLQWKHSXEOLFULJKWRIZD\WKURXJKRXWWKHGXUDWLRQRIWKH:RUN7KH FRQWUDFWRUVKDOOXVH%HVW0DQDJHPHQW3UDFWLFHV%03VIRUWKHSURWHFWLRQRIWKHZHOOVLWHGXULQJ WĂŐĞϯŽĨϴ WKH:RUNDQGVKDOOWDNHZKDWHYHUPHDVXUHVQHFHVVDU\WRHQVXUHWKDW&RQWUDFWRU¶VDFWLYLWLHVGR QRWLPSDFWVXUURXQGLQJDUHDV 'LVSRVDORIDOOZDVWHPDWHULDOVVKDOOEHFRQGXFWHGE\VXFKPDQQHUDQGWUDQVSRUWHGWRVXFK ORFDWLRQVWKDWQXLVDQFHRUGDPDJHWRWKHHQYLURQPHQWVWUXFWXUHVURDGVXWLOLWLHVDQGLQWHUIHUHQFH ZLWKRWKHUFRQVWUXFWLRQSURMHFWVZLOOEHSUHYHQWHG7KHGLVFKDUJHORFDWLRQRIZDVWHZDWHUVKDOOEH SURYLGHGDQGDSSURYHGE\WKH&LW\$OOFRVWVLQFXUUHGLQWKHGLVSRVDORIZDVWHZDWHUDQGUHPRYDO RIVROLGPDWHULDOVVKDOOEHDWWKHFRQWUDFWRU¶VH[SHQVH$OOFRVWVLQYROYHGZLWKWHPSRUDU\ FRQWDLQPHQWFRQYH\DQFHDQGPRQLWRULQJRIIOXLGVJHQHUDWHGGXULQJWHVWLQJVKDOOEHDWWKH FRQWUDFWRU¶VH[SHQVH %(URVLRQ&RQWURO ,IQHFHVVDU\WKH&RQWUDFWRUVKDOOLQVWDOOHURVLRQFRQWUROPHDVXUHVDQGGHYLFHVWRSUHYHQW ZRUNVLWHVWRUPUXQRIIDQGRUIOXLGVIURPOHDYLQJWKHVLWH8QGHUQRFLUFXPVWDQFHVVKDOOZDWHU IURPDQ\VRXUFHUHODWHGWRWKH:RUNRUVWRUPUXQRIIEHDOORZHGWROHDYHWKHVLWHRWKHUWKDQ WKURXJKSURSHUGLVSRVDOXQGHUWKH13'(6GLVFKDUJHSHUPLW$WWKHHQGRIWKH:RUNWKH &RQWUDFWRUVKDOOSURSHUO\GLVSRVHRIDOOHURVLRQFRQWUROGHYLFHVLIDQ\DWDQDSSURSULDWHORFDWLRQ %&RQWURORI'LVFKDUJHG:DWHUV 7KHFRQWUDFWRUVKDOOSURYLGHDOOSLSHOLQHIDFLOLWLHVDQGDSSXUWHQDQFHVIRUGLVFKDUJLQJSXPSHG ZDWHUIURPWKHZHOOVLWH7KHFRQWUDFWRUVKDOOFRQIRUPWRDOOZDVWHGLVFKDUJHUHTXLUHPHQWV LPSRVHGRQWKH&LW\E\WKH&DOLIRUQLD5HJLRQDO:DWHU4XDOLW\&RQWURO%RDUG/RV$QJHOHV 5HJLRQDQGSHUWKH13'(63HUPLW$OODFWLRQVQHFHVVDU\WRFRQIRUPWRWKHVHUHTXLUHPHQWVVKDOO EHSHUIRUPHGE\WKHFRQWUDFWRUDVDSDUWRIWKHFRQVWUXFWLRQFRQWUDFWDQGDOOH[SHQVHVWKHUHRI VKDOOEHFRQVLGHUHGWREHLQFOXGHGZLWKLQWKHYDULRXVELGLWHPV 7KH&LW\VKDOOEHQRWLILHGILYHGD\VSULRUWRFRPPHQFHPHQWRIDQ\ZRUNUHTXLULQJWKHGLVFKDUJH RIZHOOZDWHULQH[FHVVRIJDOORQV7KHFRQWUDFWRUVKDOOFRQQHFWDOOQHFHVVDU\WHPSRUDU\ SLSLQJIURPWKHZHOOWRWKHFDWFKEDVLQIRUGLVSRVDORIWKHGHYHORSPHQWDQGWHVWLQJZDWHU 7KHFRQWUDFWRUVKDOOREWDLQDSSURYDOIURPWKH&LW\¶VSURMHFWHQJLQHHUKHUHLQDIWHUUHIHUUHGWRDV ³(QJLQHHU´EHIRUHSURFHHGLQJZLWKDQ\DOWHUQDWLYHZDWHUGLVFKDUJHPHWKRGV,WLVWKH FRQWUDFWRU¶VUHVSRQVLELOLW\WRREWDLQDOOSHUPLWVDQGPHHWDOOUHTXLUHPHQWVQHFHVVDU\7KH FRQWUDFWRUVKDOOEHUHVSRQVLEOHIRUDOOFRVWVUHODWHGWRZDWHUGLVFKDUJHDQGQRDGGLWLRQDO FRPSHQVDWLRQVKDOOEHSDLGWR&RQWUDFWRUIRUDQ\DOWHUQDWLYHZDWHUGLVFKDUJHPHWKRGV %6LWH6HFXULW\ 7KHFRQWUDFWRUVKDOOPDNHDGHTXDWHSURYLVLRQVIRUWKHSURWHFWLRQRIWKHZRUNDUHDDQGWKHZHOO DJDLQVWILUHWKHIWDQGYDQGDOLVPDVZHOODVIRUWKHSURWHFWLRQRIWKHSXEOLFDJDLQVWH[SRVXUHWR LQMXU\ 7KHFRQWUDFWRUVKDOOEHDUWKHUHVSRQVLELOLW\IRUSURWHFWLRQRIHTXLSPHQWDQGPDWHULDORQWKH ZRUNVLWH'XULQJQLJKWWLPHKRXUVZHHNHQGVKROLGD\VDQGDOORWKHUWLPHVZKHQQRZRUNLVEHLQJ SHUIRUPHGDWWKHVLWHWKHFRQWUDFWRUPD\ZLVKWRSURYLGHWHPSRUDU\HQFORVXUHVDQGRUVHFXULW\ VHUYLFHVWRSURWHFWWKHVLWHIRUWKHFRQWUDFWRU¶VRZQEHQHILWDQGDW&RQWUDFWRU¶VRZQH[SHQVH WĂŐĞϰŽĨϴ %7HPSRUDU\:DWHU0HWHU ,IQHFHVVDU\WKHFRQWUDFWRUVKDOOREWDLQDWHPSRUDU\ZDWHUPHWHUIURPWKH&LW\RI9HUQRQ:DWHU 'LYLVLRQE\ILUVWFRQWDFWLQJWKH:DWHU6XSHULQWHQGHQWDQGWKHQSODFLQJDGHSRVLWRIZLWK WKH&XVWRPHU6HUYLFH'HSDUWPHQW7KHFRQWUDFWRUVKDOOSD\IRUDOOZDWHUXVHG$OOZDWHUVKDOOEH PHWHUHGDQGFDUHIXOO\FRQVHUYHG$QDOORZDQFHIRUWKHGLUHFWFRVWRIZDWHUXVDJHKDVEHHQ LGHQWLILHG&RQWUDFWRUPXVWSURYLGHSURRIRISD\PHQWWREHFRPSHQVDWHGIRUZDWHUXVHG1R PDUNXSZLOOEHDOORZHG7KHFRQWUDFWRUVKDOOQRWUHORFDWHWKHWHPSRUDU\PHWHUVHUYLFH,I &RQWUDFWRUQHHGVWRUHORFDWHWKHWHPSRUDU\PHWHUVHUYLFH&RQWUDFWRUVKDOOFDOOWKH&LW\RI 9HUQRQ:DWHU'LYLVLRQWRUHORFDWHWKHVHUYLFHDQGZLOOEHFKDUJHGDUHORFDWLRQIHH %6DIHW\RI3HUVRQQHODQG)LHOG(TXLSPHQW 7KHFRQWUDFWRUVKDOOHQVXUHWKDWLWVSHUVRQQHODUHSURSHUO\WUDLQHGLQWKHKDQGOLQJXVHDQG VWRUDJHRIKD]DUGRXVPDWHULDOVHJR[LGL]HUVDQGDFLGVDQGVKDOOKDYHSURSHUVDIHW\HTXLSPHQW LQDGGLWLRQWREDVLFSHUVRQDOSURWHFWLYHHTXLSPHQWRQWKHZRUNVLWHDWDOOWLPHVZKHQKDQGOLQJ KD]DUGRXVPDWHULDOV 7KHIROORZLQJVDIHW\PHDVXUHVVKDOOEHLPSOHPHQWHGE\&RQWUDFWRUSHUVRQQHODWDOOWLPHV$OO ZRUNVKDOOWDNHSODFHZLWKDGHTXDWHYHQWLODWLRQ$OOZRUNHUVVKDOOEHUHTXLUHGWRZDVKZLWKVRDS DQGZDWHUDIWHUKDQGOLQJFKHPLFDOVDQGSULRUWRHDWLQJGULQNLQJVPRNLQJRUXVLQJVDQLWDU\ IDFLOLWLHV7KHFRQWUDFWRUVKDOOHQVXUHDGHTXDWHZDWHUVXSSO\RQVLWHDWDOOWLPHVWRIOXVKVNLQDQG H\HVLQFDVHRIDFFLGHQWDOFKHPLFDOVSLOOV5HTXLUHGRQVLWHVDIHW\HTXLSPHQWVXSSOLHVVKDOO FRQVLVWRIEXWLVQRWOLPLWHGWRWKHIROORZLQJ D+DUGKDW E:DWHUUHVLVWDQWVWHHOWRHGERRWV F,PSDFWUHVLVWDQWVDIHW\JRJJOHV G6DIHW\YHVW H*ORYHV I7\YHNVXLWVDQGUHVSLUDWRUVZLWKDFLGDQG92&FDUWULGJHVDVUHTXLUHGDQG J(PHUJHQF\H\HZDVKVWDWLRQDVUHTXLUHG %5HKDELOLWDWLRQRI5HVHUYRLUDQG 7HFKQLFDO6SHFLILFDWLRQVDQG3ODQVIRUWKH5HKDELOLWDWLRQRI5HVHUYRLUVDQGFDQEH IRXQGLQ$WWDFKPHQW %5HVHUYRLU0L[HUV 6SHFLILFDWLRQVIRUWKH5HVHUYRLU0L[HUVFDQEHIRXQGLQ$WWDFKPHQW %3KRWRJUDSKLF6XUYH\5HSRUWVIRU5HVHUYRLUVDQG 5HVHUYRLUVDQGZHUHUHFHQWO\LQVSHFWHGLQ)HEUXDU\7KHUHSRUWVSUHSDUHG FRQWDLQSKRWRVGHWDLOLQJWKHFRQGLWLRQRIWKHLQWHULRUDQGH[WHULRUVXUIDFHV7KHUHSRUWVDUH LQFOXGHGDVUHIHUHQFHDQGFDQEHIRXQGLQ$WWDFKPHQW %/DERUDWRU\$QDO\VLV $ODERUDWRU\DQDO\VLVRIWKHLQWHULRUFRDWLQJDQGH[WHULRUSDLQWIRUHDFKUHVHUYRLULQFOXGHDV UHIHUHQFHFDQEHIRXQGLQ$WWDFKPHQW Page 5 of 8 Attachment 1 Technical Plans and Specifications for the Rehabilitation of Reservoirs 2-1, 2-2, and 2-3 NPROJECTLOCATIONNPROJECTLOCATIONNPROJECTLOCATIONPROJECTLOCATIONPROJECTACCESS GATEPROJECTACCESS GATE CONSTRUCTION NOTESReservoir 2-1 Dimensions: 80 ft. Dia. 30 ft. Ht. CONSTRUCTION NOTESReservoir 2-2 Dimensions: 80 ft. Dia. 30 ft. Ht.Reservoir 2-3 Dimensions: 80 ft. Dia. 30 ft. Ht. &,7<2)9(5121 7(&+1,&$/63(&,),&$7,216 )257+( 5(+$%,/,7$7,212)5(6(592,56$1' $8*867 0U0DUN$XPHQWDGR &LW\RI9HUQRQ 6DQWD)H$YHQXH 9HUQRQ&$ &,7<2)9(5121 5(6(592,56$1' 6(&7,21,1'(; 6(&7,21 6800$5<2):25. 5(6(592,5&2$7,1*$1'3$,17,1*63(&,),&$7,21 0,6&(//$1(2866758&785$/02',),&$7,21663(&,),&$7,21 &$7+2',&3527(&7,21%<*$/9$1,&$12'(6 +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV 6(&7,216800$5<2):25. 3$57*(1(5$/ :25.81'(57+,6&2175$&7 $ 7KH&RQWUDFWRUVKDOOIXUQLVKDOOODERUHTXLSPHQWDQGPDWHULDOVDVUHTXLUHGE\WKHVH VSHFLILFDWLRQVIRUWKHIROORZLQJUHVHUYRLUV7KHGLPHQVLRQVDUHDSSUR[LPDWHRQO\DQGVKDOO EHILHOGYHULILHGE\WKH&RQWUDFWRUSULRUWRELGGLQJ 5HVHUYRLU 6L]H 'LPHQVLRQV 7\SH 5HVHUYRLU 0* IW'LD[IW+W 5LYHWHG 5HVHUYRLU 0* IW'LD[IW+W :HOGHG 5HVHUYRLU 0* IW'LD[IW+W :HOGHG % :RUNWREHSHUIRUPHGLQFOXGHVDSSOLFDWLRQRISURWHFWLYHFRDWLQJVWRLQWHULRUVXUIDFHVDQG SDLQW WR H[WHULRU VXUIDFHV LQFOXGLQJ VXUIDFH SUHSDUDWLRQ KDQGOLQJ RI KD]DUGRXV DQG QRQKD]DUGRXV PDWHULDOVZDVWHV GLVLQIHFWLRQ RI LQWHULRU VXUIDFHV DQG PRGLILFDWLRQ RI PLVFHOODQHRXVVWUXFWXUDOLWHPVWREULQJWKHVWUXFWXUHVLQWRFRPSOLDQFHZLWKFXUUHQWVDIHW\ DQGKHDOWKFRGHVVWDQGDUGVDQGUHJXODWLRQVDQGRWKHUZRUNQHFHVVDU\WRDFFRPSOLVKWKH DSSURYHGHQGUHVXOWRIWRWDOO\SURWHFWHGDQGXVDEOHVWUXFWXUHVLQFOXGLQJDWWDFKPHQWV DFFHVVRULHVDQGDSSXUWHQDQFHV7KHIROORZLQJLWHPVDUHUHTXLUHGH[FHSWDVRWKHUZLVH QRWHGJHQHUDOO\DVIROORZV 5(6(592,5 ,7(06 7KHZDWHULQHDFKUHVHUYRLUZLOOEHSXPSHGGRZQE\WKH&LW\WRDSSUR[LPDWHO\ IHHW 7KH &RQWUDFWRU VKDOO UHPRYH WKH UHPDLQLQJ ZDWHU DQG VHGLPHQW (DFK UHVHUYRLUKDVDERWWRPGUDLQZKLFKGUDLQGLUHFWO\WRDVWRUPGUDLQ7KHZDWHUPXVW EHGHFKORULQDWHGDQGDQ\VHGLPHQWPXVWEHILOWHUHGSULRUWREHLQJGUDLQHGLQWRWKH VWRUPGUDLQ &RDOWDUHQDPHOSUHVHQWRQWKHORZHUIWRIWKHVKHOODQGERWWRPVXUIDFHVVKDOO EHUHPRYHGE\SQHXPDWLFPHFKDQLFDOFKLSSLQJPHWKRGSULRUWRDEUDVLYHEODVWLQJ 5HPRYHDOOLQWHULRUFRDWLQJVE\DEUDVLYHEODVWFOHDQLQJ D 7KH WRSVLGH RI WKH H[LVWLQJ UDIWHUV VKDOO EH EODVWHG DQG FRDWHG LQ DFFRUGDQFHZLWKWKHVSHFLILFDWLRQV E 7KHWRSVLGHRIWKHQHZUDIWHUVVKDOOEHEODVWHGDQGFRDWHGLQDFFRUGDQFH ZLWKWKHVSHFLILFDWLRQVSULRUWRLQVWDOODWLRQ $SSO\DWKUHHFRDWHSR[\FRDWLQJV\VWHPWRDOOLQWHULRUVXUIDFHVDERYHWKHERWWRP (OHFWULFDOO\GHWHFWHSR[\FRDWLQJV\VWHPQRWHGLQDERYHDQGUHSDLUDVUHTXLUHG $SSO\DVROLGVHSR[\FRDWLQJV\VWHPWRDOOLQWHULRUERWWRPVXUIDFHVDQGORZHU IHHWRIWKHVKHOODQGFROXPQV +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV (OHFWULFDOO\GHWHFWVROLGVHSR[\FRDWLQJV\VWHPDQGUHSDLUDVUHTXLUHG &XUHLQWHULRUHSR[\FRDWLQJDVVSHFLILHGKHUHLQ 7HVW KDQGOH DQG GLVSRVH RI KD]DUGRXV DQG QRQKD]DUGRXV FRDWLQJ ZDVWHV LQ FRQIRUPDQFHWRDOOUHJXODWLRQV $SSO\DIOH[LEOHVHDODQWWRDOOURRIODSVHDPVDQGLQDFFHVVLEOHYRLGVDVGHVLJQDWHG E\WKH(QJLQHHU :DVKGRZQLQWHULRUVXUIDFHVDQGGLVLQIHFWFRPSOHWHLQWHULRU 5HPRYHDOOSDLQWIURPH[WHULRUURRIVKHOOSLSLQJDQGDSSXUWHQDQFHVE\DEUDVLYH EODVWFOHDQLQJRURWKHUDSSURYHGPHWKRG $SSO\VSHFLILHGSULPHUWRDOOH[WHULRUVXUIDFHVRIWKHUHVHUYRLUQRWHGLQDERYH $SSO\LQWHUPHGLDWHDQGILQLVKFRDWVRISDLQWWRFRPSOHWHH[WHULRUVXUIDFHVSLSLQJ DQGDSSXUWHQDQFHVRIWKHUHVHUYRLUQRWHGLQDERYH 7HVWKDQGOHDQGGLVSRVHRIKD]DUGRXVDQGQRQKD]DUGRXVZDVWHVJHQHUDWHGIURP H[WHULRUSDLQWLQJRSHUDWLRQVLQFRQIRUPDQFHWRDOOUHJXODWLRQV 5HPRYHH[LVWLQJFHQWHUYHQWDQGURRISODWHVDVGHWHUPLQHGQHFHVVDU\E\WKH (QJLQHHUDQGIDEULFDWHDQGLQVWDOODQHZLQFKGLDPHWHUFHQWHUYHQWLQFOXGLQJ UHLQIRUFLQJSODWHILEHUJODVVFRYHUDQGURRISODWHVDVQHHGHG 5HPRYHDQGGLVSRVHRIWKHH[LVWLQJJXDUGUDLOGLDJRQDOVXSSRUWVDQGIXUQLVKDQG LQVWDOOQHZJXDUGUDLOLQJUHWXUQVZLWKNLFNSODWHVDWWKHURRIKDWFKZRUNDUHDVLQ DFFRUGDQFHZLWKWKHSODQV D5HVHUYRLU GRHV QRW KDYH GLDJRQDO VXSSRUWV WR UHPRYH 7KH QHZ UHWXUQVVKDOOEHLQVWDOOHGDWWKHHQGRIWKHJXDUGUDLOV E )XUQLVKDQGLQVWDOOQHZIRRWVHFWLRQVRIJXDUGUDLOVDWWKHWRSRIWKHODGGHU RSHQLQJRQ5HVHUYRLU 5HSODFHWKHH[LVWLQJURRIKDWFKFRYHUZLWKDQHZó´DOXPLQXPFRYHU )XUQLVKDQGLQVWDOODQHZVHFRQGDU\URRIKDWFKZLWKDLQFKGLDPHWHUFRXSOLQJLQ WKHKDWFKFXUEDWWKHORFDWLRQGHVLJQDWHGE\WKH(QJLQHHULQDFFRUGDQFHZLWKWKH SODQV7KHQHZURRIKDWFKVKDOOEH IURPWKHHGJHRIWKHURRI )XUQLVK DQG LQVWDOO D QHZ PL[LQJ DQG FKHPLFDO IHHG V\VWHPLQFOXGLQJ PL[HU FRQWUROSDQHODQGHQFORVXUHIRXUHDFKQR]]OHVDQGEDOOYDOYHVFRQGXLW XQLVWUXWVFRSSHUSLSHDQGURRIKDWFKFRXSOLQJLQDFFRUGDQFHZLWKWKHSODQVDQG VSHFLILFDWLRQV )XUQLVKDQGLQVWDOODQHZFRXSOLQJDQGEDOOYDOYHDWORFDWLRQGHVLJQDWHGE\WKH &LW\ +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV )XUQLVKDQGLQVWDOOQHZODGGHUVDIHW\V\VWHPRQWKHLQWHULRUODGGHUV )XUQLVKDQGLQVWDOODQHZIDOOUHVWUDLQWFDEOHV\VWHPLQDFFRUGDQFHZLWKWKHSODQV 5HPRYHDQGGLVSRVHRIOLTXLGOHYHOLQGLFDWRUDVVHPEO\DQGSLSLQJ)XUQLVKDQG ZHOGSODWHVRYHUWKHRSHQLQJVLQWKHURRI )XUQLVKDQGLQVWDOODQHZJDOYDQLFDQRGHFDWKRGLFSURWHFWLRQV\VWHPDVVKRZQRQ WKHSODQV D 5HPRYH DQG GLVSRVH RI WKH H[LVWLQJ FDWKRGLF SURWHFWLRQ V\VWHP RQ 5HVHUYRLU 5HPRYHWKHH[LVWLQJLQOHWGLIIXVHUER[DQGIXUQLVKDQGLQVWDOODQHZLQOHWGLIIXVHU ER[LQDFFRUGDQFHZLWKWKHSODQV 5HPRYHDVSKDOWEHWZHHQWKHFRQFUHWHJUDGHEDQGDQGUHVHUYRLUERWWRPSODWH H[WHQVLRQ5HPRYHJUDYHODQGGLUWZLWKLQWKHFRQFUHWHJUDGHEDQGRIWKHUHVHUYRLU DPLQLPXPRILQFKHVEHORZWKHERWWRPSODWHH[WHQVLRQDQGSODFHQHZFOHDQ JUDYHOZLWKLQWKHFRQFUHWHJUDGHEDQGXSWRWKHERWWRPSODWHH[WHQVLRQ 5(6(592,5,7(06 0RGLI\WKHH[LVWLQJRYHUIORZWRH[WHQGWKHRYHUIORZSLSHWRDPLQLPXPLQFKHV DQGPD[LPXPLQFKHVIURPWKHVSODVKSDG)XUQLVKDQGLQVWDOOQHZSLSHDQG SLSHEUDFNHWVDQGUHORFDWHWKHH[LVWLQJSDVVLYHFKHFNYDOYHWRWKHHQGRIWKHQHZ SLSH :LGHQWKHWRSRIWKHODGGHUDQGPRGLI\JXDUGUDLOWRSURYLGHDPLQLPXPDQG PD[LPXPRSHQLQJDQGEUDFHWKHVDIHW\FOLPELQDFFRUGDQFHZLWKWKHSODQV )XUQLVKDQGLQVWDOODQHZVHOIFORVLQJKLQJHGJDWHDWWKHHQGRIWKHQHZIRRW VHFWLRQVRIJXDUGUDLOVLQDFFRUGDQFHZLWKWKHSODQV )XUQLVKDQGLQVWDOODQHZODGGHUVDIHW\V\VWHPRQWKHH[WHULRUODGGHUDQGEUDFH GLVPRXQWVHFWLRQLQDFFRUGDQFHZLWKWKHSODQV 5HPRYHWRSUXQJIURPWKHLQWHULRUODGGHU 5(6(592,5237,21$/,7(06 3URYLGHGHKXPLGLILFDWLRQV\VWHPIRULQWHULRUZRUNLQFOXGLQJFXULQJWKHFRDWLQJDV GHWHUPLQHGQHFHVVDU\E\WKH&LW\ )LOO RU ZHOG SODWHV RYHU H[FHVVLYHO\ SLWWHG RU FRUURGHG DUHDV DV GHWHUPLQHG QHFHVVDU\E\WKH(QJLQHHU ([FHVVLYHO\FRUURGHGDUHDVRQWKHUDIWHUVDQGRUJLUGHUIODQJHVWKDWFRPSULVHRI VKDUS HGJHV IURP VDQGEODVWLQJ VKDOO EH JURXQG VPRRWK DQG URXQGHG DV GHWHUPLQHGQHFHVVDU\E\WKH(QJLQHHU +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV )XUQLVK DOO ODERU PDWHULDOV DQG HTXLSPHQW WR DEUDVLYHO\ EODVW FOHDQ VHYHUHO\ FRUURGHGDUHDVDVGHWHUPLQHGQHFHVVDU\E\WKH(QJLQHHU 5HPRYHDQGUHSODFHIWVHFWLRQRIVHYHUHO\FRUURGHGUDIWHUVDVGHWHUPLQHG QHFHVVDU\E\WKH(QJLQHHU 5HPRYH DQG UHSODFH VHYHUHO\ FRUURGHG QXWV DQG EROWV RQ WKHVWUXFWXUDO FRQQHFWLRQVDVGHWHUPLQHGQHFHVVDU\E\(QJLQHHU 5(6(592,5,7(06 5HPRYHDQGGLVSRVHRIWKHH[LVWLQJRYHUIORZSLSHDQGIXUQLVKDQGLQVWDOODQHZ RYHUIORZSLSHVKHOOQR]]OHSLSHEUDFNHWVDQGSDVVLYHFKHFNYDOYH )XUQLVKDQGLQVWDOOQHZODWHUDOEUDFLQJDWWKHPLGVSDQRIWKHIXOOOHQJWKUDIWHUVDQG ZHOGH[LVWLQJ-DFNUDIWHUKHDGHUWRWKHH[LVWLQJIXOOOHQJWKUDIWHULQDFFRUGDQFHZLWK WKHSODQV 5HPRYHWRSUXQJIURPWKHLQWHULRUODGGHU 5(6(592,5237,21$/,7(06 3URYLGHGHKXPLGLILFDWLRQV\VWHPIRULQWHULRUZRUNLQFOXGLQJFXULQJWKHFRDWLQJDV GHWHUPLQHGQHFHVVDU\E\WKH&LW\ )LOO RU ZHOG SODWHV RYHU H[FHVVLYHO\ SLWWHG RU FRUURGHG DUHDV DV GHWHUPLQHG QHFHVVDU\E\WKH(QJLQHHU ([FHVVLYHO\FRUURGHGDUHDVRQWKHUDIWHUVDQGRUJLUGHUIODQJHVWKDWFRPSULVHRI VKDUS HGJHV IURP VDQGEODVWLQJ VKDOO EH JURXQG VPRRWK DQG URXQGHG DV GHWHUPLQHGQHFHVVDU\E\WKH(QJLQHHU )XUQLVK DOO ODERU PDWHULDOV DQG HTXLSPHQW WR DEUDVLYHO\ EODVW FOHDQ VHYHUHO\ FRUURGHGDUHDVDVGHWHUPLQHGQHFHVVDU\E\WKH(QJLQHHU 5HPRYHDQGUHSODFHFHQWHUVXSSRUWVWUXFWXUHLQOLNHNLQG 5HPRYH DQG UHSODFH VHYHUHO\ FRUURGHG QXWV DQG EROWV RQ WKHVWUXFWXUDO FRQQHFWLRQVDVGHWHUPLQHGQHFHVVDU\E\(QJLQHHU 5(6(592,5,7(06 5HPRYHDQGGLVSRVHRIWKHH[LVWLQJRYHUIORZSLSHDQGIXUQLVKDQGLQVWDOODQHZ RYHUIORZSLSHVKHOOQR]]OHSLSHEUDFNHWVDQGSDVVLYHFKHFNYDOYH )XUQLVKDQGLQVWDOOQHZODWHUDOEUDFLQJDWWKHPLGVSDQRIWKHIXOOOHQJWKUDIWHUVDQG ZHOGH[LVWLQJ-DFNUDIWHUKHDGHUWRWKHH[LVWLQJIXOOOHQJWKUDIWHULQDFFRUGDQFHZLWK WKHSODQVLQDFFRUGDQFHZLWKWKHSODQV 5(6(592,5237,21$/,7(06 +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV 3URYLGHGHKXPLGLILFDWLRQV\VWHPIRULQWHULRUZRUNLQFOXGLQJFXULQJWKHFRDWLQJDV GHWHUPLQHGQHFHVVDU\E\WKH&LW\ )LOO RU ZHOG SODWHV RYHU H[FHVVLYHO\ SLWWHG RU FRUURGHG DUHDV DV GHWHUPLQHG QHFHVVDU\E\WKH(QJLQHHU ([FHVVLYHO\FRUURGHGDUHDVRQWKHUDIWHUVDQGRUJLUGHUIODQJHVWKDWFRPSULVHRI VKDUS HGJHV IURP VDQGEODVWLQJ VKDOO EH JURXQG VPRRWK DQG URXQGHG DV GHWHUPLQHGQHFHVVDU\E\WKH(QJLQHHU )XUQLVK DOO ODERU PDWHULDOV DQG HTXLSPHQW WR DEUDVLYHO\ EODVW FOHDQ VHYHUHO\ FRUURGHGDUHDVDVGHWHUPLQHGQHFHVVDU\E\WKH(QJLQHHU 5HPRYH DQG UHSODFH VHYHUHO\ FRUURGHG QXWV DQG EROWV RQ WKHVWUXFWXUDO FRQQHFWLRQVDVGHWHUPLQHGQHFHVVDU\E\(QJLQHHU & 6XUIDFHV QRW WR EH SDLQWHG LQFOXGH IHQFLQJ FRQFUHWH VXUIDFHV OLTXLG OHYHO LQGLFDWRU DFFHVVRULHVJODVVSODVWLFQDPHSODWHVFRPPXQLFDWLRQHTXLSPHQWLQWUXVLRQVZLWFKHV DQGRWKHUVXUIDFHVRQZKLFKFRDWLQJVRUSDLQWZRXOGQRWDGKHUHRUZRXOGLQWHUIHUHZLWK RSHUDWLRQRIVSHFLILFLWHP ' ,IVHYHUHO\FRUURGHGRUGDPDJHGDUHDVDUHGLVFRYHUHGGXULQJWKHFRXUVHRIDEUDVLYHEODVW FOHDQLQJRSHUDWLRQVWKH&RQWUDFWRUVKDOOQRWLI\WKH(QJLQHHURUDXWKRUL]HGUHSUHVHQWDWLYH :HOGLQJDQGUHSDLURIVHYHUHO\FRUURGHGDUHDVRIUHVHUYRLUDQGRWKHUPHFKDQLFDOUHSDLUV PD\EHUHTXLUHGGXULQJSURMHFW 7KH&RQWUDFWRUVKDOODOORZWKH&LW\DFFHVVWRPDNHUHVHUYRLUUHSDLUVZKLOHWKH H[LVWLQJFRDWLQJVRUSDLQWVDUHEHLQJUHPRYHG $WLPHH[WHQVLRQZLOOEHLVVXHGVKRXOGVWUXFWXUDOUHSDLUVSUHFOXGHDEUDVLYHEODVW FOHDQLQJDQGRUFRDWLQJRUSDLQWDSSOLFDWLRQ3UHSDUDWLRQZRUNVKDOOFRQWLQXHZKLOH UHVHUYRLUUHSDLUVDUHEHLQJPDGH7KHWLPHH[WHQVLRQZLOODVVXPHWKH&RQWUDFWRU ZLOOEHDEOHWRUHPRELOL]HDQGEHJLQFRDWLQJDQGSDLQWLQJZLWKLQWZRZHHNVRI QRWLILFDWLRQ1RDGGLWLRQDOWLPHZLOOEHJUDQWHGWRSHUPLWWKH&RQWUDFWRUWRFRPSOHWH RWKHUSURMHFWVSULRUWRWKLVSURMHFW 5()(5(1&(63(&,),&$7,216$1'67$1'$5'6 $ :LWKRXWOLPLWLQJWKHJHQHUDODVSHFWVRURWKHUUHTXLUHPHQWVRIWKLVVSHFLILFDWLRQZRUNDQG HTXLSPHQWVKDOOFRQIRUPWRDSSOLFDEOHUHTXLUHPHQWVRIPXQLFLSDOVWDWHDQGIHGHUDOFRGHV ODZVDQGRUGLQDQFHVJRYHUQLQJWKHZRUNPDQXIDFWXUHU¶VSULQWHGLQVWUXFWLRQVVXEMHFWWR (QJLQHHU¶VDSSURYDO % 7KH(QJLQHHU¶VGHFLVLRQVKDOOEHILQDODVWRLQWHUSUHWDWLRQDQGRUFRQIOLFWEHWZHHQDQ\RI WKHUHIHUHQFHGFRGHVODZVRUGLQDQFHVVSHFLILFDWLRQVDQGVWDQGDUGVFRQWDLQHGKHUHLQ '(),1,7,216 $ 7KHIROORZLQJSDLUVRIZRUGVVKDOOEHFRQVLGHUHGLGHQWLFDOLQPHDQLQJDQGPD\EHXVHG LQWHUFKDQJHDEO\ ³&LW\´ DQG ³2ZQHU´ ³*HQHUDO &RQGLWLRQV´ DQG ³*HQHUDO 3URYLVLRQV´ +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV ³'UDZLQJV´DQG³3ODQV´³6WDQGDUG'UDZLQJV´DQG³6WDQGDUG3ODQV´ % 7KH&LW\UHIHUUHGWRLQWKHVHVSHFLILFDWLRQVLV&LW\RI9HUQRQ(QJLQHHUVKDOOEHSHUVRQRU SHUVRQVDVGHVLJQDWHGE\WKH&LW\ & 7KHGHILQLWLRQRIWKHZRUG³(QJLQHHU´FRQWDLQHGKHUHLQLV7KHSHUVRQDXWKRUL]HGE\WKH &LW\WRRYHUVHHWKHH[HFXWLRQRIWKHFRQWUDFWDFWLQJHLWKHUGLUHFWO\RUWKURXJKKLVSURSHUO\ DXWKRUL]HGDJHQWVHDFKDJHQWDFWLQJRQO\ZLWKLQWKHVFRSHRIDXWKRULW\GHOHJDWHGWRKLP +28562):25. $ 7KH&RQWUDFWRU¶VDFWLYLWLHVVKDOOEHFRQILQHGWRDQHLJKWKRXUVKLIWEHWZHHQWKHKRXUVRI DPDQGSP0RQGD\WKURXJK)ULGD\H[FOXGLQJ&LW\GHVLJQDWHGKROLGD\V 'HYLDWLRQIURPWKHVHKRXUVZLOOQRWEHSHUPLWWHGZLWKRXWWKHSULRUFRQVHQWRIWKH&LW\ H[FHSWLQHPHUJHQFLHVLQYROYLQJLPPHGLDWHKD]DUGWRSHUVRQVRUSURSHUW\ % ,QWKHHYHQWRIHLWKHUDUHTXHVWHGRUHPHUJHQF\GHYLDWLRQLQVSHFWLRQVHUYLFHIHHVIRU&LW\ SHUVRQQHODQGDQ\WKLUGSDUW\LQVSHFWRUZLOOEHFKDUJHGDJDLQVWWKH&RQWUDFWRU7KH VHUYLFHIHHVZLOOEHFDOFXODWHGDWIXOORYHUWLPHUDWHVLQFOXGLQJEHQHILWVRYHUKHDGDQGWUDYHO WLPH7KHVHUYLFHIHHVZLOOEHGHGXFWHGIURPDQ\DPRXQWVGXHWKH&RQWUDFWRU&KDUJHV ZLOOEHPDGHIRUDQ\FKDQJHWRH[WUDRUGLQDU\ZRUNKRXUVLQFOXGLQJVWDQGE\WLPHGXHWR ODWHFUHZDUULYDORU³QRVKRZ´E\FUHZ & ,QVSHFWLRQKRXUVPDGHQHFHVVDU\DVDUHVXOWRIWKH&RQWUDFWRU¶VFUHZZRUNLQJRYHUIRUW\ KRXUVSHUZHHNPXVWEHVFKHGXOHGDQGDSSURYHGE\&LW\DQGSDLGIRUE\&RQWUDFWRUDW WKHSUHYDLOLQJUDWHIRURYHUWLPH,QVSHFWLRQVUHTXHVWHGE\RUPDGHQHFHVVDU\DVDUHVXOW RIDFWLRQVE\WKH&RQWUDFWRURQ6DWXUGD\V6XQGD\VRUKROLGD\VPXVWEHVFKHGXOHGDQG DSSURYHGE\&LW\DQGSDLGIRUE\&RQWUDFWRUDWWKHSUHYDLOLQJUDWHIRURYHUWLPHRUKROLGD\ ZRUN ' &RQWUDFWRU VKDOO SHUIRUP DOO PRGLILFDWLRQV LQWHULRU VXUIDFH SUHSDUDWLRQ DQG FRDWLQJ DSSOLFDWLRQXWLOL]LQJDPLQLPXPRIWZREODVWQR]]OHVSHUVKLIWZRUNLQJDPLQLPXPRI RQHHLJKWKRXUVKLIWSHUGD\IRUGXUDWLRQRIDOOLQWHULRUZRUN &203/(7,212):25. $OO ZRUN VKDOO EH FRPSOHWHG ZLWKLQ WKH QXPEHU RI FDOHQGDU GD\VFRQVLVWHQW ZLWK WKH &RQWUDFW3HULRGQRWHGLQWKH&RQWUDFW'RFXPHQWV,IZRUNLVQRWFRPSOHWHGZLWKLQWKH QXPEHURIFDOHQGDUGD\VVSHFLILHG&RQWUDFWRUVKDOOEHDUDOODGGLWLRQDOH[SHQVHVLQFXUUHG DIWHUFRQWUDFWFRPSOHWLRQVFKHGXOH (;75$:25. $ 7KH&LW\PD\DVWKHQHHGDULVHVRUGHUFKDQJHVLQZRUNWKURXJKDGGLWLRQVGHOHWLRQVRU PRGLILFDWLRQVZLWKRXWLQYDOLGDWLQJWKH&RQWUDFW6XFKFKDQJHVZLOOEHDIIHFWHGWKURXJK ZULWWHQFKDQJHRUGHUVGHOLYHUHGWRWKH&RQWUDFWRUGHVFULELQJWKHFKDQJHUHTXLUHGLQWKH ZRUNWRJHWKHUZLWKDQ\DGMXVWPHQWLQFRQWUDFWSULFHRUWLPHRIFRPSOHWLRQDVKHUHLQDIWHU SURYLGHG1RVXFKFKDQJHVKDOOFRQVWLWXWHWKHEDVLVRIFODLPVIRUGDPDJHVRUDQWLFLSDWHG SURILWVKRZHYHUWKH(QJLQHHUZLOOPDNHUHDVRQDEOHDOORZDQFHIRUWKHYDOXHRIDQ\ZRUN PDWHULDOVRUHTXLSPHQWIXUQLVKHGDQGVXEVHTXHQWO\UHQGHUHGXVHOHVVEHFDXVHRIVXFK FKDQJH$Q\DGMXVWPHQWLQ&RQWUDFWSULFHUHVXOWLQJIURPDFKDQJHRUGHUZLOOEHFRQVLGHUHG +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV LQFRPSXWLQJVXEVHTXHQWPRQWKO\SD\PHQWVGXHWKH&RQWUDFWRU$Q\ZRUNSHUIRUPHGLQ DFFRUGDQFHZLWKDFKDQJHRUGHUVKDOOEHVXEMHFWWRDOOSURYLVLRQVRIWKHRULJLQDO&RQWUDFW DQGWKH&RQWUDFWRU¶VVXUHWLHVVKDOOEHERXQGWKHUHE\WRWKHVDPHGHJUHHDVXQGHUWKH RULJLQDO&RQWUDFW7KH&RQWUDFWRUZLOOQRWUHFHLYHSD\PHQWIRUH[WUDZRUNSHUIRUPHGXQOHVV VDLGH[WUDZRUNLVRUGHUHGLQZULWLQJ % $Q\DGMXVWPHQWLQFRQWUDFWSULFHVKDOOEHEDVHGRQXQLWSULFHELGLWHPVRUDGGLWLYHDQG GHGXFWLYHELGLWHPVVXEPLWWHGE\WKH&RQWUDFWRULQKLVRULJLQDOELGRQWKHZRUNZKHUHVXFK ELGLWHPVDUHDSSOLFDEOHRUWLPHDQGPDWHULDOUDWHVHVWDEOLVKHGDWWKH3UH&RQVWUXFWLRQ &RQIHUHQFH 48$/,7<$6685$1&( $ *HQHUDO4XDOLW\DVVXUDQFHSURFHGXUHVDQGSUDFWLFHVVKDOOEHXWLOL]HGWRPRQLWRUDOO SKDVHVRIVXUIDFHSUHSDUDWLRQDSSOLFDWLRQDQGLQVSHFWLRQWKURXJKRXWWKHGXUDWLRQRIWKH SURMHFW3URFHGXUHVRUSUDFWLFHVQRWVSHFLILFDOO\GHILQHGKHUHLQPD\EHXWLOL]HGSURYLGHG WKH\PHHWUHFRJQL]HGDQGDFFHSWDEOHSURIHVVLRQDOVWDQGDUGVDQGDUHDSSURYHGE\WKH (QJLQHHU % $OOPDWHULDOVIXUQLVKHGDQGDOOZRUNDFFRPSOLVKHGXQGHUWKH&RQWUDFWVKDOOEHVXEMHFWWR LQVSHFWLRQE\WKH(QJLQHHU7KH&RQWUDFWRUVKDOOEHKHOGVWULFWO\WRWKHWUXHLQWHQWRIWKH 6SHFLILFDWLRQVLQUHJDUGWRTXDOLW\RIPDWHULDOVZRUNPDQVKLSDQGGLOLJHQWH[HFXWLRQRIWKH &RQWUDFW & :RUN DFFRPSOLVKHG LQ WKH DEVHQFH RI SUHVFULEHG LQVSHFWLRQ PD\ EH UHTXLUHG WR EH UHPRYHGDQGUHSODFHGXQGHUWKHSURSHULQVSHFWLRQDQGWKHHQWLUHFRVWRIUHPRYDODQG UHSODFHPHQWLQFOXGLQJWKHFRVWRIDOOPDWHULDOVZKLFKPD\EHIXUQLVKHGE\WKH&LW\DQG XVHGLQWKHZRUNWKXVUHPRYHGVKDOOEHERUQHE\WKH&RQWUDFWRUUHJDUGOHVVRIZKHWKHU WKHZRUNUHPRYHGLVIRXQGWREHGHIHFWLYHRUQRW:RUNFRYHUHGXSZLWKRXWWKHDXWKRULW\ RIWKH(QJLQHHURU,QVSHFWRUVKDOOXSRQRUGHURIWKH(QJLQHHUEHXQFRYHUHGWRWKHH[WHQW UHTXLUHGDQGWKH&RQWUDFWRUVKDOOVLPLODUO\EHDUWKHHQWLUHFRVWRIDFFRPSOLVKLQJDOOWKH ZRUNDQGIXUQLVKLQJDOOWKHPDWHULDOVQHFHVVDU\IRUWKHUHPRYDORIWKHFRYHULQJDQGLWV VXEVHTXHQWUHSODFHPHQWDVGLUHFWHGDQGDSSURYHGE\WKH(QJLQHHU ' ([FHSWDVRWKHUZLVHSURYLGHGKHUHLQWKHFRVWRILQVSHFWLRQZLOOEHSDLGE\WKH&LW\ ( 7KH(QJLQHHUZLOOPDNHRUKDYHPDGHVXFKWHVWVDVKHGHHPVQHFHVVDU\WRHQVXUHWKH ZRUNLVEHLQJDFFRPSOLVKHGLQDFFRUGDQFHZLWKWKHUHTXLUHPHQWVRIWKH&RQWUDFW8QOHVV RWKHUZLVHVSHFLILHGLQWKH6SHFLDO&RQGLWLRQVWKHFRVWRIVXFKWHVWLQJZLOOEHERUQHE\WKH &LW\,QWKHHYHQWVXFKWHVWVUHYHDOQRQFRPSOLDQFHZLWKWKHUHTXLUHPHQWVRIWKH&RQWUDFW WKH&RQWUDFWRUVKDOOEHDUWKHFRVWRIVXFKFRUUHFWLYHPHDVXUHVGHHPHGQHFHVVDU\E\WKH (QJLQHHUDVZHOODVWKHFRVWRIVXEVHTXHQWUHWHVWLQJDQGUHLQVSHFWLRQ,WLVXQGHUVWRRG DQGDJUHHGWKHPDNLQJRIWHVWVVKDOOQRWFRQVWLWXWHDQDFFHSWDQFHRIDQ\SRUWLRQRIWKH ZRUNQRUUHOLHYHWKH&RQWUDFWRUIURPFRPSOLDQFHZLWKWKHWHUPVRIWKH&RQWUDFW ) :DUUDQW\,QVSHFWLRQ:DUUDQW\LQVSHFWLRQVKDOOEHFRQGXFWHGEHWZHHQWKHHOHYHQWKDQG VL[WHHQWKPRQWKVIROORZLQJFRPSOHWLRQRIDOOZRUNDQGILOLQJRIWKH1RWLFHRI$FFHSWDQFH 7KH GUDLQLQJ RI WKH UHVHUYRLUV ZLOO EH DFFRPSOLVKHG ZKHQ WKHUHZLOO EH PLQLPXP LQFRQYHQLHQFHWRWKH&LW\$OOSHUVRQQHOSUHVHQWDWWKH3UH&RQVWUXFWLRQ&RQIHUHQFH VKRXOG EH SUHVHQW DW WKLV LQVSHFWLRQ $OO GHIHFWLYH ZRUN VKDOO EH UHSDLUHG LQ VWULFW DFFRUGDQFHZLWKWKLVVSHFLILFDWLRQDQGWRWKHVDWLVIDFWLRQRIWKH(QJLQHHU +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV 1RWLILFDWLRQ7KH&LW\VKDOOHVWDEOLVKWKHGDWHIRUWKHLQVSHFWLRQDQGVKDOOQRWLI\ WKH&RQWUDFWRUDWOHDVWGD\VLQDGYDQFH7KH&LW\ZLOOGUDLQWKHUHVHUYRLUDQG &RQWUDFWRUVKDOOSURYLGHDWKLVRZQH[SHQVHVXLWDEOHOLJKWLQJVFDIIROGLQJDQG YHQWLODWLRQIRUWKHLQVSHFWLRQ$WWKH&LW\¶VRSWLRQZDUUDQW\LQVSHFWLRQIRULQWHULRU VXUIDFHVPD\EHDFFRPSOLVKHGE\GLYLQJRSHUDWLRQVZLWKUHVHUYRLULQVHUYLFH ,QWHULRU,QVSHFWLRQ7KHHQWLUHLQWHULRUFRDWLQJV\VWHPVVKDOOEHYLVXDOO\LQVSHFWHG DV VSHFLILHG LQ 48$/,7< $6685$1&( $OO GHIHFWLYH FRDWLQJ DV ZHOO DV GDPDJHGRUUXVWLQJVSRWVRIWKHUHVHUYRLUVKDOOEHVDWLVIDFWRULO\UHSDLUHGE\DQGDW WKHVROHH[SHQVHRIWKH&RQWUDFWRU$OOUHSDLUHGDUHDVVKDOOWKHQEHHOHFWULFDOO\ WHVWHGDVVSHFLILHGLQWKHDERYHPHQWLRQHGVHFWLRQDQGUHSDLUHOHFWULFDOWHVWLQJ SURFHGXUHUHSHDWHGXQWLOVXUIDFHLVDFFHSWDEOHWRWKH(QJLQHHU ([WHULRU,QVSHFWLRQ7KHHQWLUHH[WHULRUSDLQWV\VWHPVVKDOOEHYLVXDOO\LQVSHFWHG DVVSHFLILHGLQ48$/,7<$6685$1&($OOGHIHFWLYHSDLQWDVZHOODVGDPDJHG RUUXVWLQJVSRWVRIWKHUHVHUYRLUVKDOOEHVDWLVIDFWRULO\UHSDLUHGE\DQGDWWKHVROH H[SHQVHRIWKH&RQWUDFWRU$OOUHSDLUHGDUHDVVKDOOWKHQEHDJDLQLQVSHFWHGDV VSHFLILHG LQ WKH DERYHPHQWLRQHG VHFWLRQ DQG UHSDLU SURFHGXUH UHSHDWHG XQWLO VXUIDFHLVDFFHSWDEOHWRWKH(QJLQHHU 6WUXFWXUDO,QVSHFWLRQ7KHHQWLUHZRUNVKDOOEHYLVXDOO\LQVSHFWHGDVVSHFLILHG$OO GHIHFWLYHZRUNVKDOOEHVDWLVIDFWRULO\UHSDLUHGE\DQGDWWKHVROHH[SHQVHRIWKH &RQWUDFWRU ,QVSHFWLRQ5HSRUW7KH(QJLQHHUVKDOOSUHSDUHDQLQVSHFWLRQUHSRUWFRYHULQJWKH ILUVWDQQLYHUVDU\LQVSHFWLRQVHWWLQJIRUWKWKHQXPEHUDQGW\SHRIGHIHFWVREVHUYHG IDLOXUHVREVHUYHGWKHSHUFHQWDJHRIWKHVXUIDFHDUHDZKHUHIDLOXUHKDVRFFXUUHG DQGWKHQDPHVRIWKHSHUVRQVPDNLQJWKHLQVSHFWLRQ 6FKHGXOH8SRQFRPSOHWLRQRILQVSHFWLRQDQGUHFHLSWRI,QVSHFWLRQ5HSRUWDV QRWHGKHUHLQ&LW\VKDOOQRWLI\&RQWUDFWRURIUHVXOWVRILQVSHFWLRQDQGHVWDEOLVKD GDWHIRU&RQWUDFWRUWRSURFHHGZLWKUHPHGLDOZRUN$Q\GHOD\RQSDUWRI&RQWUDFWRU WRPHHWVFKHGXOHPD\FDXVH&LW\WRSURFHHGWRKDYHGHIHFWVUHPHGLHGE\RWKHUV DVRXWOLQHGXQGHU*HQHUDO3URYLVLRQV 5HPHGLDO:RUN7KH&RQWUDFWRUVKDOOPDNHUHSDLUVDWDOOSRLQWVZKHUHGHIHFWVDUH REVHUYHGE\UHPRYLQJWKHGHIHFWLYHZRUNDQGUHSDLULQJRUUHSODFLQJLWWREULQJWKH LWHP LQWR WRWDO FRQIRUPDQFH WR WKH RULJLQDO VSHFLILFDWLRQ $Q\ ORFDWLRQ ZKHUH FRDWLQJRUSDLQWKDVSHHOHGEXEEOHGRUFUDFNHGDQGDQ\ORFDWLRQZKHUHUXVWLQJLV HYLGHQWVKDOOEHFRQVLGHUHGWREHDIDLOXUHRIWKHV\VWHP7KH&RQWUDFWRUVKDOO PDNHUHSDLUVDWDOOSRLQWVZKHUHIDLOXUHVDUHREVHUYHGE\UHPRYLQJWKHGHWHULRUDWHG FRDWLQJRUSDLQWFOHDQLQJWKHVXUIDFHDQGUHDSSO\LQJWKHVDPHV\VWHPSHURULJLQDO VSHFLILFDWLRQ,IWKHDUHDRIIDLOXUHH[FHHGVSHUFHQWRIDVSHFLILFFRDWHGRU SDLQWHGVXUIDFHWKHHQWLUHDSSOLHGV\VWHPPD\EHUHTXLUHGWREHUHPRYHGDQG UHDSSOLHG EDVHG RQ WKH &LW\¶V VROH MXGJPHQW LQ DFFRUGDQFH ZLWKWKH RULJLQDO VSHFLILFDWLRQ D 6SHFLILFFRDWHGVXUIDFHVDUHGHILQHGDVIROORZV 8QGHUVLGHRIURRIDQGVWUXFWXUDOPHPEHUV +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV 6KHOO FROXPQV %RWWRP $WWDFKPHQWVDFFHVVRULHVDQGDSSXUWHQDQFHV )OH[LEOHVHDODQWV E 6SHFLILFSDLQWHGVXUIDFHVDUHGHILQHGDVIROORZV 5RRI 6KHOO $WWDFKPHQWVDFFHVVRULHVDQGDSSXUWHQDQFHV )OH[LEOHVHDODQWV 8SRQFRPSOHWLRQRIZDUUDQW\UHPHGLDOUHSDLUV&RQWUDFWRUVKDOOZDVKGRZQDQG GLVLQIHFWUHVHUYRLUDVRULJLQDOO\VSHFLILHG&RQWUDFWRUVKDOOSURYLGHQHZZKLWH16) DSSURYHGJDVNHWVIRUWKHPDQKROHVDVQHHGHG &RVWV$OOQRWHGFRVWVIRU&RQWUDFWRU¶VLQVSHFWLRQDQGDOOFRVWVIRUUHSDLUVKDOOEH ERUQHE\WKH&RQWUDFWRUDQGLQILJXULQJKLVELGWKH&RQWUDFWRUVKDOOLQFOXGHDQ DSSURSULDWHDPRXQWIRUWHVWLQJDQGUHSDLUDVQRDGGLWLRQDODOORZDQFHZLOOEHSDLG E\WKH&LW\IRUVDLGLQVSHFWLRQDQGUHSDLU 6$)(7<$1'+($/7+5(48,5(0(17 $ &RQWUDFWRUVKDOOVXEPLWDQRWDUL]HGOHWWHUVLJQHGE\DSULQFLSDORIILFHURIWKH&RUSRUDWLRQ RU&RPSDQ\FHUWLI\LQJWKH&RQWUDFWRUIXOO\FRPSOLHVZLWK)HGHUDODQG6WDWH5HJXODWLRQV SHUWDLQLQJWRWKHZRUNLQFOXGLQJEXWQRWOLPLWHGWRWKHIROORZLQJ5HYLHZRI&RQWUDFWRU¶V VDIHW\SODQE\(QJLQHHUGRHVQRWLPSO\WKDW&LW\DFFHSWVUHVSRQVLELOLW\IRUVXFKSODQVRU VDIHW\DFWLYLWLHV ,OOQHVV,QMXU\3UHYHQWLRQ3URJUDP &62*,62 &RQILQHG6SDFH3ODQ*,62 5HVSLUDWRU\3URWHFWLRQ &62*,62 +D]DUG&RPPXQLFDWLRQ *,62 /HDG%DVHG3DLQW&RPSOLDQFH3ODQ &62 5ROOLQJ6FDIIROGV &62 (PSOR\HH6DIHW\,QVWUXFWLRQ &62 (PHUJHQF\0HGLFDO6HUYLFH &62 +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV 'XVWV)XPHV0LVWV9DSRUV *DVHV &62 % *HQHUDO &RQWUDFWRU DVVXPHV WKH UHVSRQVLELOLW\ WR DFFRPSOLVK DOO ZRUN LQ D VDIH DQG SUXGHQWPDQQHUDQGWRFRQIRUPWRDOODSSOLFDEOHVDIHW\UHTXLUHPHQWVUHJXODWLRQVDQG JXLGHOLQHV RI IHGHUDO VWDWH DQG ORFDO UHJXODWRU\ DJHQFLHV DVZHOO DV DSSOLFDEOH PDQXIDFWXUHU¶V SULQWHG LQVWUXFWLRQV DQG DSSURSULDWH WHFKQLFDO EXOOHWLQV DQG PDQXDOV :LWKRXWLQDQ\ZD\OLPLWLQJWKDWUHVSRQVLELOLW\RUDVVXPLQJUHVSRQVLELOLW\IRUVDIHW\WKH&LW\ LVSDUWLFXODUO\FRQFHUQHGWKDWWKHIROORZLQJDUHVWULFWO\REVHUYHG /LIH6DYLQJ(TXLSPHQW&RQWUDFWRUVKDOOSURYLGHDQGUHTXLUHXVHRISHUVRQDO SURWHFWLYHOLIHVDYLQJHTXLSPHQWIRUDOOLWVSHUVRQQHOZRUNLQJLQRUDERXWWKHSURMHFW VLWH $FFHVV)DFLOLWLHV$OOODGGHUVVFDIIROGLQJDQGULJJLQJVKDOOEHGHVLJQHGIRUWKHLU LQWHQGHGXVHVDQGPHHW26+$UHJXODWLRQV/DGGHUVDQGVFDIIROGLQJVKDOOEH VXSSOLHGDQGHUHFWHGDVUHTXHVWHGE\(QJLQHHUWRIDFLOLWDWHLQVSHFWLRQDQGEH PRYHGE\WKH&RQWUDFWRUWRORFDWLRQVUHTXHVWHGE\WKH(QJLQHHU 9HQWLODWLRQ&RQWUDFWRUVKDOOHQVXUHWKHUHLVSURSHUYHQWLODWLRQDLUHGXFWLRQDQG H[KDXVWLQJRIZRUNVSDFHWRUHGXFHWKHFRQFHQWUDWLRQRIDLUFRQWDPLQDQWVWRDOHYHO ZKLFKSRVHVQRKD]DUGWRSHUVRQQHODWRUQHDUWKHMREVLWH$LUFLUFXODWLRQDQG H[KDXVWLQJRIVROYHQWYDSRUVVKDOOEHFRQWLQXHGXQWLOFRDWLQJVDQGSDLQWVKDYHIXOO\ FXUHG,IFRQYHQWLRQDOEODVWFOHDQLQJLVDFFRPSOLVKHGWRWDOFRQWDLQPHQWGXULQJ EODVWFOHDQLQJDQGFRDWLQJDQGSDLQWDSSOLFDWLRQRSHUDWLRQVLVPDQGDWRU\7KH H[KDXVW EORZHU RU GHKXPLGLILFDWLRQ HTXLSPHQW FDSDFLW\ VKDOO EHVXIILFLHQW WR PDLQWDLQDLUFKDQJHVZLWKLQFRQWDLQPHQWLQWHULRULQDFFRUGDQFHZLWK26+$FRDWLQJ DQGSDLQWPDQXIDFWXUHU¶VUHFRPPHQGDWLRQVDQGORFDO$LU4XDOLW\0DQDJHPHQW 'LVWULFWUHJXODWLRQVVXEMHFWWR(QJLQHHU¶VUHYLHZ D ([KDXVW EORZHU VKDOO H[KDXVW LQWR DQ (QJLQHHUUHYLHZHG VWUXFWXUH WKDW SUHFOXGHVWKHH[KDXVWLQJRISDLQWFKLSVRUSDUWLFXODWHPDWWHURQWRWKHVLWH RULQWRWKHDWPRVSKHUH E :KHUHYHQWLODWLRQLVXVHGWRFRQWUROKD]DUGRXVH[SRVXUHDOOHTXLSPHQW VKDOOEHH[SORVLRQSURRIRILQGXVWULDOGHVLJQDQGVKDOOEHDSSURYHGE\WKH (QJLQHHU +RXVHKROGW\SH YHQWLQJ HTXLSPHQW ZLOO QRW EH DFFHSWDEOH 9HQWLODWLRQVKDOOUHGXFHWKHFRQFHQWUDWLRQRIDLUFRQWDPLQDQWWRWKHGHJUHH DKD]DUGGRHVQRWH[LVWE\HGXFWLQJDLUYDSRUVHWFIURPWKHFRQILQHG VSDFH F 9HQWLODWLRQV\VWHPVKDOOEHIXUQLVKHGDQGLQVWDOOHGE\WKH&RQWUDFWRULQ DFFRUGDQFH ZLWK WKHVH VSHFLILFDWLRQV 7KH &RQWUDFWRU VKDOO PDNH PRGLILFDWLRQVWRWKHYHQWLODWLRQV\VWHPDVUHTXLUHGE\&DO26+$WRHQVXUH DVDIHZRUNLQJHQYLURQPHQWDQGFRPSOHWHUHPRYDORIDOOFRQWDPLQDWHG YDSRUV +HDGDQG)DFH3URWHFWLRQDQG5HVSLUDWRU\'HYLFHV(TXLSPHQWVKDOOLQFOXGH SURWHFWLYHKHOPHWVWKDWVKDOOEHZRUQE\DOOSHUVRQVZKLOHLQWKHYLFLQLW\RIWKHZRUN 'XULQJDEUDVLYHEODVWLQJRSHUDWLRQVQR]]OHPHQVKDOOZHDU86%XUHDXRI0LQHV DSSURYHGSRVLWLYHSUHVVXUHDLUVXSSOLHGKHOPHWVDQGDOORWKHUSHUVRQVZKRDUH H[SRVHG WR EODVWLQJ GXVW VKDOO ZHDU UHVSLUDWRU\ SURWHFWLRQ ,I FRDWLQJV DUH +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV KD]DUGRXVDGGLWLRQDOSURWHFWLRQZLOOEHZRUQDVGHWHUPLQHGQHFHVVDU\E\WKH H[SRVXUHDVVHVVPHQWRIWKH&HUWLILHG,QGXVWULDO+\JLHQLVW D :KHQDQGZKHUHUHTXLUHGSRVLWLYHSUHVVXUHDLUIHGKRRGVDQGRUPDVNV VKDOOEHVXSSOLHGE\DQDLUVRXUFHFXUUHQWO\FHUWLILHGWRSURGXFH³&ODVV' %UHDWKLQJ$LU´&RQWUDFWRUVKDOODWDOOWLPHVGXULQJWKHZRUNPDLQWDLQRQVLWH FXUUHQWGRFXPHQWDWLRQWRVXEVWDQWLDWHWKHTXDOLW\RIWKHEUHDWKLQJDLU E %DUULHUFUHDPVVKDOOEHXVHGRQDQ\H[SRVHGDUHDVRIVNLQ *URXQGLQJ:HOGLQJOHDGVDOOKRVHVDQGUHODWHGHTXLSPHQWVKDOOEHJURXQGHGWR SUHYHQWDFFXPXODWLRQRIFKDUJHVRIVWDWLFHOHFWULFLW\ ,OOXPLQDWLRQ6SDUNSURRIDUWLILFLDOOLJKWLQJVKDOOEHSURYLGHGIRUDOOZRUNLQFRQILQHG VSDFHV/LJKWEXOEVVKDOOEHJXDUGHGWRSUHYHQWEUHDNDJH/LJKWLQJIL[WXUHVDQG IOH[LEOHFRUGVVKDOOFRPSO\ZLWKWKHUHTXLUHPHQWVRI1)3$³1DWLRQDO(OHFWULF &RGH´IRUWKHDWPRVSKHUHLQZKLFKWKH\ZLOOEHXVHG:KHQHYHUUHTXLUHGE\WKH (QJLQHHU WKH &RQWUDFWRU VKDOO SURYLGH DGGLWLRQDO LOOXPLQDWLRQDQG QHFHVVDU\ VXSSRUWVWRFRYHUDOODUHDVWREHLQVSHFWHG7KHOHYHORILOOXPLQDWLRQIRULQVSHFWLRQ SXUSRVHVVKDOOEHGHWHUPLQHGE\WKH(QJLQHHU 7R[LFLW\DQG([SORVLYHQHVV7KHPD[LPXPDOORZDEOHFRQFHQWUDWLRQRIYDSRUVKDOO EHNHSWEHORZWKHPD[LPXPVDIHFRQFHQWUDWLRQIRUHLJKWKRXUH[SRVXUHSOXVORZHU H[SORVLYHOLPLW/(/PXVWEHVWULFWO\PDLQWDLQHG$OOUHJXODWLRQVUHODWHGWRVDIHW\ RISHUVRQQHODQGKDQGOLQJRIVXFKPDWHULDOVVKDOOEHVWULFWO\IROORZHG&RVWRI KDQGOLQJDQGGLVSRVLQJRIVXFKPDWHULDOVZLOOEHERUQHE\WKH&RQWUDFWRU D &RQWUDFWRU¶VUHVSRQVLELOLW\IRUPHHWLQJDOOUHJXODWLRQVUHODWLQJWRWR[LFDQG KD]DUGRXVPDWHULDOVLQFOXGHVEXWLVQRWOLPLWHGWRREWDLQLQJDOOSHUPLWVDQG (3$QXPEHUVSURFHVVLQJSDSHUZRUNEORRGWHVWLQJRISHUVRQQHODWVWDUW DQGILQLVKRISURMHFWVDPSOLQJDQGWHVWLQJRIZDVWHVSD\LQJIHHVKDQGOLQJ DQGSDFNDJLQJRIZDVWHVDWVLWHDQGGHOLYHULQJPDWHULDOVWRWKHVHOHFWHG &ODVV , GXPSVLWH XVLQJ OLFHQVHG KD]DUGRXV PDWHULDOV WUDQVSRUWHUV $OO UHJXODWLRQVUHODWLQJWRZRUNLQJZLWKKHDY\PHWDOVRUFRQILQHGVSDFHVVKDOO EH VWULFWO\ HQIRUFHG 'RFXPHQWDWLRQ RI DOO KD]DUGRXV RU WR[LFZDVWH GLVSRVDOZLOOEHUHTXLUHGDQGDFRS\VXSSOLHGWRWKH&LW\ 3URWHFWLYH&ORWKLQJ'XULQJFXWWLQJEXUQLQJZHOGLQJRSHUDWLRQVDQGZKHQKDQGOLQJ DQGPL[LQJFRDWLQJVDQGSDLQWVZRUNPHQVKDOOZHDUJORYHVH\HVKLHOGVDQGRWKHU SURWHFWLYHFORWKLQJ,IZRUNLQJZLWKOHDG]LQFRURWKHUKHDY\PHWDOVUHJXODWLRQV UHJDUGLQJKDQGOLQJRIH[SRVHGFORWKLQJVKDOOEHVWULFWO\HQIRUFHG )LUH&RQWUDFWRUVKDOOSURYLGHDSSURSULDWHILUHDEDWHPHQWGHYLFHVRQVLWHDQGEH UHDGLO\DYDLODEOHDWWKHMREVLWHGXULQJDOORSHUDWLRQV3URKLELWDQ\IODPHVZHOGLQJ DQGVPRNLQJGXULQJPL[LQJDQGDSSOLFDWLRQRIPDWHULDOV 6RXQG/HYHOV:KHQHYHUWKHRFFXSDWLRQDOQRLVHH[SRVXUHH[FHHGVWKHPD[LPXP DOORZDEOHVRXQGOHYHOVWKH&RQWUDFWRUVKDOOSURYLGHDQGUHTXLUHWKHXVHRI26+$ DSSURYHGHDUSURWHFWLYHGHYLFHV D 6RXQG EDUULHUV DSSURYHG E\ WKH &LW\ VKDOO EH SURYLGHG DW DOOWLPHVWR +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV PLQLPL]H GLVWXUEDQFH WR SHUVRQV OLYLQJ RU ZRUNLQJ QHDUE\ DQG WR WKH JHQHUDOSXEOLF0HDVXUHVWREHXVHGLQHIIHFWLQJQRLVHVXSSUHVVLRQVKDOO LQFOXGHEXWQRWOLPLWHGWRHTXLSSLQJDOOLQWHUQDOFRPEXVWLRQHQJLQHVZLWK FULWLFDO UHVLGHQWLDO VLOHQFHUV PXIIOHUV VKLHOGLQJ QRLVHSURGXFLQJ HTXLSPHQWIURPQHDUHVWDUHDVRIKXPDQRFFXSDQF\E\ORFDWLRQLQVXFK SRVLWLRQVDVWRGLUHFWWKHJUHDWHVWQRLVHHPLVVLRQVDZD\IURPVXFKDUHDV DQGFRQGXFWLQJRSHUDWLRQVLQWKHPRVWHIIHFWLYHPDQQHUWRPLQLPL]HQRLVH JHQHUDWLRQFRQVLVWHQWZLWKWKHSURVHFXWLRQRIWKH&RQWUDFWLQDWLPHO\DQG HFRQRPLFPDQQHU:KHQHYHUOHYHOVDUHDERYHORFDORUGLQDQFHVRUUHVXOW LQQRLVHFRPSODLQWVIURPUHVLGHQWVWKH\VKDOOEHDGMXVWHGDVGLUHFWHGE\ WKH(QJLQHHU *DV DQG $LU 0RQLWRULQJ &RQWUDFWRU VKDOO IXUQLVK PRQLWRULQJ HTXLSPHQW WR GHWHUPLQH WKH SUHVHQFH RI R[\JHQ GHILFLHQF\RU GDQJHURXV DLU FRQWDPLQDWLRQ &RQWLQXDOPRQLWRULQJZLOOEHUHTXLUHG&RQFHQWUDWLRQOHYHOVZLOOEHDVSUHVFULEHG E\26+$ & &RQWUDFWRUVKDOOSURYLGH+HDOWK'HSDUWPHQWDSSURYHGVDQLWDU\IDFLOLWLHVIRUDOO&RQWUDFWRU SHUVRQQHODVQRH[LVWLQJIDFLOLWLHVZLOOEHDYDLODEOHWRWKH&RQWUDFWRU)DFLOLWLHVVKDOOEH PDLQWDLQHGGXULQJWKHSURMHFWWRFRPSOHWHVWDQGDUGVHVWDEOLVKHGE\&LW\DQGVKDOOEH UHPRYHGSULRUWR&RQWUDFWRU¶VGHSDUWXUHIURPWKHVLWHDWFRPSOHWLRQRIWKHSURMHFW '(+80,',),&$7,21 $ 6FRSH,IGHKXPLGLILFDWLRQLVUHTXLUHGE\WKH&LW\¶V2SWLRQDO%LG,WHPWKHLQWHULRURIWKH VWUXFWXUHVKDOOEHGHKXPLGLILHGFRQWLQXRXVO\KRXUVSHUGD\GD\VSHUZHHNGXULQJ WKH FOHDQLQJ DQG FRDWLQJ RSHUDWLRQV LQFOXGLQJ VKLIWV GXULQJ ZKLFK QR ZRUN LV EHLQJ DFFRPSOLVKHGDQGDOVRGXULQJWKHILQDOFXULQJSHULRGXQOHVVIHZHUKRXUVRUGD\VDUH DSSURYHGLQZULWLQJE\WKH(QJLQHHU 7KHSXUSRVHRIGHKXPLGLI\LQJWKHLQWHULRURIWKHUHVHUYRLUGXULQJWKHFOHDQLQJDQG FRDWLQJRSHUDWLRQVDQGGXULQJWKHILQDOFXUHSHULRGLVWRQXOOLI\WKHDGYHUVHHIIHFWV RI FROG DQGRU ZHW DWPRVSKHULF FRQGLWLRQV $GGLWLRQDOO\ WKH GHKXPLGLILFDWLRQ HTXLSPHQWZLOOSURYLGHWKHQHFHVVDU\YHQWLODWLRQIRUWKHUHPRYDORIVROYHQWYDSRUV GXULQJWKHFRDWLQJDQGILQDOFXUHSKDVHV 'XVW FROOHFWRUV DQGRU VHSDUDWRUV XVLQJ DSSURYHG ILOWHUV DUH UHTXLUHG 7KH FRQWUDFWRUVKDOODWDOOWLPHVPDLQWDLQWKHFRQFHQWUDWLRQRIVROYHQWYDSRUVLQDOO SDUWVRIWKHVWUXFWXUHEHORZWKHORZHUH[SORVLYHOLPLW/(/ % 'HKXPLGLILFDWLRQHTXLSPHQWV\VWHPVPXVWEHUHYLHZHGE\WKH(QJLQHHU 7KHH[KDXVWEORZHUIRUUHPRYDORIGXVWHWFIURPWKHLQWHULRUFRQWDLQPHQWVKDOO H[KDXVWLQWRDQ(QJLQHHUUHYLHZHGVWUXFWXUHWKDWSUHFOXGHVWKHH[KDXVWLQJRIOHDG RU]LQFODGHQSDLQWFKLSVRUSDUWLFXODWHPDWWHURQWRWKHVLWHRULQWRWKHDWPRVSKHUH & )LQDO&XUH)LQDOFXUHRIFRDWLQJLVVSHFLILHGLQ6HFWLRQ6XEVHFWLRQ),1$/ &85,1*2)(32;<&2$7,1*6 ' *HQHUDO +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV 7KHVWUXFWXUHVKDOOEHFRQWLQXRXVO\GHKXPLGLILHGKRXUVSHUGD\GXULQJEODVWLQJ FRDWLQJEHWZHHQFRDWVRIFRDWLQJDQGGXULQJWKHILQDOFXUHSHULRGXQOHVVIHZHU KRXUVRUGD\VDUHDSSURYHGLQZULWLQJE\WKH(QJLQHHU 7KH&RQWUDFWRUVKDOOPDLQWDLQWKHGHKXPLGLILFDWLRQV\VWHPDWDOOWLPHVLQFOXGLQJ ILQDOFXUHSHULRGDQGVKDOOUHPRYHWKHYHQWLODWLRQDQGGHKXPLGLILFDWLRQV\VWHP XSRQFRPSOHWLRQRIWKHILQDOFXUHSHULRG 7KH &RQWUDFWRU VKDOO PDNH PRGLILFDWLRQV WR WKH GHKXPLGLILFDWLRQ V\VWHP DV GLUHFWHGE\WKH(QJLQHHUWRHQVXUHDVDIHZRUNLQJHQYLURQPHQWFRPSOHWHUHPRYDO RI DOO VROYHQW YDSRUV DQG PDLQWHQDQFH RI WKH SURSHU UHODWLYH KXPLGLW\ DW WKH FRQFUHWHDQGVWHHOVXUIDFHV 'XFWLQJVKDOOEHDLUWLJKWDQGUHLQIRUFHGZLWKVSLUDOO\ZRXQGZLUHWRSUHYHQWFRO ODSVH7KH&RQWUDFWRUVKDOOIXUQLVKDQGLQVWDOODQDSSURSULDWHDLUWLJKWFRQQHFWLQJ GHYLFHEHWZHHQWKHGXFWDQGGHVLJQDWHGRSHQLQJ$OOEHQGVLQGXFWZRUNVKDOOKDYH DPLQLPXPUDGLXVRI[,'RIWKHGXFWLQJLH,' PLQLPXPUDGLXV 7KH &RQWUDFWRU VKDOO GHVLJQ DQG VXEPLW IRU UHYLHZ D GHKXPLGLILFDWLRQ DQG YHQWLODWLRQSODQ,IOHDGFRDWLQJRUSDLQWLVEHLQJUHPRYHGWKHYHQWLODWLRQSODQVKDOO SURYLGHIRUDPLQLPXPFURVVGUDIWYHORFLW\RIIHHWSHUPLQXWHLQWKHYLFLQLW\RI WKHZRUNDUHD7KHFURVVGUDIWYHORFLWLHVPD\EHREWDLQHGZLWKXVHRIDSRUWDEOH EORZHURUIDQV,IOHDGFRDWLQJRUSDLQWLVEHLQJUHPRYHGDLUILOWUDWLRQLVUHTXLUHG ZLWK+(3$30ILOWHUV 7KH&RQWUDFWRUVKDOOIXUQLVKLQVWDOODQGPDLQWDLQWKUHHFXELFIRRWSHU PLQXWHFLUFXODWLRQIDQVLQVLGHWKHVWUXFWXUHRUDVPRGLILHGE\WKH(QJLQHHU 7KHFLUFXODWLRQIDQVPD\EHPRYHGDVQHFHVVDU\EXWVKDOOEHSODFHGLQGHDGDLU VSDFHDUHDVDQGGLUHFWHGWRZDUGWKHGHVLJQDWHGRSHQLQJDWDOOWLPHV 7KH&RQWUDFWRUVKDOOVHDODOOVWUXFWXUHRSHQLQJVWRSUHYHQWWKHHQWU\RIPRLVWDLU GHWULPHQWDOWRWKHEODVWLQJFRDWLQJRUFXULQJSURFHVV$QDSSURYHGDLUORFNHQWU\ VKDOOEHSURYLGHGIRULQJUHVVWRDQGHJUHVVIURPWKHVWUXFWXUH 7KHDUHDDGMDFHQWWRWKHVXUIDFHWKDWLVWREHEODVWHGDQGFRDWHGVKDOOQRWEH H[SRVHGWRDUHODWLYHKXPLGLW\RYHUWKLUW\ILYHSHUFHQWDWDQ\WLPHGXULQJ EODVWLQJFOHDQLQJDQGFRDWLQJRSHUDWLRQV ( (TXLSPHQW 7KHGHKXPLGLILFDWLRQHTXLSPHQWVKDOOEHDVROLGGHVLFFDQWQRWOLTXLGJUDQXODURU ORRVHOLWKLXPFKORULGHGHVLJQKDYLQJDVLQJOHURWDU\GHVLFFDQWEHGFDSDEOHRI FRQWLQXRXV RSHUDWLRQ IXOO\ DXWRPDWLF ZLWK GULSSURRI DXWRPDWLF HOHFWULFDO FRQWUROOHU 'HKXPLGLILFDWLRQHTXLSPHQWRSHUDWHGRQWKHVWUXFWXUHPXVWEHFDSDEOHRIPDNLQJ WZRFRPSOHWHDLUFKDQJHVHYHU\VL[W\PLQXWHVXQOHVVWKHIHHWSHUPLQXWH FURVVGUDIWYHORFLW\UHTXLUHPHQWUHTXLUHVDODUJHUYROXPH 7KHSURFHVVHGDLUIURPWKHGHKXPLGLILFDWLRQXQLWPXVWPDLQWDLQDUHODWLYHKXPLGLW\ +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV RIHOHYHQSHUFHQWRUOHVV 'XULQJWKHFRDWLQJDQGFXUHSKDVHGHKXPLGLILFDWLRQXQLWVPXVWKDYHDX[LOLDU\ KHDWHUV FDSDEOH RI PDLQWDLQLQJ DQ DLU WHPSHUDWXUH LQVLGH WKH UHVHUYRLU RI D PLQLPXPRIGHJUHHV) $LUKHDWHUVDUHQRWDFFHSWDEOHDVVXEVWLWXWHVIRUGHKXPLGLILFDWLRQXQLWV $LU FKLOOHUV KHDWHUV RU DLU FRQGLWLRQHUV PD\ EH XVHG GRZQVWUHDP RI WKH GHKXPLGLILHUV LI WKH\ DUH DSSURYHG IRU XVH E\ WKH PDQXIDFWXUHURI WKH GHKXPLGLILFDWLRQHTXLSPHQW 3$57352'8&761RW8VHG 3$57(;(&87,21 &225',1$7,21$1'0((7,1*6 $ 35(%,'&21)(5(1&( $PDQGDWRU\3UH%LG&RQIHUHQFHIRUWKHSURMHFWZLOOEHFRQGXFWHGE\WKH(QJLQHHU DW&LW\RIILFHVDQGVLWHDVQRWHGLQWKH1RWLFHRI,QYLWLQJ%LGV7KHREMHFWRIWKH 3UH%LG&RQIHUHQFHLVWRDFTXDLQWELGGHUVZLWKH[LVWLQJIDFLOLW\DQGVLWHV7KH FRQGLWLRQVDQGUHTXLUHPHQWVRIWKHSODQVDQGVSHFLILFDWLRQVVKDOOJRYHUQRYHUDQ\ LQIRUPDWLRQSUHVHQWHGDWWKH3UH%LG&RQIHUHQFHXQOHVVDPHQGHGLQZULWLQJE\ WKH(QJLQHHU$OOELGGHUVPXVWDWWHQGWKH3UH%LG&RQIHUHQFHWRKDYHWKHLUELG DFFHSWHGE\WKH&LW\ % 35(&216758&7,21&21)(5(1&( $3UH&RQVWUXFWLRQ&RQIHUHQFHVKDOOEHVFKHGXOHGSULRUWRVWDUWRISURMHFW7KH &LW\&RQWUDFWRUDQG(QJLQHHUVKDOOEHSUHVHQW7KHVHTXHQFHRIZRUNZLOOEH GLVFXVVHG DQG ZLOO EH PXWXDOO\ DJUHHG XSRQ WR HQVXUH WKDW WKH ZRUN LV DFFRPSOLVKHGDQGFRPSOHWHGDVVWDWHGLQWKH&RQWUDFWDQGWRDOORZIRULQVSHFWLRQ DQGRSHUDWLRQVIOH[LELOLW\E\&LW\$VFKHGXOHRIZRUNWREHDFFRPSOLVKHGDQGDOLVW RIODERUPDWHULDODQGHTXLSPHQWUDWHVIRUDGGLWLRQDOZRUNZLOOEHHVWDEOLVKHGDQG PDLQWDLQHG WKURXJKRXW WKH SURMHFW &RQWUDFWRU VKDOO IXUQLVK UHVXPHV RI DOO SHUVRQQHODVVLJQHGWRSURMHFWDQGDFRPSOHWHVHWRIDSSURYHGVXEPLWWDOGDWDIRU XVHE\LQVSHFWLRQSHUVRQQHO&RQWUDFWRUVKDOOKDYHDGHVLJQDWHGUHSUHVHQWDWLYH IRUDOOSURMHFWV 7KH &RQWUDFWRU VKDOO VXEPLW PDQXIDFWXUHU¶V OLWHUDWXUH DQG 6DIHW\ 'DWD 6KHHWV 6'6RQDOOPDWHULDOVWREHXVHGLQFRDWLQJDQGSDLQWLQJRSHUDWLRQVLQFOXGLQJEXW QRWOLPLWHGWRFRDWLQJVSDLQWVWKLQQHUVVROYHQWVDQGFOHDQLQJIOXLGV1RPDWHULDOV ZLOO EH DOORZHG ZKLFK KDYH EHHQ VWRUHG RYHU GD\V RU PDQXIDFWXUHU¶V UHFRPPHQGHGVKHOIOLIHZKLFKHYHULVOHVV&RQWUDFWRUVKDOOPDLQWDLQFRSLHVRI 6'6DWMREVLWHDWDOOWLPHV&RSLHVRIDOOLQYRLFHVVKRZLQJSXUFKDVHGGDWHVDQG GHOLYHU\IRUDOOPDWHULDOPHQWLRQHGDERYHZLOOEHUHTXLUHG +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV (1'2)6(&7,21 +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV 6(&7,215(6(592,5&2$7,1*$1'3$,17,1*63(&,),&$7,21 3$57*(1(5$/ 385326( 7KHSXUSRVHRIWKLVVSHFLILFDWLRQLVWRHVWDEOLVKPHWKRGVDQGSURFHGXUHVIRUFRDWLQJ SDLQWLQJ GHKXPLGLILFDWLRQ DQG KDQGOLQJ RI KD]DUGRXV DQG QRQKD]DUGRXV PDWHULDOVZDVWHV &2175$&725 7KH&RQWUDFWRUVKDOOEHDOLFHQVHG3DLQWLQJDQG'HFRUDWLQJ&RQWUDFWRULQWKH6WDWHRI &DOLIRUQLD & &ODVVLILFDWLRQ +H VKDOO KDYH D PLQLPXP RI ILYH \HDUV SUDFWLFDO H[SHULHQFHDQGVXFFHVVIXOKLVWRU\LQWKHDSSOLFDWLRQRIVSHFLILHGSURGXFWVWRVXUIDFHVRI VWHHOZDWHUVWRUDJHUHVHUYRLU8SRQUHTXHVWKHVKDOOVXEVWDQWLDWHWKLVUHTXLUHPHQWE\ IXUQLVKLQJDZULWWHQOLVWRIUHIHUHQFHV '(),1,7,216 $ ³&RDWLQJ´UHIHUVWRSURWHFWLYHPDWHULDOVXVHGRUDSSOLHGRQLQWHULRUVXUIDFHV % ³3DLQW´UHIHUVWRSURWHFWLYHPDWHULDOVXVHGRUDSSOLHGRQH[WHULRUVXUIDFHV & ³&RDW´UHIHUVWRSDLQWDSSOLHGLQDVLQJOHRUPXOWLSOHSDVVDSSOLFDWLRQWRIRUPDQHYHQO\ GLVWULEXWHGILOPZKHQGU\'HVLJQDWLRQVIRU³FRDWV´DUHSULPHURUILUVWFRDWLQWHUPHGLDWHRU VHFRQGFRDWDQGILQLVKFRDWDQGDQ\FRDWVDSSOLHGEH\RQGWKHGHVLJQDWHGFRDWV 48$/,7<$6685$1&( $ 6XUIDFH3UHSDUDWLRQ6XUIDFHSUHSDUDWLRQZLOOEHEDVHGXSRQFRPSDULVRQZLWK³3LFWRULDO 6XUIDFH 3UHSDUDWLRQ 6WDQGDUGV IRU 3DLQWLQJ 6WHHO 6XUIDFHV´ 663&9LV $670 'HVLJQDWLRQ'DQGDVGHVFULEHGEHORZ$QFKRUSURILOHIRUSUHSDUHGVXUIDFHVVKDOOEH PHDVXUHG E\ XVLQJ D QRQGHVWUXFWLYH LQVWUXPHQW VXFK DV D .7 6XUIDFH 3URILOH &RPSDUDWRUGLJLWDOVXUIDFHSURILOHJDXJHRU7HVWH[3UHVV2)LOP6\VWHP7HPSHUDWXUH DQGGHZSRLQWUHTXLUHPHQWVQRWHGLQ%KHUHLQVKDOODSSO\WRDOOVXUIDFHSUHSDUDWLRQ RSHUDWLRQVH[FHSWORZDQGKLJKWHPSHUDWXUHOLPLWVDQGRSHUDWLRQRIGHKXPLGLILFDWLRQ HTXLSPHQWVKDOOEHGHWHUPLQHGDWWKH3UH&RQVWUXFWLRQ&RQIHUHQFH % $SSOLFDWLRQ1RFRDWLQJVKDOOEHDSSOLHGXQGHUWKHIROORZLQJFRQGLWLRQV :KHQWKHVXUURXQGLQJDLUWHPSHUDWXUHRUWKHWHPSHUDWXUHRIWKHVXUIDFHWREH FRDWHGRUSDLQWHGLVEHORZGHJUHHV)IRUHSR[\FRDWLQJVEHORZGHJUHHV) IRUHSR[\ORZWHPSHUDWXUHFXUHFRDWLQJVRUEHORZGHJUHHV)IRUXUHWKDQHSDLQW RUDERYHGHJUHHV)IRUDOOPDWHULDOVRULQDFFRUGDQFHZLWKWKHGDWDVKHHWV 7RZHWRUGDPSVXUIDFHVRULQUDLQIRJRUPLVW :KHQWKHVXUIDFHWHPSHUDWXUHLVOHVVWKDQGHJUHHV)DERYHWKHGHZSRLQW +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV :KHQLWLVH[SHFWHGWKHDLUWHPSHUDWXUHZLOOGURSEHORZGHJUHHV)IRUHSR[\ FRDWLQJ EHORZ GHJUHHV ) IRU HSR[\ ORZ WHPSHUDWXUH FXUH FRDWLQJV RU GHJUHHV)IRUXUHWKDQHSDLQWVRUVXUIDFHWHPSHUDWXUHLVH[SHFWHGWREHOHVVWKDQ GHJUHHV)DERYHWKHGHZSRLQWZLWKLQWZRKRXUVDIWHUDSSOLFDWLRQRIFRDWLQJVRU SDLQWV D 'HZSRLQW VKDOO EH PHDVXUHG E\ XVH RI DQ LQVWUXPHQW VXFK DV D VOLQJ SV\FKURPHWHULQFRQMXQFWLRQZLWK86'HSDUWPHQWRI&RPPHUFH:HDWKHU %XUHDX3V\FKURPHWULF7DEOHVRUHTXLYDOHQW'HKXPLGLILFDWLRQHTXLSPHQW PXVWUXQFRQWLQXRXVO\GXULQJDOOSKDVHVRIFRQWUDFWH[FHSWGLVLQIHFWLRQ SKDVH E ,IDERYHFRQGLWLRQVDUHSUHYDOHQWFRDWLQJDQGSDLQWDSSOLFDWLRQVKDOOEH GHOD\HGRUSRVWSRQHGXQWLOFRQGLWLRQVDUHIDYRUDEOH7KHGD\¶VDSSOLFDWLRQ VKDOOEHFRPSOHWHGLQWLPHWRSHUPLWWKHILOPVXIILFLHQWGU\LQJWLPHSULRUWR GDPDJHE\DWPRVSKHULFFRQGLWLRQV & 2YHUVSUD\DQG'XVW&RQWURO7KH&RQWUDFWRUVKDOOFRQGXFWDOORSHUDWLRQVVRDVWRFRQILQH DEUDVLYHEODVWLQJGHEULVDQGFRDWLQJDQGSDLQWRYHUVSUD\WRZLWKLQWKHERXQGVRIWKHVLWH 7KH &RQWUDFWRU VKDOO WDNH DOO SUHFDXWLRQV QHFHVVDU\ WR SUHYHQWDGYHUVH RIIVLWH FRQVHTXHQFHVRIEODVWFOHDQLQJRUDSSOLFDWLRQRSHUDWLRQV$Q\FRPSODLQWVUHFHLYHGE\WKH &LW\UHODWLQJWRDQ\VXFKSRWHQWLDORIIVLWHSUREOHPVZLOOEHLPPHGLDWHO\GHOLYHUHGWRWKH &RQWUDFWRUDVVLJQHGMREVLWHUHSUHVHQWDWLYH7KH&RQWUDFWRUVKDOOLPPHGLDWHO\KDOWEODVW FOHDQLQJ RU DSSOLFDWLRQ ZRUN DQG VKDOO WDNH ZKDWHYHU FRUUHFWLYH DFWLRQ LV UHTXLUHG WR PLWLJDWHDQ\VXFKSUREOHPV$OOFRVWVDVVRFLDWHGZLWKSURWHFWLRQRIRIIVLWHSURSHUWLHV DQGRU FRUUHFWLRQ RI GDPDJH WR SURSHUW\ DV D UHVXOW RI EODVW FOHDQLQJ RU DSSOLFDWLRQ RSHUDWLRQVVKDOOEHERUQHGLUHFWO\E\WKH&RQWUDFWRUDWQRDGGLWLRQDOH[SHQVHWRWKH&LW\ &LW\DSSURYDORI&RQWUDFWRU¶VEODVWFOHDQLQJDQGRYHUVSUD\SUHYHQWLRQSURFHGXUHV DQG(QJLQHHU¶VSUHVHQFHRQSURMHFWGRHVQRWIUHH&RQWUDFWRUIURPUHVSRQVLELOLW\ IRUFRPSOLDQFH'DLO\DSSURYDORISURFHGXUHVZLOOEHUHTXLUHGSULRUWRVWDUWRIEODVW FOHDQLQJRUVSUD\RSHUDWLRQV ' ,QVSHFWLRQDQG&KHFNLQJ7KH&LW\ZLOOSURYLGHDQGXWLOL]HWKHVHUYLFHVRIDQLQGHSHQGHQW SURIHVVLRQDOFRDWLQJLQVSHFWLRQDJHQWZKRZLOOEH&LW\¶V&RDWLQJ,QVSHFWRU&RQWUDFWRUZLOO IXUQLVKLQVSHFWLRQGHYLFHVDQGWHVWHTXLSPHQWLQJRRGZRUNLQJFRQGLWLRQDQGHTXLSPHQW VKDOOEHRSHUDWHGE\RULQWKHSUHVHQFHRIWKHLQVSHFWRU3URFHGXUHVRUSUDFWLFHVQRW VSHFLILFDOO\GHILQHGKHUHLQPD\EHXWLOL]HGSURYLGHGWKH\PHHWUHFRJQL]HGDQGDFFHSWHG SURIHVVLRQDO VWDQGDUGV DQG DUH DFFHSWDEOH WR &LW\¶V &RDWLQJ ,QVSHFWRU 7KH &LW\¶V (QJLQHHU¶VGHFLVLRQVVKDOOEHILQDODVWRLQWHUSUHWDWLRQDQGRUFRQIOLFWEHWZHHQDQ\RIWKH UHIHUHQFHVSHFLILFDWLRQVDQGVWDQGDUGVFRQWDLQHGKHUHLQ 7KH&LW\¶V&RDWLQJ,QVSHFWRUZLOOSHUIRUPFRQWLQXRXVLQVSHFWLRQRQDOOSKDVHVRI WKHVXUIDFHSUHSDUDWLRQDEUDVLYHEODVWFOHDQLQJDQGDSSOLFDWLRQRIWKHFRDWLQJ V\VWHPV$OOVXUIDFHVZLOOEHLQVSHFWHGE\&LW\¶V&RDWLQJ,QVSHFWRUSULRUWRHDFK DSSOLFDWLRQ RI FRDWLQJ PDWHULDOV &RDWLQJ PDWHULDOV DSSOLHG ZLWKRXW WKH SULRU LQVSHFWLRQ RI &LW\¶V &RDWLQJ ,QVSHFWRU VKDOO EH UHPRYHG DQG UHDSSOLHG DW WKH H[SHQVHRIWKH&RQWUDFWRU &LW\¶V &RDWLQJ ,QVSHFWRU ZLOO SHUIRUP VXFK WHVWV DV DUH UHTXLUHG WR HQVXUH FRPSOLDQFHZLWKDOOSKDVHVRIWKHVXUIDFHSUHSDUDWLRQDEUDVLYHEODVWFOHDQLQJDQG +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV DSSOLFDWLRQRIWKHFRDWLQJV\VWHPV7HVWHTXLSPHQWVKDOOLQFOXGHEXWQRWEHOLPLWHG WRWKHIROORZLQJ663&VXUIDFHSUHSDUDWLRQVWDQGDUGVVXUIDFHSURILOHFRPSDUDWRU WHVW WDSH PLFURPHWHU DEUDVLYH VLHYH WHVW XOWUDYLROHW ODPS PLUURU FHUWLILHG WKLFNQHVVFDOLEUDWLRQSODWHVDQGPDJQHWLFW\SHGU\ILOPWKLFNQHVVJDXJH$FFXUDF\ RILQVSHFWLRQHTXLSPHQWZLOOEHYHULILHGE\&LW\¶V&RDWLQJ,QVSHFWRULQWKHSUHVHQFH RIWKH&RQWUDFWRUWRYHULI\LWVDFFXUDF\SULRUWRXVH 1RWLI\ &LW\¶V &RDWLQJ ,QVSHFWRU GD\V LQ DGYDQFH RI VKRS DQG ILHOGDSSO\ RSHUDWLRQVLQYROYLQJDEUDVLYHEODVWFOHDQLQJDQGFRDWLQJDSSOLFDWLRQV &LW\¶V &RDWLQJ ,QVSHFWRU ZLOO GHWHUPLQH WKH GHJUHH RI FOHDQOLQHVV DQG VXUIDFH SURILOHRIWKHVKRSDQGILHOGEODVWFOHDQHGVXUIDFHV$GGLWLRQDOEODVWFOHDQLQJRI QRQFRQIRUPLQJ DUHDV VKDOO EH DFFRPSOLVKHG XQWLO DOO DUHDV FRQIRUP WR WKH FOHDQOLQHVVDQGSURILOHVSHFLILHG &LW\¶V&RDWLQJ,QVSHFWRUZLOOWRWDOO\LQVSHFWHDFKFRDWRISULPHULQWHUPHGLDWHDQG ILQLVKFRDWLQJWRGHWHUPLQHWKHWKLFNQHVVDQGLQWHJULW\(DFKFRDWDSSOLHGZLOOEH FKHFNHGDQGGHILFLHQFLHVPDUNHG$IWHUREVHUYLQJVSHFLILHGUHFRDWWLPHDSSO\ DGGLWLRQDOFRDWLQJPDWHULDOVRYHUDUHDVQRWKDYLQJWKHVSHFLILHGPLQLPXPGU\ILOP WKLFNQHVV DQG DUHDV KDYLQJ DQ\ KROLGD\V RU SLQKROHV $IWHU FRUUHFWLRQ RI GHILFLHQFLHV&LW\¶V&RDWLQJ,QVSHFWRUZLOOUHLQVSHFWWKRVHDUHDVWRGHWHUPLQHWKH DFFHSWDELOLW\RIWKHDGGLWLRQDOFRDWLQJ(DFKFRDWDSSOLHGPXVWEHWRWKH VDWLVIDFWLRQRI&LW\¶V&RDWLQJ,QVSHFWRUSULRUWRVXEVHTXHQWFRDWVEHLQJDSSOLHG ( ,QVSHFWLRQ)DFLOLWLHV7KH&RQWUDFWRUVKDOOSURYLGH&LW\¶V&RDWLQJ,QVSHFWRUZLWKIDFLOLWLHV IRULQVSHFWLRQLQFOXGLQJEXWQRWOLPLWHGWRWKHIROORZLQJ )XUQLVKDVGHWHUPLQHGQHFHVVDU\E\&LW\¶V&RDWLQJ,QVSHFWRUDOOVDIHW\HTXLSPHQW DQGGHYLFHVGXULQJDEUDVLYHEODVWFOHDQLQJDQGFRDWLQJRSHUDWLRQV3URYLGHKHOPHW ZLWKFRQWLQXRXVIUHVKDLUVXSSO\IRUREVHUYDWLRQGXULQJFOHDQLQJRSHUDWLRQV )XUQLVKLOOXPLQDWLRQDQGWKHPDQSRZHUWRPRYHWKHOLJKWVZKHQHYHUUHTXLUHGE\ WKH&LW\¶V&RDWLQJ,QVSHFWRU3URYLGHDGGLWLRQDOOLJKWVDQGVXSSRUWVVXIILFLHQWWR LOOXPLQDWHDOODUHDVWREHLQVSHFWHG&LW\¶V&RDWLQJ,QVSHFWRUZLOOGHWHUPLQHWKH OHYHORILOOXPLQDWLRQUHTXLUHGIRULQVSHFWLRQSXUSRVHV 7HPSRUDU\ODGGHUVDQGVFDIIROGLQJVKDOOEHHUHFWHGDQGPRYHGWRWKHORFDWLRQV UHTXHVWHGE\&LW\¶V&RDWLQJ,QVSHFWRU ) 7KLFNQHVV7HVWLQJ7KLFNQHVVRIFRDWLQJVDQGSDLQWVVKDOOEHWHVWHGZLWKDQRQGHVWUXFWLYH ILOPWKLFNQHVVJDXJH$QLQVWUXPHQWVXFKDVD7RRNH*DJHVKRXOGEHXVHGLIDGHVWUXFWLYH WHVWHULVGHHPHGQHFHVVDU\7HVWLQJVKDOOEHDFFRPSOLVKHGLQFRQIRUPDQFHWR663&3$ ³0HDVXUHPHQW RI 'U\ 3DLQW 7KLFNQHVV ZLWK 0DJQHWLF *DJHV´ H[FHSW DV PRGLILHG KHUHLQDIWHU )ODWFRDWHGRUSDLQWHGVXUIDFHVVKDOOEHWHVWHGLQFRQIRUPDQFHWR663&3$ 6WUXFWXUDO PHPEHUV SLSLQJ DQG RWKHU LUUHJXODU VXUIDFHV VKDOO EH WHVWHG ZLWK IUHTXHQF\DQGORFDWLRQVDVGLUHFWHGE\WKH(QJLQHHU * +ROLGD\7HVWLQJ&RDWLQJLQWHJULW\RI$//LQWHULRUFRDWHGVXUIDFHVVKDOOEHWHVWHGZLWKDQ +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV DSSURYHGLQVSHFWLRQGHYLFH$OOSLQKROHVVKDOOEHPDUNHGUHSDLUHGLQDFFRUGDQFHZLWKWKH PDQXIDFWXUHU¶VSULQWHGUHFRPPHQGDWLRQVDQGUHWHVWHG1RSLQKROHVRURWKHULUUHJXODULWLHV ZLOOEHSHUPLWWHGLQWKHILQDOFRDWLQJ + ,QVSHFWLRQ'HYLFHV&RQWUDFWRUZLOOIXUQLVKXQWLOILQDODFFHSWDQFHRIFRDWLQJVDQGSDLQW LQVSHFWLRQGHYLFHVLQJRRGZRUNLQJFRQGLWLRQIRUGHWHFWLRQRIKROLGD\VDQGPHDVXUHPHQW RIGU\ILOPWKLFNQHVV7KH\VKDOODOVRIXUQLVK86'HSDUWPHQWRI&RPPHUFH1DWLRQDO %XUHDXRI6WDQGDUGVFHUWLILHGWKLFNQHVVFDOLEUDWLRQSODWHVWRWHVWDFFXUDF\RIWKLFNQHVV JDXJHV'U\ILOPWKLFNQHVVJDXJHKROLGD\GHWHFWRUVVKDOOEHDYDLODEOHDWDOOWLPHVXQWLO ILQDO DFFHSWDQFH RI DSSOLFDWLRQ ,QVSHFWLRQ GHYLFHV VKDOO EH RSHUDWHG E\ RU LQ WKH SUHVHQFHRIWKH(QJLQHHUZLWKORFDWLRQDQGIUHTXHQF\EDVLVGHWHUPLQHGE\WKH(QJLQHHU , $FFHSWDEOH,QVSHFWLRQ'HYLFHV$FFHSWDEOHGHYLFHVIRUIHUURXVPHWDOVXUIDFHVLQFOXGH EXWDUHQRWOLPLWHGWR7LQNHUDQG5DVRU0RGHOV$3DQG$3:KROLGD\GHWHFWRUVHTXLSSHG ZLWKDZLUHEUXVKHOHFWURGHVXSSOLHGE\WKHPDQXIDFWXUHUDQG³,QVSHFWRU´RU³3RVLWHVW´ RU³3RVLWHFWRU´RU³4XDQL[´XQLWVIRUGU\ILOPWKLFNQHVVJDXJLQJ,QVSHFWLRQGHYLFHVVKDOO EHRSHUDWHGLQDFFRUGDQFHZLWKWKHVHVSHFLILFDWLRQVDQGWKHPDQXIDFWXUHU¶VLQVWUXFWLRQV 3$57352'8&76 *(1(5$/ $ 0DWHULDOVVSHFLILHGDUHWKRVHZKLFKKDYHEHHQHYDOXDWHGIRUWKHVSHFLILFVHUYLFH3URGXFWV RI,QWHUQDWLRQDO'HYRH&RDWLQJVDQG7QHPHF&RPSDQ\,QFDUHOLVWHGWRHVWDEOLVKD VWDQGDUGRITXDOLW\IRUWKHSURMHFW6WDQGDUGSURGXFWVRIPDQXIDFWXUHUVRWKHUWKDQWKRVH VSHFLILHGZLOOEHDFFHSWHGZKHQLWLVSURYHGWRWKHVDWLVIDFWLRQRIWKH(QJLQHHUWKH\DUH HTXDOLQFRPSRVLWLRQGXUDELOLW\XVHIXOQHVVDQGFRQYHQLHQFHIRUWKHSXUSRVHLQWHQGHG 6XEVWLWXWLRQVZLOOEHFRQVLGHUHGSURYLGHGWKHIROORZLQJPLQLPXPFRQGLWLRQVDUHPHW 7KHSURSRVHGFRDWLQJRUSDLQWV\VWHPVKDOOKDYHDGU\ILOPWKLFNQHVVHTXDOWRRU JUHDWHUWKDQWKDWRIWKHVSHFLILHGV\VWHP 7KHSURSRVHGFRDWLQJRUSDLQWV\VWHPVKDOOHPSOR\DQHTXDORUJUHDWHUQXPEHURI VHSDUDWHFRDWV 7KHSURSRVHGFRDWLQJRUSDLQWV\VWHPVKDOOHPSOR\FRDWLQJVRUSDLQWVRIWKHVDPH JHQHULFW\SH $OOUHTXHVWVIRUVXEVWLWXWLRQVKDOOFDUU\IXOOGHVFULSWLYHOLWHUDWXUHDQGGLUHFWLRQVIRU DSSOLFDWLRQDORQJZLWKFRPSOHWHLQIRUPDWLRQRQJHQHULFW\SHQRQYRODWLOHFRQWHQW E\YROXPHDQGDOLVWRIVLPLODUSURMHFWVDOODWOHDVWWKUHH\HDUVROGZKHUHWKH SURGXFWVKDYHEHHQDSSOLHGWRVLPLODUH[SRVXUH 7KH &LW\ UHTXLUHV WKDW WKH &RQWUDFWRU SURYLGH FHUWLILHG ODERUDWRU\ GDWD VKHHWV VKRZLQJWKHUHVXOWVRIFRPSOHWHVSHFWURJUDSKLFDQGGXUDELOLW\WHVWVDFFRPSOLVKHG RQ WKH SURSRVHG VXEVWLWXWH 7HVWV VKDOO EH DFFRPSOLVKHG E\ DQLQGHSHQGHQW WHVWLQJODERUDWRU\VDWLVIDFWRU\WRWKH(QJLQHHUDQGDOOFRVWVLQFXUUHGLQWKHWHVWLQJ SURJUDPVKDOOEHERUQHE\WKH&RQWUDFWRU,QDQ\FDVHWKH(QJLQHHUVKDOOEHVROH DQGILQDOMXGJHRIWKHDFFHSWDELOLW\RIDQ\SURSRVHGVXEVWLWXWLRQ5HTXHVWVIRU VXEVWLWXWLRQPXVWEHDSSURYHGLQZULWLQJSULRUWRGDWHRIELG +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV % 7KH&RQWUDFWRUVKDOOVXEPLWSULRUWRVWDUWRISURMHFWPDQXIDFWXUHU¶VOLWHUDWXUHDQG6DIHW\ 'DWD 6KHHWV 6'6 RQ DOO PDWHULDOV WR EH XVHG LQ FRDWLQJ DQG SDLQWLQJ RSHUDWLRQV LQFOXGLQJEXWQRWOLPLWHGWRFRDWLQJVSDLQWVWKLQQHUVVROYHQWVDQGFOHDQLQJIOXLGV1R PDWHULDOV ZLOO EH DOORZHG ZKLFK KDYH EHHQ VWRUHG RYHU GD\VRU PDQXIDFWXUHU¶V UHFRPPHQGHGVKHOIOLIHZKLFKHYHULVOHVV&RQWUDFWRUVKDOOPDLQWDLQFRSLHVRI6'6DWMRE VLWHDWDOOWLPHV $QHOHFWURQLFVXEPLWWDOZLOOEHDFFHSWHGLQRQO\WKHIROORZLQJIRUPDW D 7KHILOHVKDOOEHLQSGIIRUPDW E (DFKSURMHFWVXEPLWWDOVKDOOEHDVHSDUDWHGRFXPHQWILOH F (DFKGRFXPHQWILOHVKDOOEHODEHOHGLQWKHIROORZLQJVHTXHQFH 2ZQHU1DPH3URMHFW1DPH 6XEPLWWDO1R 'HVFULSWLRQ & $OOPDWHULDOVVKDOOEHEURXJKWWRWKHMREVLWHLQWKHRULJLQDOVHDOHGFRQWDLQHUV7KH\VKDOO QRWEHRSHQHGRUXVHGXQWLO&LW\¶VUHSUHVHQWDWLYHKDVSK\VLFDOO\LQVSHFWHGFRQWHQWVDQG REWDLQHG QHFHVVDU\ GDWD IURP LQIRUPDWLRQ SULQWHG RQ FRQWDLQHUVRU ODEHO 0DWHULDOV H[FHHGLQJVWRUDJHOLIHUHFRPPHQGHGE\WKHPDQXIDFWXUHUVKDOOEHUHMHFWHG&RS\RI LQYRLFHVKRZLQJSXUFKDVHDQGGHOLYHU\GDWHVZLOOEHUHTXLUHG ' )ODPPDELOLW\WR[LFLW\DOOHUJHQLFSURSHUWLHVDQGDQ\RWKHUFKDUDFWHULVWLFUHTXLULQJILHOG SUHFDXWLRQVVKDOOEHLGHQWLILHGDQGVSHFLILFVDIHW\SUDFWLFHVVKDOOEHVWLSXODWHG ( $OOFRDWLQJDQGSDLQWPDWHULDOVVKDOOEHVWRUHGLQHQFORVHGVWUXFWXUHVWRSURWHFWWKHPIURP ZHDWKHUDQGH[FHVVLYHKHDWRUFROG)ODPPDEOHPDWHULDOVPXVWEHVWRUHGWRFRQIRUPZLWK &LW\&RXQW\6WDWHDQG)HGHUDOVDIHW\FRGHVIRUIODPPDEOHPDWHULDOV$WDOOWLPHVFRDWLQJV DQGSDLQWVVKDOOEHSURWHFWHGIURPIUHH]LQJ ) &RQWUDFWRUVKDOOXVHSURGXFWVRIVDPHPDQXIDFWXUHUIRUDOOFRDWV 63(&,),&,17(5,25&2$7,1*0$7(5,$/6 $ &RDWLQJPDWHULDOVIRULQWHULRUVXUIDFHVRIUHVHUYRLUVPXVWDSSHDURQWKH6WDQGDUGRIWKH 1DWLRQDO 6DQLWDWLRQ )RXQGDWLRQ 16) RU 6WDQGDUG RI 8QGHUZULWHUV /DERUDWRULHV 3URGXFWVFRQWDLQLQJSHUFKORURHWK\OHQH3&(WULFKORURHWK\OHQH7&(OHDGFKURPLXPRU ]LQFZLOOQRWEHSHUPLWWHG,QDGGLWLRQSURGXFWVFRQWDLQLQJ0HWK\O(WK\O.HWRQH0(.RU 0HWK\O,VREXW\O.HWRQH0,%.ZLOOQRWEHDOORZHGLQDPRXQWVWKDWZLOOFDXVHYRODWLYH RUJDQLFDQDO\VLVWREHDERYHPD[LPXPFRQWDPLQDQWOHYHOVRUDFWLRQOHYHOV 7KH&RQWUDFWRUVKDOOSURYLGHSULRUWRFRDWLQJDQ\VXUIDFHVRIWKHUHVHUYRLUZULWWHQ FHUWLILFDWLRQVIURPWKHFRDWLQJPDQXIDFWXUHUVVWDWLQJWKDWWKHFRDWLQJPDWHULDOV WKLQQHUVVROYHQWVDQGHTXLSPHQWFOHDQLQJIOXLGVSURYLGHGE\WKHPDQXIDFWXUHUV GRQRWFRQWDLQ3&(RU7&(7KH&RQWUDFWRUVKDOODOVRFHUWLI\LQZULWLQJWKDWQR PDWHULDOFRQWDLQLQJ3&(7&(OHDGFKURPLXPRU]LQFLQDQ\IRUPZLOOEHXVHGIRU WKHLQWHULRUFRDWLQJVRUH[WHULRUSDLQWRIWKHUHVHUYRLU7KLVVKDOOLQFOXGHDOOVROYHQWV WKLQQHUVDQGFOHDQLQJIOXLGVDWWKHMREVLWHUHJDUGOHVVRIZKHUHWKHPDWHULDOVZHUH REWDLQHG 7KH(QJLQHHUPD\UHTXLUHDOOVROYHQWVWKLQQHUVDQGFOHDQLQJIOXLGVEHWHVWHGIRU +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV 7&(DQG3&(SULRUWREHLQJXVHGDWWKHMREVLWH7KH&RQWUDFWRUVKDOOSURYLGHWKH (QJLQHHUZLWKVDPSOHVRIHDFKPDWHULDODWQRFRVWWRWKH&LW\8QDFFHSWDEOH PDWHULDOVVKDOOEHUHPRYHGIURPWKHMREVLWH % $OOFRDWLQJPDWHULDOVVKDOOFRPSO\ZLWKDLUSROOXWLRQUHJXODWLRQVVSHFLILFDOO\WKHORFDODLU TXDOLW\PDQDJHPHQWGLVWULFWRUDLUSROOXWLRQFRQWUROGLVWULFWUXOHVDQGUXOHVIRUWKH&LW\ & $OOFRDWLQJPDWHULDOVVKDOODOVRFRQIRUPWRUHJXODWLRQVDQGDSSOLFDEOHUHTXLUHPHQWVRI ORFDO6WDWHDQG)HGHUDOKHDOWKUHJXODWRU\DJHQFLHV ' (SR[\FRDWLQJVVKDOOEHVLPLODURUHTXDOWRSURGXFWVVXFKDV,&,'HYRH%DU5XVW+ /RZ92&0XOWL3XUSRVH(SR[\&RDWLQJRU7QHPHF3RWD3R[6HULHV/)/RZ92& )LUVWRUSULPHFRDWVKDOOQRWEHJUD\EXWILQLVKFRDWVKDOOEHZKLWH ( 6ROLG (SR[\ FRDWLQJV VKDOO EH ,QWHUQDWLRQDO ,QWHUOLQH 3 6ROLGV (SR[\ &RDWLQJRU7QHPHF(SR[ROLQH6HULHV6ROLGV(SR[\&RDWLQJ7QHPHF(SR[ROLQH 6HULHV)&6ROLGV(SR[\&RDWLQJPD\EHXVHGIRUFROGFRQGLWLRQVRUDFFHOHUDWHG FXUHDVDSSURYHGE\WKH(QJLQHHU)LQLVKFRDWVKDOOEHZKLWH ) -RLQWVHDODQWEHORZWKHZDWHUOHYHOVKDOOEHDIOH[LEOHSRO\XUHWKDQHHODVWRPHULFVHDODQW VLPLODURUHTXDOWR6LNDIOH[&16DVPDQXIDFWXUHGE\6LND&RUSRUDWLRQ * -RLQW VHDODQW RQ WKH URRI DQG VWUXFWXUDO PHPEHUV DERYH WKH ZDWHU VKDOO EH D IOH[LEOH SRO\XUHWKDQHVXFKDV6LNDIOH[$RUSRO\VXOILGHSURGXFW :$6+'2:10$7(5,$/6 $ &OHDQHUIRUSUHGLVLQIHFWLRQFOHDQLQJRILQWHULRUVXUIDFHVVKDOOEH*UH6D:D\RUDSSURYHG HTXDO % 'LVLQIHFWLRQPDWHULDOVVKDOOFRQIRUPWRDOOUHTXLUHPHQWVRI$::$6WDQGDUG&ODWHVW UHYLVLRQ & 3URGXFWWRSUHYHQWIODVKUXVWLQJGXULQJZHWDEUDVLYHEODVWFOHDQLQJVKDOOEH+ROG7LJKW RUDSSURYHGHTXDO 63(&,),&(;7(5,253$,170$7(5,$/6 $ 3DLQWPDWHULDOVIRUH[WHULRUVXUIDFHVRIUHVHUYRLUZLOOFRQVLVWRIDQHSR[\SULPHUHSR[\ LQWHUPHGLDWHFRDWDQGXUHWKDQHILQLVKFRDW3URGXFWVFRQWDLQLQJOHDG]LQFRUFKURPLXP FRPSRXQGVZLOOQRWEHSHUPLWWHG % $OOSDLQWPDWHULDOVVKDOOFRPSO\ZLWKDLUSROOXWLRQUHJXODWLRQVVSHFLILFDOO\WKHORFDODLU TXDOLW\PDQDJHPHQWGLVWULFWRUDLUSROOXWLRQFRQWUROGLVWULFWUXOHVDQGUXOHVIRUWKH&LW\ & $OOSDLQWPDWHULDOVVKDOODOVRFRQIRUPWRUHJXODWLRQVDQGDSSOLFDEOHUHTXLUHPHQWVRIORFDO 6WDWHDQG)HGHUDOKHDOWKUHJXODWRU\DJHQFLHV ' 3ULPHFRDWVKDOOEHVLPLODURUHTXDOWRSURGXFWVVXFKDV,&,'HYRH%DU5XVW+/RZ 92&¶V 0XOWL3XUSRVH HSR[\ FRDWLQJ RU 7QHPHF / (SR[ROLQH ,, /RZ 92&¶V HSR[\ FRDWLQJ +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV ( ,QWHUPHGLDWHFRDWVKDOOEHVLPLODURUHTXDOWRSURGXFWVVXFKDV,&,'HYRH%DU5XVW+ /RZ92&¶V0XOWL3XUSRVHHSR[\FRDWLQJRU7QHPHF/(SR[ROLQH,,/RZ92&¶VHSR[\ FRDWLQJ ) )LQLVKFRDWVKDOOEHVLPLODURUHTXDOWRSURGXFWVVXFKDV'HYRH%DU2['HYWKDQH+ XUHWKDQHFRDWLQJRU7QHPHF6HULHV/RZ92&¶VXUHWKDQHFRDWLQJ * -RLQW VHDODQW VKDOO EH D IOH[LEOH SRO\XUHWKDQH HODVWRPHULF VHDODQW VLPLODU RU HTXDO WR 6LNDIOH[&16DVPDQXIDFWXUHGE\6LND&RUSRUDWLRQ 3$57(;(&87,21 *(1(5$/ $ $OOVXUIDFHSUHSDUDWLRQFRDWLQJDQGSDLQWDSSOLFDWLRQVKDOOFRQIRUPWRDSSOLFDEOHVWDQGDUGV RIWKH&LW\DQGWKHPDQXIDFWXUHU¶VSULQWHGLQVWUXFWLRQVDVDSSURYHGE\WKH(QJLQHHU 0DWHULDODSSOLHGSULRUWRDSSURYDORIWKHVXUIDFHE\WKH(QJLQHHUVKDOOEHUHPRYHGDQG UHDSSOLHGWRWKHVDWLVIDFWLRQRIWKH(QJLQHHUDWWKHH[SHQVHRIWKH&RQWUDFWRU % $OOZRUNVKDOOEHDFFRPSOLVKHGE\VNLOOHGFUDIWVPHQTXDOLILHGWRDFFRPSOLVKWKHUHTXLUHG ZRUNLQDPDQQHUFRPSDUDEOHZLWKWKHEHVWVWDQGDUGVRISUDFWLFH5HVXPHVRISHUVRQQHO SURSRVHGWREHXVHGRQWKHSURMHFWVKDOOEHVXEPLWWHGIRUDSSURYDOXSRQ1RWLFHRI$ZDUG &RQWLQXLW\ RI SHUVRQQHO VKDOO EH PDLQWDLQHG DQG WUDQVIHUV RI NH\ SHUVRQQHO VKDOO EH FRRUGLQDWHGZLWKWKH(QJLQHHU & 7KH&RQWUDFWRUVKDOOSURYLGHDVXSHUYLVRUWREHDWWKHZRUNVLWHGXULQJFOHDQLQJDQG DSSOLFDWLRQRSHUDWLRQV7KHVXSHUYLVRUVKDOOKDYHWKHDXWKRULW\WRVLJQDQ\FKDQJHRUGHUV FRRUGLQDWHZRUNDQGPDNHRWKHUGHFLVLRQVSHUWDLQLQJWRWKHIXOILOOPHQWRIWKHLUFRQWUDFW ' &RQWUDFWRUVKDOOSURYLGHDSSURYHGVDQLWDU\IDFLOLWLHVIRUDOO&RQWUDFWRUSHUVRQQHODVQR H[LVWLQJIDFLOLWLHVZLOOEHDYDLODEOHWRWKH&RQWUDFWRU)DFLOLWLHVVKDOOEHPDLQWDLQHGGXULQJ WKHSURMHFWWRFRPSOHWHVWDQGDUGVHVWDEOLVKHGE\&LW\DQGVKDOOEHUHPRYHGSULRUWR &RQWUDFWRU¶VGHSDUWXUHIURPWKHVLWHDWFRPSOHWLRQRIWKHSURMHFW ( 'XVWGLUWRLOJUHDVHRUDQ\IRUHLJQPDWWHUZKLFKZLOODIIHFWWKHDGKHVLRQRUGXUDELOLW\RI WKHILQLVKPXVWEHUHPRYHGE\ZDVKLQJZLWKFOHDQUDJVGLSSHGLQDQDSSURYHGFRPPHUFLDO FOHDQLQJVROXWLRQULQVHGZLWKFOHDQZDWHUDQGZLSHGGU\ZLWKFOHDQUDJV ) 1RUXEEHUWLUHYHKLFOHVRUHTXLSPHQWVKDOOEHSHUPLWWHGRQWKHLQWHULRUIORRUDIWHUWKHIORRU KDVEHHQEODVWHG * 7KH&RQWUDFWRU¶VHTXLSPHQWVKDOOEHGHVLJQHGIRUDSSOLFDWLRQRIPDWHULDOVVSHFLILHGDQG VKDOOEHPDLQWDLQHGLQILUVWFODVVZRUNLQJFRQGLWLRQ&RPSUHVVRUVVKDOOKDYHVXLWDEOHWUDSV DQGILOWHUVWRUHPRYHZDWHUDQGRLOVIURPWKHDLU%ORWWHUWHVWVKDOOEHDFFRPSOLVKHGDW HDFKVWDUWXSSHULRGDQGDVGHHPHGQHFHVVDU\E\WKH(QJLQHHU&RQWUDFWRU¶VHTXLSPHQW VKDOO EH VXEMHFW WR DSSURYDO RI WKH (QJLQHHU 7KLV DSSURYDO GRHV QRW UHOLHYH WKH &RQWUDFWRU¶VUHVSRQVLELOLW\IRUWKHVDIHRSHUDWLRQRIWKHHTXLSPHQWRULWVSHUIRUPDQFH &OHDQOLQHVV RI FRPSUHVVHG DLU VXSSO\ VKDOO EH YHULILHG GDLO\ DQG DV GHHPHG QHFHVVDU\E\(QJLQHHUE\GLUHFWLQJDVWUHDPRIDLUZLWKRXWDEUDVLYHIURPWKH +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV EODVWQR]]OHRQWRDZKLWHEORWWHURUFORWKIRUWZHQW\VHFRQGV,IRLORUZDWHUDSSHDUV RQWKHEORWWHURUFORWKDOOWUDSVDQGVHSDUDWRUVVKDOOEHEORZQGRZQXQWLOWZR VXEVHTXHQWWZHQW\VHFRQGWHVWVVKRZQRIXUWKHURLORUZDWHU + $SSOLFDWLRQRIWKHILUVWFRDWVKDOOIROORZLPPHGLDWHO\DIWHUVXUIDFHSUHSDUDWLRQDQGFOHDQLQJ ZLWKLQDQHLJKWKRXUSHULRG,IXQIRUHVHHQZHDWKHUFRQGLWLRQVRFFXUDVGHILQHGLQ% 48$/,7<$6685$1&(VXUIDFHVVKDOOEHUHFOHDQHGSHUWKHRULJLQDOVSHFLILFDWLRQVSULRU WRDSSOLFDWLRQRIWKHILUVWFRDW%UXVKRIIEODVWFOHDQLQJ663&63VZHHSEODVWZLOOQRW EHDFFHSWHGLQOLHXRI663&631HDU:KLWH0HWDOEODVW ,I GHKXPLGLILFDWLRQ HTXLSPHQW LV UHTXLUHG FOHDQHG DUHDV VKDOO KDYH ILUVW FRDW DSSOLHG DW ODVW VKLIW RI WKH ZHHN DV DSSURYHG E\ WKH (QJLQHHU SURYLGHG GHKXPLGLILFDWLRQHTXLSPHQWKDVUXQFRQWLQXRXVO\GXULQJWKHFRPSOHWHZHHNDQG VXUIDFHVPHHWDOOUHTXLUHPHQWVRIWKHVSHFLILFDWLRQ0RQLWRULQJGHYLFHVDSSURYHG E\WKH(QJLQHHUVKDOOEHXVHGWRHQVXUHFRQWLQXRXVRSHUDWLRQ , %HFDXVHRISUHVHQFHRIPRLVWXUHDQGSRVVLEOHFRQWDPLQDQWVLQDWPRVSKHUHFDUHVKDOOEH WDNHQWRHQVXUHSUHYLRXVO\FRDWHGRUSDLQWHGVXUIDFHVDUHSURWHFWHGRUUHFOHDQHGSULRUWR DSSOLFDWLRQ RI VXEVHTXHQW FRDWV 0HWKRGV RI SURWHFWLRQ DQG UHFOHDQLQJ VKDOO EH DSSURYHGE\WKH(QJLQHHU 3URMHFW LV VXEMHFW WR LQWHUPLWWHQW VKXWGRZQ LI LQ WKH RSLQLRQ RI WKH (QJLQHHU FOHDQLQJDQGDSSOLFDWLRQRSHUDWLRQVDUHFUHDWLQJDORFDOL]HGFRQGLWLRQGHWULPHQWDO WRRQJRLQJIDFLOLW\DFWLYLWLHVSHUVRQQHORUDGMDFHQWSURSHUW\ ,QWKHHYHQWRIHPHUJHQF\VKXWGRZQE\WKH(QJLQHHU&RQWUDFWRUVKDOOLPPHGLDWHO\ FRUUHFWGHILFLHQFLHV$OODGGLWLRQDOFRVWVFUHDWHGE\VKXWGRZQVKDOOEHERUQHE\ &RQWUDFWRU - 7KH&RQWUDFWRUVKDOOSURYLGHDWKLVRZQH[SHQVHDOOQHFHVVDU\SRZHUUHTXLUHGIRUKLV RSHUDWLRQVXQGHUWKHFRQWUDFW . &RQWUDFWRUVKDOOVHDODQ\UHVHUYRLUYHQWVSXPSVPRWRUVDQGRWKHURSHQDUHDVWRSUHYHQW LQWUXVLRQRIFRDWLQJRUSDLQWRURWKHUFRQWDPLQDQWV7KHVHDOLQJV\VWHPVKDOOEHGHVLJQHG WRDOORZFRQWLQXRXVRSHUDWLRQRIIDFLOLWLHVRUHTXLSPHQWZLWKQRGHWULPHQWDOHIIHFWV,I QHFHVVDU\VHDOLQJV\VWHPVKDOOEHUHPRYHGGDLO\DWWHUPLQDWLRQRIZRUNRUDVGLUHFWHG E\WKH(QJLQHHU 685)$&(35(3$5$7,21*(1(5$/ $ 7KHODWHVWUHYLVLRQRIWKHIROORZLQJVXUIDFHSUHSDUDWLRQVSHFLILFDWLRQVRIWKH6RFLHW\IRU 3URWHFWLYH&RDWLQJVVKDOOIRUPDSDUWRIWKLVVSHFLILFDWLRQ1RWH$QHOHPHQWRIVXUIDFH DUHDLVGHILQHGDVDQ\JLYHQVTXDUHLQFKRIVXUIDFH 6ROYHQW &OHDQLQJ 663&63 5HPRYDO RI RLO JUHDVH VRLO DQG RWKHU FRQWDPLQDQWVE\XVHRIVROYHQWVHPXOVLRQVFOHDQLQJFRPSRXQGVVWHDPFOHDQLQJ RUVLPLODUPDWHULDOVDQGPHWKRGVZKLFKLQYROYHDVROYHQWRUFOHDQLQJDFWLRQ +DQG7RRO&OHDQLQJ663&635HPRYDORIORRVHUXVWORRVHPLOOVFDOHDQG RWKHUGHWULPHQWDOIRUHLJQPDWWHUSUHVHQWWRGHJUHHVSHFLILHGE\KDQGFKLSSLQJ VFUDSLQJVDQGLQJDQGZLUHEUXVKLQJ +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV 3RZHU7RRO&OHDQLQJ663&635HPRYDORIORRVHUXVWORRVHPLOOVFDOHDQG RWKHU GHWULPHQWDO IRUHLJQ PDWWHU SUHVHQW WR GHJUHH VSHFLILHG E\ SRZHU ZLUH EUXVKLQJSRZHULPSDFWWRROVRUSRZHUVDQGHUV &RPPHUFLDO%ODVW&OHDQLQJ663&63%ODVWFOHDQLQJXQWLODWOHDVWWZRWKLUGVRI HDFKHOHPHQWRIVXUIDFHDUHDLVIUHHRIDOOYLVLEOHUHVLGXH %UXVKRII%ODVW&OHDQLQJ663&63%ODVWFOHDQLQJWRUHPRYHORRVHUXVWORRVH PLOOVFDOHDQGRWKHUGHWULPHQWDOIRUHLJQPDWWHUSUHVHQWWRWKHGHJUHHVSHFLILHG 1HDU:KLWH %ODVW &OHDQLQJ 663&63 %ODVW FOHDQLQJ WR QHDUZKLWH PHWDO FOHDQOLQHVVXQWLODWOHDVWQLQHW\ILYHSHUFHQWRIHDFKHOHPHQWRIVXUIDFHDUHDLVIUHH RIDOOYLVLEOHUHVLGXHV 3RZHU7RRO&OHDQLQJWR%DUH0HWDO663&633RZHUWRROFOHDQLQJWRSURGXFH DEDUHPHWDOVXUIDFHDQGWRUHWDLQRUSURGXFHDVXUIDFHSURILOHRIDWOHDVWPLO +LJKDQG8OWUD+LJK3UHVVXUH:DWHU-HWWLQJ663&63:-WKURXJK:DWHUMHW FOHDQLQJRIPHWDOVWRUHPRYHUXVWPLOOVFDOHFRDWLQJSDLQWDQGRWKHUGHWULPHQWDO IRUHLJQPDWWHUWRSUHVHQWWRYDU\LQJGHJUHHVRIFOHDQOLQHVVIURPOLJKWFOHDQLQJWR FOHDQWREDUHVXEVWUDWH % $Q\EXUUVZHOGVSDWWHUVKDUSHGJHVFRUQHUVRUURXJKZHOGVZKLFKZRXOGFDXVHGLIILFXOW\ LQDFKLHYLQJDGHIHFWIUHHSDLQWV\VWHPVKDOOEHFKLSSHGRUJURXQGVPRRWKLQFRQIRUPDQFH WR1$&(6WDQGDUG63ODWHVWHGLWLRQ,WLVQRWWKHLQWHQWWRKDYHWKHZHOGVRU³VFDUV´ JURXQG³IOXVK´7KHREMHFWRIWKHJULQGLQJLVWRHOLPLQDWHVKDUSHGJHVFRUQHUVDQG RYHUODSVWRSURYLGHDVXUIDFHIRUWKHDSSOLFDWLRQRIDXQLIRUPWKLFNQHVVRIFRDWLQJRUSDLQW ZLWKRXWYRLGVRURWKHUGHIHFWV & $EUDVLYHEODVWLQJQR]]OHVVKDOOEHHTXLSSHGZLWK³GHDGPDQ´HPHUJHQF\VKXWRIIQR]]OHV %ODVWQR]]OHSUHVVXUHVKDOOEHDPLQLPXPRI36,DQGVKDOOEHYHULILHGE\XVLQJDQ DSSURYHGQR]]OHSUHVVXUHJDJHDWHDFKVWDUWXSSHULRGRUDVGLUHFWHGE\WKH(QJLQHHU 1XPEHURIQR]]OHVXVHGGXULQJDOOEODVWFOHDQLQJRSHUDWLRQVPXVWEHVXIILFLHQWWRHQVXUH WLPHO\FRPSOHWLRQRISURMHFWVXEMHFWWRGHVLJQDWLRQDQGDSSURYDOE\(QJLQHHU &RQWUDFWRUVKDOOSHUIRUPDOOPRGLILFDWLRQVLQWHULRUVXUIDFHSUHSDUDWLRQDQGFRDWLQJ DSSOLFDWLRQXWLOL]LQJDPLQLPXPRIWZREODVWQR]]OHVSHUVKLIW ' $OOEODVWKRVHFRQQHFWLRQVVKDOOEHWHWKHUHGDQGVHFXUHGWRSUHYHQWVHSDUDWLRQGXULQJ EODVWFOHDQLQJRSHUDWLRQVDQGVKDOOEHWDSHGZLWKGXFWWDSHSULRUWRSUHVVXUL]LQJ$OOWDSHG FRQQHFWLRQVVKDOOEHYLVXDOO\LQVSHFWHGIRUOHDNVZLWKLQILYHPLQXWHVDIWHUVWDUWRIEODVW FOHDQLQJRSHUDWLRQVDQGDWWKHHQGRIEODVWFOHDQLQJRSHUDWLRQV/HDNLQJFRQQHFWLRQVVKDOO EHLPPHGLDWHO\UHSDLUHGWRSUHYHQWIXUWKHUGDPDJH ( )LHOGEODVWFOHDQLQJIRUDOOVXUIDFHVVKDOOEHE\GU\PHWKRGXQOHVVRWKHUZLVHGLUHFWHG &RQWUDFWRULVUHVSRQVLEOHIRUPDLQWDLQLQJGXVWHPLVVLRQVZLWKLQWKHOHJDOOHYHODQGWKDW OHYHOZKLFKZRXOGQRWFUHDWHDQXLVDQFH ) 3DUWLFOHVL]HRIDEUDVLYHVXVHGLQEODVWFOHDQLQJVKDOOEHWKDWZKLFKZLOOSURGXFHDPLO VXUIDFH SURILOH DQG D PLO SURILOH IRU DOO VXUIDFHV XOWLPDWHO\ UHFHLYLQJ VROLGV +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV FRDWLQJLQDFFRUGDQFHZLWKUHFRPPHQGDWLRQVRIWKHPDQXIDFWXUHURIWKHVSHFLILHGFRDWLQJ RUSDLQWV\VWHPWREHDSSOLHGVXEMHFWWRDSSURYDORI(QJLQHHU * $EUDVLYHXVHGLQEODVWFOHDQLQJRSHUDWLRQVVKDOOEHQHZZDVKHGJUDGHGDQGIUHHRI FRQWDPLQDQWVZKLFKZRXOGLQWHUIHUHZLWKDGKHVLRQRIFRDWLQJVDQGSDLQWVDQGVKDOOQRWEH UHXVHGXQOHVVVSHFLILFDOO\DSSURYHGE\WKH(QJLQHHU$EUDVLYHVVKDOOEHFHUWLILHGIRU XQFRQILQHGGU\EODVWLQJSXUVXDQWWRWKH&DOLIRUQLD$GPLQLVWUDWLYH&RGH6HFWLRQRI 6XEFKDSWHU7LWOHRUVXEVHTXHQWUHYLVLRQDQGVKDOODSSHDURQWKHFXUUHQWOLVWLQJRI DSSURYHGDEUDVLYHV,QYRLFHVRUORDGVKHHWVFRQILUPLQJDERYHVKDOOEHUHTXLUHG + 5HF\FOHGIHUURXVPHWDOOLFDEUDVLYHVPXVWPHHWRUH[FHHGWKHFOHDQOLQHVVVWDQGDUGVVHW IRUWKLQ663&$%7KHRSHUDWLQJPL[RIDEUDVLYHPHGLDVKDOOEHVXFKWKDWDVKDUS DQJXODUQRWSHHQHGSURILOHLVSURGXFHG$Q\UHF\FOHGDEUDVLYHVKDOOEHVXFKWKDWDVKDUS DQJXODUQRWSHHQHGSURILOHLVSURGXFHG$Q\UHF\FOHGDEUDVLYHVKDOOEHGHVLJQHGIRUWKH XVHLHVWHHOJULWDQGEHIUHHRIJUHDVHRLORURWKHUGHEULVRUFRQWDPLQDQWVWKDWFRXOGEH GHWULPHQWDOWRWKHVHUYLFHOLIHRIWKHDSSOLHGFRDWLQJV,IVWHHOVKRWPHGLDLVXVHGLWVKDOO EHOLPLWHGWRQRPRUHWKDQRIWKHRSHUDWLQJPL[5HF\FOHGDEUDVLYHVKDOOEHWHVWHGIRU FRQWDPLQDWLRQWKURXJKWKHXVHRIDYLDOWHVWLQDFFRUGDQFHZLWKWKHSURFHGXUHVRXWOLQHGLQ 663&¶V3XEOLFDWLRQDQG,62 , 'XULQJEODVWFOHDQLQJRSHUDWLRQVFDXWLRQVKDOOEHH[HUFLVHGWRHQVXUHH[LVWLQJFRDWLQJV DQGSDLQWVDUHQRWH[SRVHGWRDEUDVLRQIURPEODVWFOHDQLQJ - %ODVWFOHDQLQJIURPUROOLQJVFDIIROGVVKDOORQO\EHDFFRPSOLVKHGZLWKLQFRQILQHVRILQWHULRU SHULPHWHURIVFDIIROG5HDFKLQJEH\RQGOLPLWVRISHULPHWHUZLOOEHDOORZHGRQO\LIEODVW QR]]OHLVPDLQWDLQHGLQDSRVLWLRQZKLFKZLOOSURGXFHDSURILOHDFFHSWDEOHWRWKH(QJLQHHU . $FFHVVLEOH LQWHULRU VXUIDFHV RI WKH RXWOHW QR]]OH DQG WKDW SRUWLRQ RI WKH LQOHW QR]]OH SHUPDQHQWO\DWWDFKHGWRWKHUHVHUYRLUVKDOOEHFOHDQHGRIDOOROGFRDWLQJDQGUXVWE\EODVW FOHDQLQJRURWKHUDSSURYHGPHWKRGV3UHFDXWLRQVVKDOOEHWDNHQVRDVWRSUHYHQWDQ\ GDPDJHWRWKHH[LVWLQJJDWHRUEXWWHUIO\YDOYHVDWWKHLQOHWDQGRXWOHWQR]]OHV$OOH[SRVHG VXUIDFHVRIWKHYDOYHVVKDOOEHPDVNHGSULRUWREODVWFOHDQLQJWKHQR]]OHV7KHUHPRYDEOH SRUWLRQVRIWKHLQOHWQR]]OHVKDOOEHUHPRYHGDQGEODVWFOHDQHGDVVSHFLILHGKHUHLQ / 'XULQJEODVWFOHDQLQJRSHUDWLRQVLQOHWRXWOHWRYHUIORZDQGGUDLQRSHQLQJVLQERWWRPVKDOO EHFRYHUHGZLWKSO\ZRRGEXONKHDGVRURWKHUDSSURYHGEDUULHUVWRSUHYHQWHQWU\RIVSHQW DEUDVLYHUHPRYHGFRDWLQJRURWKHUIRUHLJQPDWHULDOV 0 7KH&RQWUDFWRUVKDOONHHSWKHDUHDRIKLVZRUNLQDFOHDQFRQGLWLRQDQGVKDOOQRWSHUPLW EODVWLQJPDWHULDOVWRDFFXPXODWHDVWRFRQVWLWXWHDQXLVDQFHRUKD]DUGWRWKHSURVHFXWLRQ RIWKHZRUNRUWKHRSHUDWLRQRIWKHH[LVWLQJIDFLOLWLHV6SHQWDEUDVLYHVDQGRWKHUGHEULV VKDOOEHUHPRYHGDWWKH&RQWUDFWRU¶VH[SHQVHDVGLUHFWHGE\WKH(QJLQHHU$VH[LVWLQJ H[WHULRUSDLQWVKDYHEHHQGHWHUPLQHGE\ODERUDWRU\DQDO\VLVWREHWR[LFRUKD]DUGRXV FRDWLQJSDLQW DQG FRDWLQJSDLQW DEUDVLYH UHVLGXH PL[WXUH VKDOOEH WHVWHG WR HQVXUH FRQIRUPDQFHZLWKKD]DUGRXVPDWHULDOWROHUDQFHVKDYHEHHQPHW,WVKDOOEHWKHUHVSRQVL ELOLW\RIWKH&RQWUDFWRUWRSURYLGHDGHTXDWHFRQWDLQHUVRQWKHMREVLWHWRUHWDLQVSHQWPHGLD DQGUHPRYHGFRDWLQJDQGSDLQWXQWLOWHVWVKDYHEHHQFRPSOHWHGRUDSSURYDOIRUGLVSRVDO IURPDODQGILOOKDVEHHQREWDLQHG'LVSRVDORIKD]DUGRXVRUWR[LFZDVWHDWRWKHUWKDQ JRYHUQPHQWUHJXODWHGODQGILOOVZLOOQRWEHSHUPLWWHGXQOHVVDSSURYHGSHUVRQDOO\E\WKH (QJLQHHULQ&RQWUDFWRU¶VSODQRIDFWLRQIRUSURMHFW'RFXPHQWDWLRQRIDOOKD]DUGRXVRUWR[LF ZDVWHGLVSRVDOZLOOEHUHTXLUHGDQGDFRS\VXSSOLHGWR&LW\ +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV 1 %ODVWFOHDQHGDQGFRDWHGDQGSDLQWHGVXUIDFHVVKDOOEHFOHDQHGSULRUWRDSSOLFDWLRQRI VSHFLILHG FRDWLQJV RU SDLQWV YLD D FRPELQDWLRQ RI EORZLQJ ZLWKFOHDQ GU\ DLU EUXVKLQJEURRPLQJDQGRUYDFXXPLQJDVGLUHFWHGE\WKH(QJLQHHU$LUKRVHIRUEORZLQJ VKDOOEHDWOHDVWLQGLDPHWHUDQGVKDOOEHHTXLSSHGZLWKDVKXWRIIGHYLFH 2 +LJKDQG8OWUD+LJK3UHVVXUH:DWHU-HWWLQJ663&63:-WKURXJKVKDOOQRWEHXVHG RQLQWHULRUVXUIDFHVDQGVKDOORQO\EHXVHGRQH[WHULRUVXUIDFHVZKHQDQGDVGLUHFWHGE\ (QJLQHHU3UHVVXUHVVKDOOEHWKRVHGHWHUPLQHGE\(QJLQHHUWRHIIHFWLYHO\DFFRPSOLVK UHPRYDO RI ORRVH SHHOLQJIODNLQJ FRDWLQJV RU SDLQW RU RWKHU GHWULPHQWDO VXUIDFH FRQWDPLQDQWV +$=$5'2860$7(5,$/6*(1(5$/ $ ([WHULRUVXUIDFHVKDYHEHHQGHWHUPLQHGWRFRQWDLQKLJKOHYHOVRIOHDG&RQWUDFWRUVKDOO FRPSO\ZLWK7LWOH&DOLIRUQLD&RGHRI5HJXODWLRQV&&56HFWLRQ7KH&RQWUDFWRU VKDOOVXEPLWDZULWWHQFRPSOLDQFHSURJUDP7KHFRPSOLDQFHSURJUDPVKDOODGGUHVVGDWD VSHFLILHG LQ VXEVHFWLRQV H% DQG H& RI 6HFWLRQ &RSLHV RI DOO DLU PRQLWRULQJRUMREVLWHLQVSHFWLRQUHSRUWVVKDOOEHIXUQLVKHGZLWKLQGD\VRIPRQLWRULQJRU LQVSHFWLRQ % &RQWUDFWRUVKDOOFRPSO\ZLWKUHTXLUHPHQWVRI&)5&&57LWOH'LYLVLRQ DQG+6&'LYLVLRQ&KIRUKDQGOLQJDQGGLVSRVLQJRIKD]DUGRXVZDVWHVUHVXOWLQJ IURPVXUIDFHFRQWDPLQDWLRQDQGUHPRYHGFRDWLQJDQGSDLQWSDUWLFOHV & $OOZRUNPXVWEHDFFRPSOLVKHGLQFRPSOLDQFHWRWKHIROORZLQJ 2QILUVWGD\RIDQ\OHDGSDLQWUHPRYDOZRUNHQYLURQPHQWPXVWEHWHVWHGE\RU XQGHUWKHVXSHUYLVLRQRID&HUWLILHG,QGXVWULDO+\JLHQLVW&,+WRGHWHUPLQHOHYHOV RISURWHFWLRQUHTXLUHGWRSURWHFWZRUNHUVDQGWKHHQYLURQPHQWIURPOHDGDQGRWKHU KHDY\PHWDOFRQWDPLQDWLRQ$OOFRVWVUHODWHGWRWHVWLQJE\WKH&,+VKDOOEHERUQH E\WKH&RQWUDFWRU)LHOGWHVWLQJPD\EHDFFRPSOLVKHGE\HLWKHUDQ,QGXVWULDO +\JLHQLVWRUD&,+ 7HVWLQJZLOOLQFOXGHDLUVDPSOLQJDQGWHVWLQJRIILOWHUVUHPRYHGIURPWKHZRUNHUV¶ UHVSLUDWRUVRUSHUVRQDODLUPRQLWRUVWRGHWHUPLQHWKHOHYHORIOHDGH[SRVXUH8SRQ FRPSOHWLRQRIWHVWLQJWKH&,+VKDOOILOHDZULWWHQUHSRUWRQWKHUHVXOWVRIWKHWHVWLQJ /HYHORIH[SRVXUHZLOOWKHQGHWHUPLQHWKHW\SHUHVSLUDWRU\SURWHFWLRQFORWKLQJ KRXVHNHHSLQJK\JLHQHIDFLOLWLHVPHGLFDOVXUYHLOODQFHPHGLFDOUHPRYDOSURWHFWLRQ HPSOR\HH LQIRUPDWLRQ DQG WUDLQLQJ VLJQV UHFRUG NHHSLQJ DQG REVHUYDWLRQ RI PRQLWRULQJUHTXLUHGIRUWKHSURMHFW 1RH[WHULRUSDLQWLQJZRUNVKDOOUHFRPPHQFHXQWLOWKHUHSRUWIURPWKH&,+LVILOHG DQGZRUNHUDQGHQYLURQPHQWDOSURWHFWLRQUHTXLUHGLVLQSODFH&RVWVIRUWKHWLPH GHOD\VKDOOEHLQFOXGHGLQWKH&RQWUDFWRU¶VRULJLQDOELG %DVHGRQWKHLQLWLDODQDO\VLVVDPSOHVRIH[WHULRUVSHQWDEUDVLYHVVKRXOGEHVHQW WRDFHUWLILHGODERUDWRU\IRUWHVWLQJDWWKH&RQWUDFWRU¶VH[SHQVH77/&DQG7&/3 DQDO\VLVVKRXOGEHFRPSOHWHGIRU&&57LWOHKHDY\PHWDOV5HVXOWVRIWKH DQDO\WLFDOWHVWLQJVKRXOGEHSURYLGHGWRWKH2ZQHUSULRUWRGLVSRVDO +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV ' &RQWUDFWRULVUHVSRQVLEOHIRUPDLQWDLQLQJGXVWHPLVVLRQVZLWKLQWKHOHJDOOHYHODQGWKDW OHYHO ZKLFK ZRXOG QRW FUHDWH D QXLVDQFH 'XVW HPLVVLRQV DEUDVLYH GHIOHFWLRQ DQG UHPRYHGSDLQWSDUWLFOHVVKDOOEHFRQWDLQHGZKHUHDEUDVLYHEODVWLQJLVEHLQJDFFRPSOLVKHG XQOHVVYDFXXPEODVWLQJRURWKHUPHDQVRIFOHDQLQJDUHDSSURYHGE\(QJLQHHU1RZDWHU DEUDVLYHGHIOHFWLRQRUSDLQWSDUWLFOHVVKDOOEHDOORZHGWRODQGRQWKHJURXQGDURXQGWKH UHVHUYRLU ( $OO]LQFDQGOHDGSDLQWUHPRYDOZRUNVKDOOEHJRYHUQHGE\EXWQRWQHFHVVDULO\OLPLWHGWR &RGHRI)HGHUDO5HJXODWLRQV&)5DQGDSSOLFDEOHVHFWLRQV +HDOWKDQG6DIHW\&RGH'LYLVLRQ&KDSWHUV&DOLIRUQLD+D]DUGRXV:DVWH &RQWURO$FW 7LWOH &DOLIRUQLD $GPLQLVWUDWLYH &RGH 'LYLVLRQ 0LQLPXP 6WDQGDUG IRU 0DQDJHPHQWRI+D]DUGRXVDQG([WUHPHO\+D]DUGRXV0DWHULDOV 7LWOH&DOLIRUQLD$GPLQLVWUDWLYH&RGH &RGHRI)HGHUDO5HJXODWLRQV&)5DSSOLFDEOHVHFWLRQV ) 7UDQVSRUWDWLRQDQG'LVSRVDORI'HEULV7KH&RQWUDFWRUVKDOODUUDQJHWRKDYHWKHGHEULV WUDQVSRUWHGIURPWKHVLWHLQDFFRUGDQFHZLWKWKHUHTXLUHPHQWVRI7LWOH&)5DQG GLVSRVHGRISURSHUO\LQDFFRUGDQFHZLWK7LWOH&)5DQG&)53URWHFWLRQRI (QYLURQPHQW6LJQHGPDQLIHVWVVKDOOEHUHWXUQHGWRWKH(QJLQHHUWRYHULI\WKDWDOOVWHSV RIWKHKDQGOLQJDQGGLVSRVDOSURFHVVKDYHEHHQFRPSOHWHGSURSHUO\7KH2ZQHULV FRQVLGHUHGWKHJHQHUDWRURQWKLVSURMHFWWKH&RQWUDFWRUZLOOEHQDPHGFRJHQHUDWRU :ULWWHQFRQILUPDWLRQWKDWWKHGHEULVZLOOEHWUHDWHGDQGGLVSRVHGRILQDFFRUGDQFH ZLWKUHTXLUHPHQWVRI7LWOH&)53DUWDQG7LWOH&)53DUW&&57LWOH 'LYLVLRQDQG+6&'LYLVLRQ&KVKDOOEHUHFHLYHGE\WKH(QJLQHHU SULRUWRVWDUWRIWKHZRUN7KHZDVWHZLOOEHGLVSRVHGRIDVDSSURYHGE\(QJLQHHU DQG&LW\7KHSURJUDPVVKDOOSURYLGHDVVXUDQFHWKDWWKHGHEULVLVKDQGOHGSURSHUO\ IURPFUDGOHWRJUDYHDQGLQFOXGHWKHQHFHVVDU\QRWLILFDWLRQVDQGFHUWLILFDWLRQVRQ VKLSPHQWVSURYLGHWKHQDPHRIWKHGLVSRVDOIDFLOLW\DQGLQFOXGHDVFKHGXOHIRUWKH VXEPLWWDORIWKHFRPSOHWHGPDQLIHVWVWRWKH(QJLQHHU * 7KH&LW\VKDOOUHPRYHIRXUUHSUHVHQWDWLYHVDPSOHVRIVRLOIURPMREVLWHSULRUWRVWDUWRI ZRUN6DPSOHVVKDOOEHWHVWHGIRUGHWHUPLQDWLRQRIOHDG]LQFDQGFKURPLXPFRPSRXQGV WRHQVXUHVRLOGRHVQRWFRQWDLQH[FHVVLYHOHYHOVRIQRWHGKHDY\PHWDOV,IVRLOVFRQWDLQ H[FHVVLYHOHYHOVRIQRWHGRURWKHUKHDY\PHWDOVVLWHUHPHGLDWLRQVKDOOEHWKHUHVSRQVLELOLW\ RI WKH &LW\ &RSLHV RI ODERUDWRU\ DQDO\VHV UHSRUWV VKDOO EH IRUZDUGHG WR &RQWUDFWRU LPPHGLDWHO\ XSRQ UHFHLSW IURP ODERUDWRU\ SULRU WR VWDUW RI DQ\ ZRUN $Q\ UHTXLUHG UHPHGLDWLRQVFKHGXOHZLOOEHGHWHUPLQHGE\WKH&LW\ 685)$&(35(3$5$7,21,163(&7,21%/$67 $ 6HYHUHO\FRUURGHGVXUIDFHVGHVLJQDWHGE\WKH(QJLQHHUVKDOOEHEODVWFOHDQHGWR663& 63%ODVW&OHDQLQJWR1HDU:KLWH0HWDOWRGHWHUPLQHWKHFRQGLWLRQRIWKHVXEVWUDWHWR GHWHUPLQHLIUHSDLULVUHTXLUHG 7KHKRXUO\FUHZUDWHZLOOEHEDVHGRQDPLQLPXPPDQFUHZZLWKWKHIROORZLQJ +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV PLQLPXPHTXLSPHQW D $PLQLPXP1RRU1RQR]]OHZLWKDGLDPHWHUKRVH E $PLQLPXPFRPSUHVVRU F $PLQLPXPEDJEODVWSRW G 3DUWLFOHVL]HRIDEUDVLYHVKDOOEHDPLQLPXPJULW 685)$&(35(3$5$7,21,17(5,25 $ $OO FRDO WDU HQDPHO SUHVHQW RQ WKH LQWHULRU VXUIDFH VKDOO EH UHPRYHG E\ SQHXPDWLF PHFKDQLFDOFKLSSLQJPHWKRG % $OO LQWHULRU VXUIDFHV VKDOO EH EODVW FOHDQHG LQ FRQIRUPDQFH WR 6RFLHW\ IRU 3URWHFWLYH &RDWLQJV 6SHFLILFDWLRQ 663&63 %ODVW &OHDQLQJ WR 1HDU:KLWH0HWDO )LHOG EODVW FOHDQLQJIRUDOOLQWHULRUVXUIDFHVVKDOOEHE\GU\PHWKRG 7KHFRPSOHWHLQWHULRUDQGH[WHULRURIDOOURRISHQHWUDWLRQVLQFOXGLQJEXWQRWOLPLWHG WRFHQWHUYHQWVWUXFWXUHURRIYHQWVURRIKDWFKHVFDWKRGLFSURWHFWLRQKDQGKROHV DX[LOLDU\SRUWVHWFVKDOOEHEODVWFOHDQHGWR663&63LQFOXGLQJRQHIRRW SDVWWKHURRISHQHWUDWLRQRQWRWKHH[WHULRUURRIZKHQLQWHULRUURRIVXUIDFHVDUH EODVWHG7KHSHULPHWHURIWKHEODVWFOHDQHGVXUIDFHVVKDOOEHFXWWRVWUDLJKWOLQHV DQGWKHHGJHRIWKHH[LVWLQJSDLQWV\VWHPVXIILFLHQWO\IHDWKHUHGWRFUHDWHDVPRRWK WUDQVLWLRQEHWZHHQWKHWZRSDLQWV\VWHPV 3DUWLFOHVL]HRIDEUDVLYHVXVHGLQEODVWFOHDQLQJVXUIDFHVWRXOWLPDWHO\UHFHLYH HSR[\VKDOOEHWKDWZKLFKZLOOSURGXFHDPLQLPXPRIDPLOVXUIDFHSURILOH &RQWUDFWRUVKDOOEHUHVSRQVLEOHIRUUHPRYDODQGUHSODFHPHQWRIFHQWHUYHQWFRYHU DVQHHGHGWRFRDWDQGSDLQWDOOVXUIDFHV7KHVFRSHRIZRUNLQWKHVWUXFWXUDO SRUWLRQ RI WKH WHFKQLFDO VSHFLILFDWLRQV UHTXLUHV QHZ VFUHHQLQJWR EH LQVWDOOHG 7KHUHIRUHUHPRYDORIWKHYHQWFRYHUVKDOOEHFRRUGLQDWHGEHWZHHQWKHFRDWLQJ FRQWUDFWRUDQGWKHVWUXFWXUDOFRQWUDFWRU & 7KHWRSVLGHRIWKHH[LVWLQJUDIWHUVDQGWKHURRISODWHVDERYHWKHUDIWHUVVKDOOEHDEUDVLYH EODVWFOHDQHGLQFRQIRUPDQFHWR6RFLHW\IRU3URWHFWLYH&RDWLQJV6SHFLILFDWLRQ663&63 %ODVW&OHDQLQJWR1HDU:KLWH0HWDO $EUDVLYHEODVWFOHDQLQJRIWKHWRSVLGHRIWKHUDIWHUVDQGURRISODWHVPD\UHTXLUH EXWQRWEHOLPLWHGWRGLUHFWLQJWKHEODVWQR]]OHDWWKHURRIWRULFRFKHWWKHDEUDVLYH RIIWKHURRIE\ZHGJLQJWKHURRIDQGRUXWLOL]LQJDQJOHRUEDQDQDQR]]OHVRURWKHU DSSURYHGPHWKRGWKDWDFFRPSOLVKHVWKHVSHFLILHGFOHDQOLQHVV $EUDVLYHEODVWLQJLQFRQIRUPDQFHWR663&63%ODVW&OHDQLQJWR1HDU:KLWH 0HWDOZLOOQRWEHUHTXLUHGLQDUHDVZKHUHWKHURRIFDQQRWEHOLIWHGDERYHWKHUDIWHUV LQFOXGLQJEXWQRWOLPLWHGWRQHDUWKHVKHOORUDUHDVZKHUHWKHURRISODWHVDUH ZHOGHG WR WKH WRS DQJOH RU RWKHU VWUXFWXUDO PHPEHUV DV GHWHUPLQHG E\ WKH (QJLQHHU 7KHVHDUHDVVKDOOEHDEUDVLYHEODVWHGE\WKHEODVWQR]]OHEHLQJGLUHFWHG DWWKHYRLGEHWZHHQWKHURRIDQGWRSVLGHRIWKHUDIWHUIURPERWKVLGHVWRUHPRYHDOO ORRVHUXVWPLOVFDOHDQGFRDWLQJWRDFFRPSOLVKWKHVSHFLILHGFOHDQOLQHVVRI%UXVK RII%ODVW&OHDQLQJ663&63 +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV ' :HGJLQJEHWZHHQWKHUDIWHUVDQGWKHURRISODWHVDPLQLPXPRIò VKDOOEHDFFRPSOLVKHG E\WKH&RQWUDFWRUIRUDFFHVVE\WKH&LW\¶V,QVSHFWRUWRLQVSHFWWKHWRSVLGHRIWKHUDIWHUV DQGURRISODWHV 685)$&(35(3$5$7,21(;7(5,25 $ $OOH[WHULRUVXUIDFHVDSSXUWHQDQFHVDQGSLSLQJVKDOOEHEODVWFOHDQHGLQFRQIRUPDQFHWR 6RFLHW\IRU3URWHFWLYH&RDWLQJV6SHFLILFDWLRQ663&63%ODVW&OHDQLQJWR1HDU:KLWH 0HWDO 6XUIDFH SUHSDUDWLRQ DURXQG WKH URRI KDWFKHV DQG SHQHWUDWLRQV VKDOO EH LQ DFFRUGDQFHZLWK6HFWLRQ%DERYH $33/,&$7,21*(1(5$/ $ &RDWLQJ DQG SDLQW DSSOLFDWLRQ VKDOO FRQIRUP WR WKH UHTXLUHPHQWV RI WKH 6RFLHW\ IRU 3URWHFWLYH&RDWLQJV3DLQW$SSOLFDWLRQ6SHFLILFDWLRQ663&3$ODWHVWUHYLVLRQIRU³6KRS )LHOGDQG0DLQWHQDQFH3DLQWLQJ´WKH&LW\WKHPDQXIDFWXUHURIWKHFRDWLQJDQGSDLQW PDWHULDOVSULQWHGOLWHUDWXUHDQGDVVSHFLILHGKHUHLQDQGDSSURYHGE\WKH(QJLQHHU % 7KLQQLQJVKDOORQO\EHSHUPLWWHGDVUHFRPPHQGHGE\WKHPDQXIDFWXUHUDQGDSSURYHGE\ WKH(QJLQHHUDQGVKDOOQRWH[FHHGOLPLWVVHWE\DSSOLFDEOHUHJXODWRU\DJHQFLHV ,I&RQWUDFWRUDSSOLHVDQ\PDWHULDOVZKLFKKDYHEHHQPRGLILHGRUWKLQQHGWRVXFKD GHJUHHDVWRFDXVHWKHPWRH[FHHGHVWDEOLVKHG92&OHYHOV&RQWUDFWRUVKDOOEH UHVSRQVLEOHIRUDQ\ILQHVFRVWVUHPHGLHVRUOHJDODFWLRQDQGFRVWVWKDWPD\UHVXOW & (DFKDSSOLFDWLRQRIFRDWLQJDQGSDLQWVKDOOEHDSSOLHGHYHQO\IUHHRIEUXVKPDUNVVDJV UXQVDQGQRHYLGHQFHRISRRUZRUNPDQVKLS&DUHVKRXOGEHH[HUFLVHGWRDYRLGODSSLQJ RQJODVVRUKDUGZDUH&RDWLQJVDQGSDLQWVVKDOOEHVKDUSO\FXWWROLQHV)LQLVKHGVXUIDFHV VKDOOEHIUHHIURPGHIHFWVRUEOHPLVKHV ' 3URWHFWLYHFRYHULQJVRUGURSFORWKVVKDOOEHXVHGWRSURWHFWIORRUVIL[WXUHVHTXLSPHQW SUHSDUHGVXUIDFHDQGDSSOLHGSDLQWV3HUVRQQHOZDONLQJRQH[WHULRUURRIRIUHVHUYRLUVKDOO WDNHSUHFDXWLRQVWRSUHYHQWGDPDJHRUFRQWDPLQDWLRQRISDLQWHGVXUIDFHV,IUHTXLUHGE\ (QJLQHHU SHUVRQQHO VKDOO ZHDU VRIWVROHG VKRHV RU VKRH FRYHULQJV DSSURYHG E\ (QJLQHHU&DUHVKDOOEHH[HUFLVHGWRSUHYHQWFRDWLQJRUSDLQWIURPEHLQJVSDWWHUHGRQWR VXUIDFHVZKLFKDUHQRWWREHFRDWHGRUSDLQWHG6XUIDFHVIURPZKLFKVXFKPDWHULDOFDQQRW EHUHPRYHGVDWLVIDFWRULO\VKDOOEHUHILQLVKHGDVUHTXLUHGWRSURGXFHDILQLVKVDWLVIDFWRU\WR WKH(QJLQHHU ( $OOPDWHULDOVVKDOOEHDSSOLHGDVVSHFLILHGKHUHLQ ) $OOZHOGVDQGLUUHJXODUVXUIDFHVVKDOOUHFHLYHDVHSDUDWHEUXVKFRDWRIWKHVSHFLILHG SURGXFWSULRUWRDSSOLFDWLRQRIWKHLQWHUPHGLDWHFRDWDQGDVHSDUDWHEUXVKFRDWSULRUWRWKH DSSOLFDWLRQ RI WKH ILQLVK FRDW $SSOLFDWLRQ RI VWULSH FRDW VKDOO QRW EH DFFRPSOLVKHG VLPXOWDQHRXVO\ZLWKVSUD\FRDWDQGVKDOOEHDOORZHGWRGU\DVXIILFLHQWDPRXQWRIWLPH EHIRUHDSSOLFDWLRQRIVXEVHTXHQWVSUD\FRDW&RDWLQJDQGSDLQWVKDOOEHEUXVKHGLQ PXOWLSOHGLUHFWLRQVWRHQVXUHSHQHWUDWLRQDQGFRYHUDJHDVDSSURYHGE\WKH(QJLQHHU 7KHVHDUHDVLQFOXGHEXWDUHQRWOLPLWHGWRZHOGVQXWVEROWVHWF&DUHVKDOOEHH[HUFLVHG WR HQVXUH GU\ ILOP WKLFNQHVV RI FRDWLQJV DQG SDLQWV GRHV QRW H[FHHG WKH PD[LPXP +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV WKLFNQHVVDOORZHGE\WKHPDQXIDFWXUHURIWKHVSHFLILFSURGXFWEHLQJDSSOLHG $OOZHOGVDQGLUUHJXODUVXUIDFHVXOWLPDWHO\UHFHLYLQJHSR[\FRDWLQJRQO\ UHTXLUHRQHVWULSHFRDWEHWZHHQWKHSULPHFRDWDQGWKHVROLGVHSR[\FRDWLQJ * $WFRQFOXVLRQRIHDFKGD\¶VEODVWFOHDQLQJDQGFRDWLQJDQGSDLQWRSHUDWLRQVDZLGH VWULSRIEODVWFOHDQHGVXEVWUDWHVKDOOUHPDLQXQFRDWHGWRIDFLOLWDWHORFDWLQJSRLQWRIRULJLQ IRUVXFFHVVLYHGD\¶VEODVWFOHDQLQJRSHUDWLRQV + (SR[\FRDWHGVXUIDFHVRURWKHUPXOWLFRPSRQHQWPDWHULDOVH[SRVHGWRH[FHVVLYHVXQOLJKW RUDQH[FHVVLYHWLPHHOHPHQWEH\RQGPDQXIDFWXUHU¶VUHFRPPHQGHGUHFRDWF\FOHVKDOOEH VFDULILHGE\%UXVKRII%ODVW&OHDQLQJ663&63RUPHWKRGVDSSURYHGE\(QJLQHHUSULRU WRDSSOLFDWLRQRIDGGLWLRQDOFRDWLQJ6FDULILHGFRDWLQJVKDOOKDYHVXIILFLHQWGHSWKWRHQVXUH DPHFKDQLFDOERQGRIVXEVHTXHQWFRDWDVUHFRPPHQGHGE\WKHPDQXIDFWXUHU , $OODWWDFKPHQWVDFFHVVRULHVDQGDSSXUWHQDQFHVVKDOOEHSUHSDUHGDQGILQLVKHGLQWKH VDPH PDQQHU DV VSHFLILHG IRU DGMRLQLQJ UHVHUYRLU VHFWLRQV H[FHSW DV VSHFLILFDOO\ GHVLJQDWHGE\WKH(QJLQHHU - (DFKVXFFHVVLYHDSSOLFDWLRQRIFRDWLQJRUSDLQWVKDOOEHRIVXIILFLHQWFRQWUDVWLQFRORUWR IDFLOLWDWHLQVSHFWLRQIRUXQLIRUPFRYHUDJHRIHDFKFRDW2ZQHUVKDOOGHVLJQDWHILQLVKFRORUV $33/,&$7,21,17(5,25(32;<&2$7,1*6<67(0 $ ,QWHULRU6XUIDFHV$ERYHWKH%RWWRP $IWHUFRPSOHWLRQRIVXUIDFHSUHSDUDWLRQDVVSHFLILHGDOOVXUIDFHVDERYHWKHERWWRP VKDOOUHFHLYHWKUHHPLOFRDWVRIHSR[\FRDWLQJVSHFLILHGXQGHU'63(&,),& ,17(5,25&2$7,1*0$7(5,$/67RWDOGU\ILOPWKLFNQHVVRIWKHFRPSOHWHG V\VWHPVKDOOEHDPLQLPXPRIPLOV D :HGJLQJEHWZHHQWKHUDIWHUVDQGURRISODWHVDPLQLPXPRIòVKDOOEH DFFRPSOLVKHG E\ WKH &RQWUDFWRU GXULQJ WKH FRDWLQJ SURFHVV IRU WKH SXUSRVHVRIFRDWLQJWKHWRSVLGHRIWKHUDIWHUVDQGLQVSHFWLRQE\&LW\¶V ,QVSHFWRU &RDWLQJ VKDOO EH DFFRPSOLVKHG LQ DFFRUGDQFH ZLWK ) $33/,&$7,21*(1(5$/7KHUDIWHUZHGJHVVKDOOEHPRYHGEHWZHHQ HDFKFRDWDQGHDFKVWULSHFRDW E $OOURRISHQHWUDWLRQVSUHSDUHGLQDFFRUGDQFHZLWK%VKDOOEHSULPHG FRQFXUUHQWO\ DV RQH XQLW RQ DOO LQWHULRU DQG H[WHULRU VXUIDFHVRI WKH SHQHWUDWLRQVDQGVKDOOUHFHLYHILUVWVWULSHFRDWLQWHUPHGLDWHFRDWVHFRQG VWULSHFRDWDQGILQLVKFRDWRQWKHLQWHULRUDQGH[WHULRUVXUIDFHVFRQFXUUHQWO\ ZKLOHWKHVHFRDWVDUHEHLQJDFFRPSOLVKHGRQWKHLQWHULRUVXUIDFHVRIWKH UHVHUYRLU F 0D[LPXP GU\ ILOP WKLFNQHVV DOORZHG LI QRW VSHFLILHG LQ PDQXIDFWXUHU¶V DSSURYHG OLWHUDWXUH ZLOO EH DV GHWHUPLQHG LQ ZULWLQJ E\ WKHFRDWLQJ PDQXIDFWXUHU¶VKHDGTXDUWHUVWHFKQLFDOUHSUHVHQWDWLYH % ,QWHULRU%RWWRP6XUIDFHVDQG/RZHU)HHWRIWKH6KHOO &ROXPQV +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV $IWHUFRPSOHWLRQRIVXUIDFHSUHSDUDWLRQDVVSHFLILHGDOOERWWRPVXUIDFHVDQGORZHU IHHWRIWKHVKHOODQGFROXPQVVKDOOUHFHLYHWKHSULPHUVSHFLILHGXQGHU' 63(&,),&,17(5,25&2$7,1*0$7(5,$/6'U\ILOPWKLFNQHVVVKDOOQRWEHOHVV WKDQPLOV $IWHUFRPSOHWLRQRISULPHFRDWHLWKHURQHPLOFRDWRUWZRPLOFRDWVRI FRDWLQJVSHFLILHGXQGHU(63(&,),&,17(5,25&2$7,1*0$7(5,$/6VKDOO EHDSSOLHG7RWDOGU\ILOPWKLFNQHVVRIWKHV\VWHPVKDOOEHQRWOHVVWKDQPLOVDW DQ\SRLQWLQWKHFRDWHGVXUIDFH D 3ULRUWREHJLQQLQJWKHVROLGVFRDWLQJDSSOLFDWLRQDIW[IWWHVWSDWFK RQSODVWLFRXWVLGHWKHUHVHUYRLUVKDOOEHSHUIRUPHG7KHWHVWSDWFKVKDOOEH VSUD\HGWRWKHVDPHWKLFNQHVVDVZLOOEHDSSOLHGWRWKHUHVHUYRLU E 5DWLRWHVWVVKDOOEHSHUIRUPHGDWWKHEHJLQQLQJRIHDFKDSSOLFDWLRQSURFHVV DQGSHUIRUPHGHYHU\KRXUVWKHUHDIWHUXQWLOWKHDSSOLFDWLRQLVFRPSOHWHGIRU WKHGD\7KHUDWLRWHVWVKDOOEHDPLQLPXPRIRXQFHVIRUWKHSDUWUHTXLULQJ WKHOHDVWTXDQWLW\ F 0D[LPXP GU\ ILOP WKLFNQHVV DOORZHG LI QRW VSHFLILHG LQ PDQXIDFWXUHU¶V DSSURYHG OLWHUDWXUH ZLOO EH DV GHWHUPLQHG LQ ZULWLQJ E\ WKHFRDWLQJ PDQXIDFWXUHU¶VKHDGTXDUWHUVWHFKQLFDOUHSUHVHQWDWLYH G ,IDSSURYHGE\WKHPDQXIDFWXUHUWKHVWULSHFRDWPD\EHWKHVDPHSURGXFW DVWKHSULPHFRDWQRWHGRQWKHSURGXFWGDWDVKHHW & 5RRI-XQFWLRQ9RLG5RRI/DS-RLQWVDQG2WKHU'HVLJQDWHG9RLG$UHDV $IWHUFRPSOHWLRQRIILQLVKFRDWDSSOLFDWLRQRIHSR[\FRDWLQJDQGKROLGD\GHWHFWLRQ DQGWRXFKXSDVVSHFLILHGDOOYRLGDUHDVLQFOXGLQJEXWQRWOLPLWHGWRFROXPQ EDVHVEROWKROHVDQGURRIODSMRLQWVVKDOOEHSULPHGLIUHTXLUHGDQGILOOHGZLWK MRLQW VHDODQW DV VSHFLILHG XQGHU ) 63(&,),& ,17(5,25 &2$7,1* 0$7(5,$/6IRUVXUIDFHVEHORZWKHZDWHUOHYHODQG*IRUVWUXFWXUDOPHPEHUV DERYHWKHZDWHU3ULRUWRILOOLQJMRLQWVDUHDVKDOOEHEORZQGRZQRUZLSHGDV QHFHVVDU\WRFOHDQDUHD9RLGVVKDOOEHILOOHGIOXVKDWDDQJOHGHJUHHVRXW IURPXSSHUHGJHRIWKHSODWHLQDFFRUGDQFHZLWKWKHSODQV D 3ULRUWRDSSO\LQJWKHFDXONLQJDWWKHEDVHRIWKHFROXPQVWKHWRSRIWKH FROXPQEDVHSODWHDQGWKHDGMDFHQWERWWRPSODWHDGLVWDQFHRIUDWLR GHJUHHDQJOHIURPWRSRXWHUHGJHRIWKHSODWHVKDOOEHPDVNHGWR REWDLQDFOHDQOLQH5HPRYHPDVNLQJDIWHUFRPSOHWLRQRIWKHFDXONLQJ 48$/,7<$6685$1&(,17(5,25(32;<&2$7,1*6<67(0 $ $OOFRDWLQJFRPSRQHQWVVKDOOEHPL[HGLQH[DFWSURSRUWLRQVVSHFLILHGE\WKHPDQXIDFWXUHU &DUHVKDOOEHH[HUFLVHGWRHQVXUHDOOPDWHULDOLVUHPRYHGIURPFRQWDLQHUVGXULQJPL[LQJ DQGPHWHULQJRSHUDWLRQV % $OOFRDWLQJVVKDOOEHWKRURXJKO\PL[HGXWLOL]LQJDQDSSURYHGVORZVSHHGSRZHUPL[HUXQWLO DOOFRPSRQHQWVDUHWKRURXJKO\FRPELQHGDQGDUHRIDVPRRWKFRQVLVWHQF\&RDWLQJVVKDOO QRWEHDSSOLHGEH\RQGSRWOLIHOLPLWVRUUHFRDWF\FOHVVSHFLILHGE\PDQXIDFWXUHU +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV & 7KLQQHUV VKDOO EH DGGHG WR FRDWLQJ PDWHULDOV RQO\ DV UHTXLUHG LQ DFFRUGDQFH ZLWK PDQXIDFWXUHU¶VSULQWHGOLWHUDWXUHDQGLQWKHSUHVHQFHRIWKH(QJLQHHU4XDQWLWLHVRIWKLQQHU VKDOOQRWH[FHHGOLPLWVVHWE\DSSOLFDEOHUHJXODWRU\DJHQFLHV ' $SSOLFDWLRQVKDOOEHE\DLUOHVVVSUD\PHWKRGH[FHSWDVRWKHUZLVHVSHFLILHG'U\LQJWLPH EHWZHHQFRDWVVKDOOEHVWULFWO\REVHUYHGDVVWDWHGLQPDQXIDFWXUHU¶VSULQWHGLQVWUXFWLRQV H[FHSWWKHUHVKDOOEHDPLQLPXPRIKRXUVEHWZHHQFRDWV ( 0D[LPXPWLPHWRUHFRDWVKDOOEHVWULFWO\REVHUYHGDVVWDWHGLQWKHPDQXIDFWXUHU¶VSULQWHG LQVWUXFWLRQV&RQWUDFWRUVKDOOEHUHVSRQVLEOHIRUDOOFRVWDVVRFLDWHGZLWKDSSOLFDWLRQRI FRDWLQJ ZLWKLQ WKH UHFRDW ZLQGRZ ,I WKH PD[LPXP UHFRDW ZLQGRZ LV YLRODWHG WKH &RQWUDFWRUZLOOEHUHTXLUHGWREUXVKRIIEODVWWKHVXUIDFHVDVUHTXLUHGE\WKHPDQXIDFWXUHU DQGWKH(QJLQHHU7KH&RQWUDFWRUZLOOEHUHTXLUHGWRSURYLGHDILQHDEUDVLYHWKDWZLOOQRW XQQHFHVVDULO\GDPDJHWKHFRDWLQJWREHVFDULILHG,IUHFRDWYLRODWLRQLVFDXVHGE\WKH &RQWUDFWRU¶VVFKHGXOHDOOFRVWVIRUEUXVKRIIEODVWLQJZLOOEHERUQHE\WKH&RQWUDFWRU ) :KHQWZRRUPRUHFRDWVDUHVSHFLILHGZKHUHSRVVLEOHHDFKFRDWVKDOOFRQWDLQVXIILFLHQW DSSURYHG FRORU DGGLWLYH WR DFW DV DQ LQGLFDWRU RI FRYHUDJH RU WKH FRDWV PXVW EH RI FRQWUDVWLQJFRORU * &DUHVKDOOEHH[HUFLVHGGXULQJVSUD\RSHUDWLRQVWRKROGWKHVSUD\QR]]OHSHUSHQGLFXODU DQGVXIILFLHQWO\FORVHWRVXUIDFHVEHLQJFRDWHGWRDYRLGH[FHVVLYHHYDSRUDWLRQRIYRODWLOH FRQVWLWXHQWV DQG ORVV RI PDWHULDO LQWR WKH DLU RU WKH EULGJLQJRI FUDFNV DQG FUHYLFHV 5HDFKLQJEH\RQGOLPLWVRIVFDIIROGSHULPHWHUZLOOQRWEHSHUPLWWHG$OORYHUVSUD\LGHQWLILHG E\(QJLQHHUVKDOOEHUHPRYHGE\KDQGRUSROHVDQGLQJSULRUWRDSSOLFDWLRQRIVXEVHTXHQW FRDW + -RLQWVHDODQWPD\EHDSSOLHGE\FDXONLQJJXQWURZHORURWKHUDSSURYHGPHWKRG6HDODQW VKDOOEHSUHVVHGILUPO\LQWRYRLGVWRHQVXUHILOOLQJVHDOLQJDQGDSSOLHGDWUDWLR GHJUHHDQJOHIURPWKHWRSHGJHRIWKHSODWH6HHGHWDLOLQWKHSODQV , 8SRQ FRPSOHWLRQ RI FRDWLQJ RSHUDWLRQV DQG SULRU WR FDXONLQJ DIWHU FXULQJ LQWHUYDO LQ DFFRUGDQFH ZLWK PDQXIDFWXUHU¶V UHFRPPHQGDWLRQV KROLGD\ GHWHFWLRQ VKDOO EH DFFRPSOLVKHGZLWKDZLUHEUXVKHOHFWURGHXVLQJWKHVSHFLILHGLQVWUXPHQWDWYROWVIRU WKHURRIDQGVKHOOVXUIDFHVDQGDWYROWVIRUDOOVXUIDFHVZLWKHSR[\FRDWLQJ 5HSDLU DQG UHWHVWLQJ VKDOO EH DFFRPSOLVKHG DV VSHFLILHG XQGHU 48$/,7< $6685$1&((QJLQHHULVQRWSUHFOXGHGIURPYHULI\LQJDGHTXDF\RIKROLGD\WHVWLQJE\ DFFRPSOLVKLQJKROLGD\GHWHFWLRQRIVHOHFWHGDUHDVXVLQJKLVRZQKROLGD\GHWHFWRU 8SRQFRPSOHWLRQRIFRDWLQJDSSOLFDWLRQWRERWWRPVXUIDFHVORZHUVKHOOVXUIDFHVRI FRPSOHWHG HSR[\ FRDWLQJ ZKLFK PD\ KDYH EHHQ VXEMHFWHG WR GDPDJHIURP DEUDVLYHEODVWFOHDQLQJRIERWWRPVXUIDFHVVKDOOEHKROLGD\GHWHFWHGDJDLQDQG UHSDLUHGDVQRWHGDERYH - $OOPL[LQJWKLQQLQJDSSOLFDWLRQDQGKROLGD\GHWHFWLRQRIFRDWLQJVVKDOOEHDFFRPSOLVKHG LQWKHSUHVHQFHRIWKH(QJLQHHU . $WLPHHOHPHQWHTXLYDOHQWWRGD\VFXULQJWLPHDWGHJUHHV)DQGUHODWLYHKXPLGLW\ VKDOOEHDOORZHGEHIRUHSODFLQJWKHHSR[\FRDWLQJLQWRVHUYLFHDVGHWHUPLQHGLQ ),1$/&85,1*2)(32;<&2$7,1*6 +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV ),1$/&85,1*2)(32;<&2$7,1*6 $ 8SRQFRPSOHWLRQDQGDFFHSWDQFHRIDSSOLHGFRDWLQJV\VWHP&RQWUDFWRUVKDOOIXUQLVKDQ DSSURYHGH[KDXVWIDQRUEORZHURIVXIILFLHQWFDSDFLW\WRHQVXUHUHPRYDORIVROYHQWYDSRUV GXULQJFXULQJSURFHVV7KHIDQRUEORZHUDIWHUDSSURYDOE\(QJLQHHUVKDOOEHLQVWDOOHG DVDSSURYHGE\WKH(QJLQHHUDQGVKDOOUHPDLQLQFRQWLQXRXVRSHUDWLRQXQWLOFRDWLQJLV FRPSOHWHO\FXUHGDVGHWHUPLQHGE\WKHPDQXIDFWXUHURIWKHFRDWLQJV\VWHP2SHUDWLRQ DQGPDLQWHQDQFHRIEORZHUGXULQJFXULQJRSHUDWLRQVVKDOOEHWKHUHVSRQVLELOLW\RIWKH&LW\ LI&RQWUDFWRUKDVFRPSOHWHGDOORQJRLQJZRUNDQGZRUNHUVDUHQRWZRUNLQJDWWKHVLWH,Q WKH HYHQW RI EORZHU PDOIXQFWLRQ &LW\ ZLOO LPPHGLDWHO\ QRWLI\ &RQWUDFWRU ZKR ZLOO EH UHVSRQVLEOHIRULPPHGLDWHUHSDLURIEORZHURUIXUQLVKLQJRIDQRWKHURSHUDWLQJEORZHUXQWLO FRPSOHWLRQRIFXULQJRSHUDWLRQV ,IGHKXPLGLILFDWLRQLVEHLQJXVHGWKHHTXLSPHQWVKDOOUHPDLQLQSODFHDQGUXQ FRQWLQXRXVO\GXULQJDOOFXULQJRSHUDWLRQV % $IWHUFRPSOHWLRQRIFXULQJF\FOHDVQRWHGDERYHWKH&RQWUDFWRUVKDOOWHVWWKHDSSOLHG FRDWLQJZLWKDVROYHQWUXEWHVWSHUIRUPHGLQDFFRUGDQFHWR$670'WRYHULI\WRWKH (QJLQHHUDGHTXDWHFXULQJKDVEHHQDWWDLQHG ,IILQDOFXUHKDVQRWEHHQDWWDLQHGEDVHGRQDERYHWHVWVYHQWLODWLRQVKDOOEH FRQWLQXHGXQWLODSSOLHGFRDWLQJSDVVHVWKH³DFHWRQHZLSHWHVW´RU³KDUGQHVVWHVW´ & $IWHUILQDOFXUHLVDSSURYHGE\(QJLQHHU&RQWUDFWRUVKDOOUHPRYHIDQRUEORZHU $33/,&$7,21(;7(5,253$,17$1'48$/,7<$6685$1&()253$,176<67(06 $ $IWHUFRPSOHWLRQRIVXUIDFHSUHSDUDWLRQDVVSHFLILHGDOOH[WHULRUVXUIDFHVSLSLQJDQG HTXLSPHQWER[HVVKDOOUHFHLYHWKHSULPHUVSHFLILHGXQGHU'63(&,),&(;7(5,25 3$,170$7(5,$/6'U\ILOPWKLFNQHVVVKDOOQRWEHOHVVWKDQPLOV 0DQXIDFWXUHU VKDOO SURYLGH UHFRDW ZLQGRZ JXLGHOLQHV IRU SURGXFW EDVHG RQ WHPSHUDWXUHYDULDWLRQVZLWKPLQLPXPDQGPD[LPXPUHFRDWZLQGRZV % $IWHUSURSHUGU\LQJLQWHUYDOSULPHGDUHDVVKDOOEHFDUHIXOO\LQVSHFWHGWRGHWHUPLQHLISDLQW HGJHVKDYHOLIWHGRULIRWKHUGHIHFWVH[LVW,IQHFHVVDU\UHSDLUVVKDOOEHDFFRPSOLVKHG XVLQJSURFHGXUHVDVVSHFLILHGKHUHLQWRDIIHFWDVPRRWKWUDQVLWLRQEHWZHHQSULPHUDQG VXEVHTXHQWFRDWV & 7KHSULPHUVKDOOEHFOHDQGU\DQGVKRZQRHYLGHQFHRIR[LGDWLRQDIWHUZKLFKDOOVXUIDFHV VKDOOUHFHLYHWKHLQWHUPHGLDWHFRDWVSHFLILHGXQGHU(63(&,),&(;7(5,253$,17 0$7(5,$/6WRDGU\ILOPWKLFNQHVVRIPLOV 0DQXIDFWXUHU VKDOO SURYLGH UHFRDW ZLQGRZ JXLGHOLQHV IRU SURGXFW EDVHG RQ WHPSHUDWXUHYDULDWLRQVZLWKPLQLPXPDQGPD[LPXPUHFRDWZLQGRZV ' $IWHUVSHFLILHGGU\LQJLQWHUYDODOOH[WHULRUVXUIDFHVVKDOOUHFHLYHWKHILQLVKFRDWVSHFLILHG XQGHU)63(&,),&(;7(5,253$,170$7(5,$/6WRDGU\ILOPWKLFNQHVVRIPLOV ,IWKHILQLVKFRDWLVDSSOLHGE\UROOLQJWZRFRDWVRIILQLVKFRDWVKDOOEHDSSOLHG +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV ( 7RWDOGU\ILOPWKLFNQHVVRIWKHFRPSOHWHGWKUHHFRDWV\VWHPVKDOOQRWEHOHVVWKDQ PLOVDWDQ\SRLQWLQWKHVXUIDFHZKHUHEDUHPHWDOZDVRULJLQDOO\H[SRVHGRUOHVVWKDQ PLOVDERYHWKHSUHYLRXVWKLFNQHVVZKHUHWKHQHZWZRFRDWV\VWHPZDVDSSOLHGRYHU H[LVWLQJSDLQW 3ULRU WR VWDUW RI LQWHUPHGLDWH FRDW DSSOLFDWLRQ &RQWUDFWRUDQG (QJLQHHU VKDOO FRQGXFWVSRWGU\ILOPWKLFNQHVVWHVWVWRGHWHUPLQHWKHPLQLPXPGU\ILOPWKLFNQHVV RIWKHH[LVWLQJSDLQWV\VWHP$PXWXDODJUHHPHQWVKDOOEHUHDFKHGDVWRWKH VSHFLILFGU\ILOPWKLFNQHVVRIWKHH[LVWLQJSDLQWV\VWHPZKLFKVKDOOWKHQEHXVHGLQ GHWHUPLQLQJLIVXIILFLHQWDGGLWLRQDOSDLQWKDVEHHQDSSOLHGRYHUWKHH[LVWLQJSDLQW D 0D[LPXP GU\ ILOP WKLFNQHVV DOORZHG LI QRW VSHFLILHG LQ PDQXIDFWXUHU¶V DSSURYHG OLWHUDWXUH ZLOO EH DV GHWHUPLQHG LQ ZULWLQJ E\ WKHSDLQW PDQXIDFWXUHU¶VKHDGTXDUWHUVWHFKQLFDOUHSUHVHQWDWLYH E 3DLQWVKDOOQRWEHDSSOLHGZKHQZLQGVSHHGH[FHHGVILIWHHQPLOHVSHUKRXU 3ULRUWRDSSO\LQJWKHILQLVKFRDWWKHUHVHUYRLUERWWRPSODWHH[WHQVLRQ%3(VKDOO UHFHLYHWZREUXVKFRDWVRIWKHHSR[\FRDWLQJ ) 8SRQFRPSOHWLRQRIH[WHULRUSDLQWLQJRSHUDWLRQVLQVSHFWLRQVKDOOEHDFFRPSOLVKHGDV VSHFLILHGXQGHU48$/,7<$6685$1&($OODSSOLFDEOHVHFWLRQVRI48$/,7< $6685$1&(,17(5,25(32;<&2$7,1*6<67(0VKDOODSSO\WRH[WHULRUSDLQWLQJ RSHUDWLRQV * $OOPL[LQJWKLQQLQJDSSOLFDWLRQDQGKROLGD\GHWHFWLRQRIFRDWLQJVDQGSDLQWVVKDOOEH DFFRPSOLVKHGLQWKHSUHVHQFHRIWKH(QJLQHHU + &RORU6FKHPH7KH&RQWUDFWRUVKDOOVXEPLWDFXUUHQWFKDUWRIWKHPDQXIDFWXUHU¶VDYDLODEOH FRORUVWRWKH&LW\¶VUHSUHVHQWDWLYHWHQGD\VSULRUWRVWDUWRISDLQWLQJRSHUDWLRQV , 7KH&RQWUDFWRUVKDOOVXSSO\WKH&LW\ZLWKILYHH[WUDJDOORQVRIERWKWKHHSR[\DQGXUHWKDQH SDLQWVXVHGIRUWKHH[WHULRUVXUIDFHV ',6,1)(&7,21 $ 'LVLQIHFWLQJRILQWHULRUVXUIDFHVRIWKHUHVHUYRLUVKDOOEHDFFRPSOLVKHGLQWKHSUHVHQFHRI WKH(QJLQHHUDQG&LW\¶V2SHUDWLRQVLQFRQIRUPDQFHWR$::$6WDQGDUG&6HFWLRQ &KORULQDWLRQ0HWKRGDVPRGLILHGKHUHLQ 'LVLQIHFWLRQVKDOOEHDFFRPSOLVKHGDIWHUFRPSOHWLRQDQGDFFHSWDQFHE\&LW\RIDOO LQWHULRUUHFRDWLQJDQGFXULQJRIFRDWLQJDVUHTXLUHGLQ),1$/&85,1*2) (32;<&2$7,1*6 3ULRU WR GLVLQIHFWLQJ WKH FRPSOHWH LQWHULRU VKDOO EH FOHDQHG ZLWK DQ DSSURYHG FOHDQHURUGHWHUJHQWDSSOLHGYLDKLJKSUHVVXUHPHWKRG,IGHHPHGQHFHVVDU\E\ (QJLQHHUEHFDXVHRIFRQWDPLQDQWVUHPDLQLQJRQVXUIDFHVLPPHUVHGDUHDVVKDOO EHVFUXEEHGZLWKDEUXVKRUVLPLODULPSOHPHQWZKLFKZLOODSSO\IRUFHDQGSUHVVXUH WR WKH VXUIDFH WR FRPSOHWHO\ UHPRYH UHVLGXDO VROYHQWV DQG RWKHU VXUIDFH FRQWDPLQDQWV +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV &RQWUDFWRUVKDOOFRRUGLQDWHZLWKWKH&LW\WRSXUJHDOOUHVHUYRLUSLSLQJWRUHPRYH VWDJQDWHZDWHUDQGDQ\GHEULVWUDSSHGLQWKHOLQHSULRUWRGLVLQIHFWLQJWKHLQWHULRU RIWKHUHVHUYRLU &OHDQHG VXUIDFHV VKDOO WKHQ EH ULQVHG ZLWK FOHDQ ZDWHU 5HVLGXDO ZDWHU DQG FRQWDPLQDWLRQUHPRYHGGXULQJZDVKLQJSURFHVVVKDOOEHWKRURXJKO\IOXVKHGIURP UHVHUYRLU&RQWUDFWRUVKDOOREWDLQDSSURYDORI&LW\SULRUWRGUDLQLQJDQ\UHVLGXDO ZDWHUWRZDVWH7KLVRSHUDWLRQVKDOOEHDFFRPSOLVKHGDIWHUFRPSOHWLRQRILQWHULRU FRDWLQJZRUNDVGLUHFWHGE\WKH(QJLQHHU $IWHUFRPSOHWLRQRIFOHDQLQJF\FOHVDVQRWHGDERYHDOOLQWHULRUVXUIDFHVVKDOOEH MHWZDVKHGZLWKDFKORULQHRUFKORUDPLQHVROXWLRQKDYLQJDFRQWHQWRI330 &KORULQHRUFKORUDPLQHVROXWLRQXVHGWRGLVLQIHFWWKHLQWHULRURIWKHUHVHUYRLUVKDOO UHPDLQLQWKHERWWRPRIWKHUHVHUYRLUZKHQWKHUHVHUYRLULVILOOHG D &RQWUDFWRUVKDOOIXUQLVKDQGLQVWDOOQHZZKLWH16)DSSURYHGJDVNHWVDQG VWDLQOHVVVWHHOEOXHFRDWHGQXWVDQGEROWVIRUWKHPDQKROHVDQGVHDOXSWKH UHVHUYRLU 2QFHWKHUHVHUYRLUKDVEHHQFRPSOHWHO\ILOOHGWKHUHVHUYRLUZLOOEHLVRODWHGIURP WKHZDWHUV\VWHPDQGWKH&LW\ZLOOWDNHD%DF7WHVW6KRXOGWKH%DF7WHVWIDLO WKH&RQWUDFWRUZLOOEHUHVSRQVLEOHIRUUHLPEXUVLQJWKH&LW\IRUWKHUHMHFWHGDQG GUDLQHGZDWHUDQGZLOOEHUHTXLUHGWRUHFKORULQDWHWKHUHVHUYRLUDVGHVFULEHGDERYH XQWLOWKH%DF7WHVWVDUHQHJDWLYH 7(67,1*)2592/$7,/(25*$1,&&203281'692&¶6 $ 7RPRQLWRUWKHSUHVHQFHRI92&¶VOHDFKHGLQWRWKHZDWHUIURPWKHFRDWLQJSURFHVVWKH IROORZLQJSURFHGXUHVKDOOEHXWLOL]HG $IWHUVDWLVIDFWRU\FXULQJWKHUHVHUYRLUVKDOOEHILOOHGE\&LW\LQDFFRUGDQFHZLWK VWDQGDUGILOOLQJSURFHGXUH:DWHUVKDOOWKHQEHUHWDLQHGIRUDSHULRGRIILYHGD\V 2QWKHVL[WKGD\IROORZLQJFRPSOHWLRQRIWKHILOOLQJRIWKHUHVHUYRLUWKH&LW\ZLOO SHUIRUPD³VQLII´WHVWWRGHWHUPLQHLIXQDFFHSWDEOHFKHPLFDORGRULVSUHVHQW 2QWKHVL[WKGD\IROORZLQJFRPSOHWLRQRIILOOLQJRIUHVHUYRLUDQGSDVVLQJWKH³VQLII WHVW´VDPSOHVRIZDWHUVKDOOEHUHPRYHGE\&LW\LQDFFRUGDQFHZLWKODWHVW6:5&% 'LYLVLRQRI'ULQNLQJ:DWHUPHPRUDQGD6DPSOHVVKDOOWKHQEHIRUZDUGHGE\&LW\ WRDQDSSURYHGWHVWODERUDWRU\IRUWHVWLQJWRGHWHUPLQHSUHVHQFHRI92&¶V $IWHUWHVWLQJRIVDPSOHVUHVXOWVPXVWVKRZOHYHOVRIOHDFKHGRUJDQLFVWREHLQ DFFRUGDQFHZLWKOHYHOVHVWDEOLVKHGE\WKH6:5&%'LYLVLRQRI'ULQNLQJ:DWHUIRU YDULRXV92&¶V5HVXOWVZLOOEHYHULILHGE\6:5&%'LYLVLRQRI'ULQNLQJ:DWHU ,IOHYHOVRIOHDFKHGRUJDQLFVH[FHHGWKRVHDFFHSWDEOHWRWKH6:5&%'LYLVLRQRI 'ULQNLQJ:DWHUWKHUHVHUYRLUVKDOOEHGUDLQHGIOXVKHGUHILOOHGDQGUHWHVWHGDWWKH &RQWUDFWRU¶VH[SHQVH)DLOXUHRIWKHUHVHUYRLUWRDWWDLQOHYHOVDFFHSWDEOHWRWKH 6:5&%'LYLVLRQRI'ULQNLQJ:DWHUVKDOOEHWKHUHVSRQVLELOLW\RIWKH&RQWUDFWRUDQG UHPHGLDOPHDVXUHVWRDWWDLQVXFKOHYHOVVKDOOEHDWKLVVROHH[SHQVH +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV ,IOHDFKHGRUJDQLFVSURGXFHDQ\WDVWHDQGRGRUREMHFWLRQDEOHWRFRQVXPHUVRIWKH ZDWHUIURPWKHUHVHUYRLUWKHUHVHUYRLUVKDOOEHGUDLQHGUHFOHDQHGIOXVKHGUHILOOHG DQGUHWHVWHGDWWKH&RQWUDFWRU¶VH[SHQVH)DLOXUHRIWKHUHVHUYRLUWREHWDVWHDQG RGRUIUHHVKDOOEHWKHUHVSRQVLELOLW\RIWKH&RQWUDFWRUDQGUHPHGLDOPHDVXUHVWR DWWDLQVXFKDFRQGLWLRQVKDOOEHDWKLVVROHH[SHQVH &/($183 $ 8SRQFRPSOHWLRQRIWKHZRUNDOOVWDJLQJVFDIIROGLQJDQGFRQWDLQHUVVKDOOEHUHPRYHG IURPWKHVLWHRUGHVWUR\HGLQDPDQQHUDSSURYHGE\WKH(QJLQHHU&RDWLQJSDLQWDQG WKLQQHUFRQWDLQHUVDQGH[FHVVFRDWLQJVSDLQWVDQGWKLQQHUVVKDOOEHGLVSRVHGRILQ FRQIRUPDQFHWRFXUUHQWUHJXODWLRQV&RDWLQJRUSDLQWVSRWVXSRQDGMDFHQWVXUIDFHVVKDOO EHUHPRYHGDQGWKHHQWLUHMREVLWHFOHDQHG$OOGDPDJHWRVXUIDFHVUHVXOWLQJIURPWKH ZRUNRIWKLVVHFWLRQVKDOOEHFOHDQHGUHSDLUHGRUUHILQLVKHGWRWKHFRPSOHWHVDWLVIDFWLRQRI WKH(QJLQHHUDWQRFRVWWRWKH&LW\ % 8SRQFRPSOHWLRQDQGDFFHSWDQFHRIDOOFRDWLQJDQGSDLQWLQJRSHUDWLRQVVLWHVRLOVKDOOEH UHWHVWHGE\&LW\LQVDPHORFDWLRQVWHVWHGSULRUWRVWDUWRIZRUNIRUSUHVHQFHRIOHDGRU RWKHUKHDY\PHWDOV7HVWLQJVKDOOEHDFFRPSOLVKHGE\WKHVDPHODERUDWRU\DVWKHRULJLQDO WHVWLQJXQGHUUHTXLUHPHQWVRI7LWOH,IVRLOVFRQWDLQH[FHVVLYHOHYHOVRIOHDGRURWKHU KHDY\ PHWDOV DERYH WKRVH OHYHOV GHWHUPLQHG E\ WHVWLQJ DW VWDUWRI ZRUN DQG EH\RQG DFFHSWDEOHOHYHOVRIFXUUHQWUHJXODWLRQV&RQWUDFWRUVKDOOEHUHVSRQVLEOHIRUUHPRYDODQG GLVSRVDORIFRQWDPLQDWHGVRLODQGUHWXUQLQJWKHVLWHWRLWVRULJLQDOFRQGLWLRQ&RSLHVRI ODERUDWRU\DQDO\VHVUHSRUWVVKDOOEHIRUZDUGHGWR&RQWUDFWRULPPHGLDWHO\XSRQUHFHLSW IURPODERUDWRU\SULRUWRVWDUWRIDQ\ZRUN$Q\UHTXLUHGUHPHGLDWLRQVFKHGXOHZLOOEH GHWHUPLQHGE\WKH&LW\ 20,66,216 &DUHKDVEHHQWDNHQWRGHOLQHDWHKHUHLQWKRVHVXUIDFHVWREHFRDWHGRUSDLQWHG+RZHYHU LIFRDWLQJDQGSDLQWLQJUHTXLUHPHQWVKDYHEHHQLQDGYHUWHQWO\RPLWWHGIURPWKLVVHFWLRQRU DQ\ RWKHU VHFWLRQ RI WKH VSHFLILFDWLRQV LW LV LQWHQGHG WKDW DOO PHWDO VXUIDFHV XQOHVV VSHFLILFDOO\H[HPSWHGKHUHLQVKDOOUHFHLYHDILUVWFODVVSURWHFWLYHV\VWHPHTXDOWRWKDW JLYHQWKHVDPHW\SHVXUIDFHSXUVXDQWWRWKHVHVSHFLILFDWLRQV (1'2)6(&7,21 +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV 6(&7,210,6&(//$1(2866758&785$/02',),&$7,21663(&,),&$7,21 3$57*(1(5$/ 385326( 7KLVVSHFLILFDWLRQHVWDEOLVKHVPHWKRGVDQGSURFHGXUHVIRUPLVFHOODQHRXVVWUXFWXUDODQG VDIHW\PRGLILFDWLRQV $33/,&$%/(67$1'$5'6$1'63(&,),&$7,216 $ :HOGLQJDQGGHVLJQVKDOOEHDFFRPSOLVKHGLQFRQIRUPDQFHWRWKHODWHVWUHYLVLRQRI$::$ '6WDQGDUGIRU:HOGHG6WHHO7DQNVIRU:DWHU6WRUDJH:KHUHWROHUDQFHVDQGGHWDLOV DUH QRW GHILQHG E\ WKH $::$ 6WDQGDUG WKH DSSOLFDEOH VHFWLRQV RI WKH $PHULFDQ 3HWUROHXP,QVWLWXWH$3,6WDQGDUGVKDOODSSO\:HOGHUVVKDOOEHFHUWLILHGWRWKH SURFHGXUHDQGSURFHVVFDOOHGIRULQWKHZRUNDQGFHUWLILFDWLRQSDSHUVVKDOOEHRQILOHZLWK WKH&RQWUDFWRUDWWKHMREVLWHRULQSRVVHVVLRQRIZHOGHUVDWDOOWLPHV % &RQWUDFWRULVWRVXEPLWVKRSGUDZLQJVRUVNHWFKHVLQGHWDLORIHDFKLWHPWREHDGGHG UHSODFHG RU PRGLILHG DV QRWHG LQ &RQWUDFWRU LV UHVSRQVLEOH IRU YHULI\LQJ DOO PHDVXUHPHQWVLQWKHILHOGEHIRUHIDEULFDWLRQRULQVWDOODWLRQRIDQ\LWHPVDVW\SLFDOGUDZLQJV PD\QRWDFFXUDWHO\UHSUHVHQWDFWXDOILHOGFRQGLWLRQV &2175$&725 7KH &RQWUDFWRU VKDOO EH OLFHQVHG XQGHU WKH ODZV RI WKH 6WDWH RI &DOLIRUQLD LQ WKH FODVVLILFDWLRQRI*HQHUDO(QJLQHHULQJ³$´ 68%0,77$/6 $ 6L[FRSLHVRIGHWDLOHGVKRSGUDZLQJVRUVNHWFKHVRIILHOGZRUNDQGUHTXLUHGFDOFXODWLRQV VKDOOEHVXEPLWWHGWRWKH(QJLQHHUIRUUHYLHZIRUDOOVWUXFWXUDOZRUN'UDZLQJVRUVNHWFKHV VKDOOFRQWDLQVXIILFLHQWGHWDLOVWRFOHDUO\GHILQHZRUNWREHDFFRPSOLVKHG)DEULFDWLRQRU LQVWDOODWLRQVKDOOQRWEHFRPPHQFHGSULRUWRUHYLHZDQGDSSURYDORIVKRSGUDZLQJVRU VNHWFKHV % $QHOHFWURQLFVXEPLWWDOZLOOEHDFFHSWHGLQRQO\WKHIROORZLQJIRUPDW 7KHILOHVKDOOEHLQSGIIRUPDW (DFKSURMHFWVXEPLWWDOVKDOOEHDVHSDUDWHILOH (DFKILOHVKDOOEHODEHOHGLQWKHIROORZLQJVHTXHQFH D 2ZQHU1DPH3URMHFW1DPH E 6XEPLWWDO1R F 'HVFULSWLRQ 48$/,7<$6685$1&( :HOGLQJSURFHGXUHVDQGZHOGLQJRSHUDWRUVVKDOOKDYHEHHQTXDOLILHGLQDFFRUGDQFHZLWK $::$'6WDQGDUG$OOEXWWMRLQWVVKDOOEHFRPSOHWHSHQHWUDWLRQDQGIXVLRQRIMRLQWV $OOFRPSOHWHGZHOGVVKDOOEHIUHHRIVODJDQGDOOILQLVKVWHHOVXUIDFHVIUHHIURPZHOG +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV VSDWWHUV([DPLQDWLRQRIWKHZHOGHGMRLQWVVKDOOEHPDGHDVWKHZRUNSURJUHVVHVLQ DFFRUGDQFH ZLWK $3, 6HFWLRQ 5HYLVHG KHUHLQ LQFOXGHG DV SDUW RI WKLV VSHFLILFDWLRQ 3$570$7(5,$/62)&216758&7,21 *(1(5$/ $ $OOPDWHULDOVVSHFLILHGDUHWKRVHZKLFKKDYHEHHQHYDOXDWHGIRUWKHVSHFLILFXVH$Q\ SURSRVHGVXEVWLWXWLRQVPXVWEHVXEPLWWHGWRWKH(QJLQHHUSULRUWRWKHELGRSHQLQJ % $OOVWHHOSODWHFRPSRQHQWVVKDOOEHIDEULFDWHGIURPQHZ$670$PDWHULDODQGDOOQHZ FDUERQVWHHOSLSHVKDOOEH$670$PDWHULDO&RQWUDFWRUVKDOOSURYLGHFHUWLILHGPLOOWHVW UHSRUWVIRUDOOVWHHOSODWHDQGSLSH & 0DWHULDOVRIFRQVWUXFWLRQQRWVSHFLILHGDVQRWHGKHUHLQVKDOOEHDVQRWHGLQDSSOLFDEOH VHFWLRQVRI6WDQGDUG6SHFLILFDWLRQVIRU3XEOLF:RUNV&RQVWUXFWLRQODWHVWHGLWLRQ 352'8&76 $ 9HQW6FUHHQLQJ6KDOOEHDOXPLQXPZLUHPHVKDQGPHVKIURP7:3RUDSSURYHG HTXDO %DQGLQJDQG6WUDSV6KDOOEHòDOXPLQXPEDQGLQJZLWKDOXPLQXPZLQJVHDOVIURP PHWURVXSSO\FROOFFRPRUDSSURYHGHTXDO 7HQVLRQLQJ 7RRO 3XVK EDU WHQVLRQ IRU VHFXULQJ EDQGLQJ VKDOO EH IURP PHWURVXSSO\FROOFFRPRUDSSURYHGHTXDO % /DGGHU6DIHW\6\VWHP )DOOSUHYHQWLRQGHYLFHVKDOOEHD6DI7&OLPEULJLGUDLOIDOOSUHYHQWLRQV\VWHPE\ 0LOOHU3URGXFWVRUDSSURYHGHTXDO 7KHVDIHW\VOHHYHVKDOOEHD6DI7&OLPEVKXWWOHDVVHPEO\PRGHOE\ 0LOOHUSURGXFWVRUDSSURYHGHTXDO 7KHVDIHW\KDUQHVVVKDOOEHD6DI7&OLPE+DUQHVVPRGHOE\ 0LOOHU3URGXFWVRUDSSURYHGHTXDO & )DOO5HVWUDLQW6\VWHP :LUH 5RSH 6KDOO EH ó 66 [ ZLUH URSH ZLWK FOHDU YLQ\O FRDWLQJ IURP 0F0DVWHU&DUU7/DQGPDQQ86&DUJR&RQWURORUDSSURYHGHTXDO &DUDELQHU&DUDELQHUVVKDOOEH0LOOHU''%,6DODRUDSSURYHGHTXDO &RPSUHVVLRQ 6OHHYHV 6KDOO EH WLQSODWHG FRSSHU DOOR\ IURP 0F0DVWHU&DUU 71LFURSUHVVRUDSSURYHGHTXDO 7KLPEOH6KDOOEH0F0DVWHU&DUU7RUDSSURYHGHTXDO +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV ' +DWFK(GJH7ULP(GJHWULPIRUSHULPHWHURIKDWFKFXUEVKDOOEH'XUR$1R. E\0F0DVWHU&DUURUDSSURYHGHTXDO ( 3DVVLYH&KHFN9DOYH3DVVLYHFKHFNYDOYHVKDOOEHDQHRSUHQHVOLSRQ6PDUW7LGHIOH[ 7)2Q\[9DOYH6HULHV'%6RUDSSURYHGHTXDO ) 6HOI&ORVLQJ*DWH6HOIFORVLQJJDWHVKDOOEHDQ$FDUERQVWHHO\HOORZSRZGHUFRDWHG 0RGHO 1R ;/3& PDGH E\ )DE(Q&R ,QF +RXVWRQ 7H[DV RU DSSURYHGHTXDO * 1XWVDQG%ROWV$OOKH[KHDGEROWVDQGQXWVXVHGRQWKHUHVHUYRLUVVKDOOEHJDOYDQL]HG FRQIRUPLQJWR$16,$60(K%DQG$16,$60(%$OOWKUHDGFRPSRXQGXVHG RQEROWHGFRQQHFWLRQVVKDOOEH16)DSSURYHG)ODQJHLQVXODWLRQNLWVVKDOOEHXVHGDW DOOVWDLQOHVVVWHHOEROWVLQFRQWDFWZLWKFDUERQVWHHO,QVXODWLQJIODQJHNLWVVKDOOLQFOXGH LQVXODWLQJVOHHYHVJDVNHWVDQGLQVXODWLQJZDVKHUVIRUHDFKIODQJHEROW6OHHYHVVKDOOEH IXOOOHQJWKDQGVKDOOFRYHUHQWLUHEROW,QVXODWLQJJDVNHWVVKDOOEHIXOOIDFHG + 0L[LQJDQG&KHPLFDO)HHG6\VWHP)XUQLVKDQGLQVWDOOWKH%LJ:DYH:DWHU7HFKQRORJLHV %LJ:DYH:DWHUFRP PL[LQJ DQG FKHPLFDO IHHG V\VWHP LQ DFFRUGDQFH ZLWK WKH GDWD VKHHWVLQFOXGHGLQ$SSHQGL[$DVIROORZV &%6&RQWURO3DQHOZLWK1(0;)53:[+['HQFORVXUH 7LGDO:DYH:DWHU0L[HU $OO6FKHGXOH39&DQG:LULQJ 3$57(;(&87,21 *(1(5$/ $ $OOZRUNVKDOOEHH[HFXWHGLQDFFRUGDQFHZLWKWKHUHTXLUHPHQWVRIWKH$PHULFDQ:DWHU :RUNV$VVRFLDWLRQ6WDQGDUG'ODWHVWUHYLVLRQWKH&LW\DQGWKHVHVSHFLILFDWLRQV :KHUHWKHIRUHJRLQJVWDQGDUGVUHFRPPHQGDWLRQVDQGVSHFLILFDWLRQVDUHFRQIOLFWLQJVDLG FRQIOLFWVVKDOOEHEURXJKWWRWKHDWWHQWLRQRIWKH(QJLQHHU % $OOZRUNVKDOOEHH[HFXWHGE\VNLOOHGFUDIWVPHQTXDOLILHGWRDFFRPSOLVKWKHUHTXLUHGZRUN LQDPDQQHUFRPSDUDEOHZLWKWKHEHVWVWDQGDUGVRISUDFWLFH5HVXPHVRISHUVRQQHOWREH XVHGRQWKHSURMHFWVKDOOEHVXEPLWWHGXSRQ1RWLFHRI$ZDUG&RQWLQXLW\RISHUVRQQHOVKDOO EHPDLQWDLQHGDQGWUDQVIHUVRINH\SHUVRQQHOVKDOOEHFRRUGLQDWHGZLWKWKH(QJLQHHU & 7KH&RQWUDFWRUVKDOOSURYLGHDVXSHUYLVRUWREHDWWKHZRUNVLWHGXULQJDOORSHUDWLRQV7KH VXSHUYLVRUVKDOOKDYHWKHDXWKRULW\WRVLJQDQ\FKDQJHRUGHUVFRRUGLQDWHZRUNDQGPDNH RWKHUGHFLVLRQVSHUWDLQLQJWRWKHH[HFXWLRQRIWKHLUFRQWUDFW ' 7KH&RQWUDFWRUVKDOOFRRSHUDWHZLWKWKH&LW\ZKRPD\EHFRQGXFWLQJRWKHURSHUDWLRQVRQ RUQHDUWKHUHVHUYRLU ( 3URYLGH VDIHJXDUGV LQFOXGLQJ ZDUQLQJ VLJQV EDUULFDGHV WHPSRUDU\ IHQFHV ZDUQLQJ OLJKWVDQGRWKHUVLPLODULWHPVWKDWDUHUHTXLUHGIRUSURWHFWLRQRIDOOSHUVRQQHOGXULQJ GHPROLWLRQDQGUHPRYDORSHUDWLRQV +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV ) $OO LQVWDOODWLRQ DQG UHSDLU ZRUN VKDOO EH DFFRPSOLVKHG LQ VXFKDZD\DVWRPLQLPL]H UHVHUYRLU GRZQWLPH $OO UHSDLU RSHUDWLRQV VKDOO EH FRPSOHWHG VR DV QRW WR LPSDLU FRPSOHWLRQVFKHGXOHIRUSURMHFWZKLFKLQFOXGHVVXEVHTXHQWUHFRDWLQJDQGUHSDLQWLQJRI UHVHUYRLUE\RWKHUV * 7KH&RQWUDFWRUVKDOOFRRUGLQDWHZLWKWKH&LW\DWOHDVWVHYHQGD\VEHIRUHVWDUWLQJZRUN DWWKHVLWH + $OOHTXLSPHQWSLSLQJDQGVXUIDFHVRIWKHUHVHUYRLUVKDOOEHSURWHFWHGIURPDOOGDPDJH DQGGXVWRURWKHUGHOHWHULRXVPDWHULDOLQILOWUDWLRQGXULQJWKHRSHUDWLRQVRIWKH&RQWUDFWRU $Q\LWHPVGDPDJHGE\WKHRSHUDWLRQVRIWKH&RQWUDFWRUVKDOOEHUHSODFHGLQNLQGRU DFFHSWDEO\UHSDLUHGWRWKHVDWLVIDFWLRQRIWKH(QJLQHHUE\WKH&RQWUDFWRUDWQRFRVWWRWKH &LW\ , $OOZRUNVKDOOEHPDGHDFFHVVLEOHWRWKH(QJLQHHUDWDOOWLPHV7KH&LW\PD\XVHRZQ IRUFHV HQJDJH IXOOWLPH LQGHSHQGHQW LQVSHFWLRQ VHUYLFHV RU SHUIRUP LQVSHFWLRQV LQWHUPLWWHQWO\7KH&RQWUDFWRULVWRVXSHUYLVHWKHMRESURSHUO\EHWZHHQLQVSHFWLRQV - :KHUHYHUDFXWWLQJWRUFKRURWKHUHTXLSPHQWWKDWPLJKWFDXVHDILUHLVXVHGSURYLGHDQG PDLQWDLQILUHH[WLQJXLVKHUVQHDUE\UHDG\IRULPPHGLDWHXVH,QVWUXFWDOOSRVVLEOHXVHUVLQ XVHRIILUHH[WLQJXLVKHU . 7KH(QJLQHHUVKDOOLQVSHFWWKHFOHDQLQJRISLWWHGDUHDVSULRUWRZHOGLQJDQGIROORZLQJ SRVWZHOGUHSDLUDSSOLFDWLRQV / $Q\EXUUVZHOGVSDWWHUVKDUSHGJHVFRUQHUVRUURXJKZHOGVZKLFKZRXOGFDXVHGLIILFXOW\ LQDFKLHYLQJDGHIHFWIUHHSDLQWV\VWHPVKDOOEHFKLSSHGRUJURXQGVPRRWKLQFRQIRUPDQFH WR1$&(6WDQGDUG53ODWHVWHGLWLRQ,WLVQRWWKHLQWHQWWRKDYHWKHZHOGVRU³VFDUV´ JURXQG³IOXVK´7KHREMHFWRIWKHJULQGLQJLVWRHOLPLQDWHVKDUSHGJHVFRUQHUVDQG RYHUODSVWRSURYLGHDVXUIDFHIRUWKHDSSOLFDWLRQRIDXQLIRUPWKLFNQHVVRIFRDWLQJRUSDLQW ZLWKRXWYRLGVRURWKHUGHIHFWV 0 6KRXOGYHQWVKROHVULJJLQJDWWDFKPHQWVRUDQ\RWKHUPRGLILFDWLRQFXWWLQJRUZHOGLQJEH UHTXLUHGWRPHHWVDIHW\VWDQGDUGVWKH\PD\EHDFFRPSOLVKHGDWWKHH[SHQVHRIWKH &RQWUDFWRUXSRQVXEPLWWLQJRIGHWDLOVLQZULWLQJWRDQGZLWKVXEVHTXHQWDSSURYDOE\WKH (QJLQHHU 1 :KHUHLWLVQHFHVVDU\WRDEUDVLYHO\EODVWFOHDQRUFKHPLFDOO\VWULSFRDWHGRUSDLQWHGDUHDV SULRUWRDQGDIWHUDQ\ZHOGLQJRSHUDWLRQVZRUNZLOOEHFRRUGLQDWHGZLWKWKH(QJLQHHU 2 $Q\ UHPHGLDO FOHDQLQJ FRDWLQJ DQG SDLQWLQJ DSSOLFDWLRQ VKDOO EH DFFRPSOLVKHG LQ DFFRUGDQFH ZLWK WKH UHTXLUHPHQWV OLVWHG LQ 6HFWLRQ EHORZ DQG 7HFKQLFDO 6HFWLRQ 3 7KH&RQWUDFWRU¶VHTXLSPHQWVKDOOEHGHVLJQHGIRULQVWDOODWLRQRIPDWHULDOVVSHFLILHGDQG VKDOOEHPDLQWDLQHGLQILUVWFODVVZRUNLQJFRQGLWLRQ&RQWUDFWRU¶VHTXLSPHQWVKDOOEH VXEMHFWWRDSSURYDORIWKH(QJLQHHU 4 7KH&RQWUDFWRUVKDOOSURYLGHDWKLVRZQH[SHQVHDOOQHFHVVDU\SRZHUDQGVFDIIROGLQJ UHTXLUHGIRUKLVRSHUDWLRQVXQGHUWKHFRQWUDFW +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV 7KHLQWHULRURIWKHUHVHUYRLUZLOOEHUHFRDWHGXSRQFRPSOHWLRQDQGDFFHSWDQFHRI WKHVWUXFWXUDOPRGLILFDWLRQV&RQWUDFWRUPD\SULYDWHO\DUUDQJHIRUWKHFRDWLQJDQG SDLQWLQJFRQWUDFWRUWRIXUQLVKVFDIIROGLQJIRUDFFRPSOLVKPHQWRIDOOVWUXFWXUDOZRUN SULRUWRXVHRIVFDIIROGLQJIRUKLVZRUN +($9<0(7$/&203/,$1&($1'7(67,1* &RQWUDFWRU VKDOO FRPSO\ ZLWK UHTXLUHPHQWV RI 'HSDUWPHQW RI +HDOWK 6HUYLFHV DQG &DO26+$7LWOHIRUZRUNHUSURWHFWLRQGXULQJUHPRYDORISDLQWDQGKDQGOLQJRIKD]DUGRXV ZDVWHVUHVXOWLQJIURPVXUIDFHFRQWDPLQDWLRQDQGDQ\UHPRYHGSDLQWSDUWLFOHV3ULRUWR UHPRYDOPRGLILFDWLRQRULQVWDOODWLRQRIDQ\PDWHULDOVRUILWWLQJV&RQWUDFWRUZLOOUHPRYH H[LVWLQJLQWHULRUFRDWLQJDQGH[WHULRUSDLQWZKHUHFXWWLQJEXUQLQJDQGZHOGLQJZLOOEH DFFRPSOLVKHG,IDQ\DGGLWLRQDOH[WHULRUSDLQWLVWREHUHPRYHGVXEPLWWDORIDZULWWHQSODQ RIDFWLRQIRUWKHSURMHFWVKDOOEHDFFRPSOLVKHGE\&RQWUDFWRUSULRUWRVWDUWRISURMHFW 02',),&$7,216$1'5(3$,56 $ :HOGLQJ:HOGLQJVKDOOEHDFFRPSOLVKHGDVVSHFLILHGKHUHLQDQGLQFRQIRUPDQFHWR UHIHUHQFHGVWDQGDUGVDQGLQGXVWU\SUDFWLFH % 'UDZLQJ DQG 6NHWFKHV $YDLODEOH RULJLQDO VLWH SLSLQJ DQG DFFHVVRU\ GUDZLQJV DQG PLVFHOODQHRXVW\SLFDOVNHWFKGUDZLQJVDUHLQFOXGHGDVVSHFLILFUHIHUHQFHV&RQWUDFWRULV WRVXEPLWVKRSGUDZLQJVRUVNHWFKHVLQGHWDLORIHDFKLWHPWREHDGGHGUHSODFHGRU PRGLILHGDVQRWHGLQ & 1HZ&HQWHU9HQW$//5HPRYHWKHH[LVWLQJFHQWHUYHQWDQGURRISODWHVDVGHWHUPLQHG QHFHVVDU\E\WKH(QJLQHHU)XUQLVKDQGLQVWDOODQHZGLDPHWHUFHQWHUYHQWFRYHU WKLFNUHLQIRUFLQJSODWHDQGQHZURRISODWHVDVQHHGHG9HQWVKDOOFRQIRUPWRGHWDLOV VKRZQRQWKHGUDZLQJ%ROWVDQGQXWVIRUWKHYHQWVKDOOEHHLWKHUFRDWHGFDUERQVWHHORU JDOYDQL]HG ,QVWDOO LQVXODWLRQ VOHHYHV DQG JDVNHWV ZKHUH GLVVLPLODU PHWDOV WRXFK 6FUHHQLQJIRUYHQWVKDOOFRQVLVWRIPHVKDOXPLQXPVFUHHQLQJRQLQVLGHZLWKPHVK DOXPLQXPEDFNXSRQRXWVLGHVHFXUHGZLWKDOXPLQXPEDQGLQJLQDFFRUGDQFHZLWK6HFWLRQ $ ' *XDUGUDLOLQJ$//5HPRYHDQGGLVSRVHRIWKHH[LVWLQJJXDUGUDLOGLDJRQDOVXSSRUWVDQG IDEULFDWHDQGLQVWDOODOOQHZJXDUGUDLOLQJUHWXUQVZLWKNLFNSODWHVDWWKHURRIKDWFKZRUN DUHDVDVVKRZQRQWKHSODQV3LSHVHFWLRQVVKDOOEHXVHGSURYLGHGWKH\PHHWFXUUHQW &DO26+$UHTXLUHPHQWV*XDUGUDLOLQJOD\RXWVKDOOEHILHOGYHULILHGSULRUWRIDEULFDWLRQ 5HVHUYRLUGRHVQRWKDYHGLDJRQDOVXSSRUWVWRUHPRYH7KHQHZUHWXUQVVKDOO EHLQVWDOOHGDWWKHHQGRIWKHJXDUGUDLOV )XUQLVKDQGLQVWDOOWZRIRRWJXDUGUDLOVHFWLRQVDWWKHWRSRIWKHODGGHURSHQLQJRQ 5HVHUYRLU ( :LGHQWKH7RSRIWKH/DGGHU0RGLI\WKHWRSRIWKHH[LVWLQJODGGHUVLGHUDLOVDQG JXDUGUDLOLQJWRZLGHQWKHRSHQLQJRQWRWKHURRIDQGEUDFHWKHODGGHUVDIHW\V\VWHPLQ DFFRUGDQFHZLWKWKHSODQV7KHRSHQLQJVKDOOEHPD[LPXPLQDFFRUGDQFHZLWKWKH SODQVWRPHHW&DO26+$UHTXLUHPHQWV,IGHWHUPLQHGQHFHVVDU\E\WKH(QJLQHHUWKH RSHQLQJFDQEHUHGXFHGWRDPLQLPXPRILQFKHVWRDFFRPPRGDWHILHOGFRQGLWLRQV +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV ) 6DIHW\ *DWH )XUQLVK DQG LQVWDOO D VHOIFORVLQJ KLQJHG JDWH LQ DFFRUGDQFH ZLWK 6HFWLRQ)DWWKHHQGRIWKHQHZIRRWVHFWLRQVRIJXDUGUDLO * 1HZ5RRI+DWFK&RYHU$//5HPRYHWKHH[LVWLQJURRIKDWFKFRYHUDQGUHSODFHZLWKD QHZó´DOXPLQXPKLQJHGFRYHULQDFFRUGDQFHZLWKWKHSODQV)XUQLVKDQGLQVWDOOHGJH WULPRQSHULPHWHURIKDWFKFXUELQDFFRUGDQFHZLWK6HFWLRQ' + 6HFRQGDU\5RRI+DWFK$//)XUQLVKDQGLQVWDOODQDSSURYHG[KDWFKZLWKKLQJHG DOXPLQXPFRYHUDWORFDWLRQQRWHGRQWKHSODQV+DWFKFXUEPXVWSHQHWUDWHWKHURRID PLQLPXPRIDQGDPD[LPXPRIRQWKHORZVLGHDQGEHVHDOZHOGHGRQWKHLQWHULRU DQGH[WHULRURIWKHURRI )XUQLVKDQGLQVWDOODLQFKGLDPHWHUFRXSOLQJLQWKHKDWFKFXUEIRUWKHPL[LQJ V\VWHPZLULQJ )XUQLVKDQGLQVWDOODQDQFKRUZHOGHGWRWKHLQWHULRURIWKHKDWFKFXUEIRUWKHPL[LQJ V\VWHPZLULQJ )XUQLVKDQGLQVWDOOHGJHWULPRQSHULPHWHURIKDWFKFXUELQDFFRUGDQFHZLWK6HFWLRQ ' , 6DI7&OLPE'HYLFH,QWHULRU$//)XUQLVKDQGLQVWDOODQDSSURYHGJDOYDQL]HG6DI7 &OLPEIDOOSUHYHQWLRQGHYLFHRQWKHH[LVWLQJLQWHULRUODGGHULQDFFRUGDQFHZLWK6HFWLRQ %DQGWKHSODQV$GLVPRXQWVHFWLRQVKDOOEHLQFOXGHGRQWKHLQWHULRUODGGHU+DUGZDUH VKDOOEHLQVWDOOHGLQDFFRUGDQFHZLWKPDQXIDFWXUHU¶VLQVWUXFWLRQVDVQRWHGLQ)LJXUH1R DQG)LJXUH1RLQFOXGLQJSDOQXWV - 6DI7&OLPE'HYLFH([WHULRU)XUQLVKDQGLQVWDOODQDSSURYHGJDOYDQL]HG6DI7 &OLPEIDOOSUHYHQWLRQGHYLFHRQWKHH[LVWLQJH[WHULRUODGGHULQDFFRUGDQFHZLWK6HFWLRQ %DQGWKHSODQV7KHGLVPRXQWVHFWLRQVKDOOEHEUDFHGLQDFFRUGDQFHZLWKWKHSODQV +DUGZDUHVKDOOEHLQVWDOOHGLQDFFRUGDQFHZLWKPDQXIDFWXUHU¶VLQVWUXFWLRQVDVQRWHGLQ )LJXUH1RDQG)LJXUH1RLQFOXGLQJSDOQXWV . )DOO5HVWUDLQW6\VWHP$//5HPRYHDQGGLVSRVHRIWKHH[LVWLQJIDOOUHVWUDLQWV\VWHPDQG IXUQLVKDQGLQVWDOOWZRQHZVWDLQOHVVVWHHOFDEOHDVVHPEOLHVDVVKRZQRQWKHSODQVDQGLQ DFFRUGDQFHZLWK6HFWLRQ&&DEOHVKDOOEHVWDLQOHVVVWHHODLUFUDIWFDEOH[ FRQVWUXFWLRQZLWKDSODVWLFVOHHYHWKHIXOOOHQJWKRIWKHFDEOH&DEOHFROODUDURXQGWKH FHQWHUYHQWDWWKHWRSRIWKHURRIVKDOOEHóGLDPHWHUFDEOHSODFHGLQDSODVWLFVOHHYHWR SUHYHQWSDLQWGDPDJH8VHDPLQLPXPRIWZRVZDJHGVWDLQOHVVVWHHORUFRSSHUDOOR\RYDO VOHHYHVWRFRQQHFWWKHODSSHGHQGVRIWKHFDEOH&DEOHVKDOODOVRVKRZDPD[LPXPRI JUHDWHUGLDPHWHUWKDQWKHFHQWHUQHFNDWWKHURRI&DEOHVKDOOUHVWIUHHO\XSRQWKHURRI DIWHULQVWDOODWLRQ 7KHWZRQHZVWDLQOHVVVWHHOIDOOSUHYHQWLRQSHUVRQQHOFDEOHVVKDOOEHóGLDPHWHU DQGVKDOOEHIDEULFDWHGZLWKDVZDJHGORRSDWWKHFHQWHUYHQWDWWDFKLQJSRLQWDQG DVZDJHGFDUDELQHU7KHFDUDELQHUVKDOOEHGRXEOHORFNLQJZLWKDPLQLPXPWHQVLOH VWUHQJWKRISRXQGVDQGDPLQLPXPJDWHIDFHRISRXQGV7KHOHQJWK RIHDFKSHUVRQQHOFDEOHVKDOOWHUPLQDWHIURPRXWHUHGJHRIWKHURRIZKHQ DWWDFKHGWRFHQWHUFDEOH +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV $OOFDEOHVVKDOOFRQWDLQVWDLQOHVVVWHHOWDJVZLWKSURSHULGHQWLILFDWLRQLQDFFRUGDQFH ZLWK$16,$66(= / 2YHUIORZ0RGLILFDWLRQ0RGLI\WKHH[LVWLQJRYHUIORZWRIXUQLVKDQGLQVWDOODSLSH EUDFNHWVDQGSLSHVXSSRUWWRH[WHQGWKHRYHUIORZWRDPLQLPXPDQGPD[LPXP IURPWKHVSODVKSDGLQDFFRUGDQFHZLWKWKHSODQV7KHLQWHULRUDQGH[WHULRURIWKHSLSH VKDOOEHFRDWHGDQGSDLQWHGLQDFFRUGDQFHZLWK6HFWLRQ7KHH[LVWLQJ7LGHIOH[ IODQJHGSDVVLYHFKHFNYDOYHVKDOOEHUHORFDWHGWRWKHHQGRIWKHQHZSLSH 0 1HZ2YHUIORZ3LSH 5HPRYHDQGGLVSRVHRIWKHH[LVWLQJRYHUIORZVKHOO QR]]OHSLSHEUDFNHWVDQGSLSHVXSSRUW)XUQLVKDQGLQVWDOODQHZVKHOOQR]]OHSLSHDQG EUDFNHWVLQDFFRUGDQFHZLWKWKHSODQV7KHLQWHULRUDQGH[WHULRURIWKHSLSHVKDOOEHFRDWHG DQGSDLQWHGLQDFFRUGDQFHZLWK6HFWLRQ$7LGHIOH[IODQJHGSDVVLYHFKHFNYDOYH DVQRWHGLQ6HFWLRQ(VKDOOEHLQVWDOOHGDIWHUSDLQWLQJ7KHYDOYHVKDOORSHQZLWKLQ RIZDWHUDQGZLWKVWDQG]HUREDFNSUHVVXUH 1 ([LVWLQJ/LTXLG/HYHO,QGLFDWRU$//5HPRYHDQGGLVSRVHRIWKHH[LVWLQJOLTXLGOHYHO LQGLFDWRUDVVHPEO\JDXJHERDUGDQGSLSLQJ+ROHVLQURRIVKDOOEHSODWHGRYHUZLWKDó WKLFNVWHHOSODWH3ODWHVKDOOH[WHQGWKUHHLQFKHVEH\RQGKROHVZLWKDILOOHWVHDOZHOG DURXQGSHULPHWHURISODWH 2 /DWHUDO%UDFLQJ )XUQLVKDQGLQVWDOOQHZò[ò[óDQJOHODWHUDOEUDFLQJ DWWKHPLGVSDQRIWKHIXOOOHQJWKUDIWHUVDQGVHDOZHOGWKHH[LVWLQJODWHUDOKHDGHUIRUWKH -DFNUDIWHUVWRWKHIXOOOHQJWKUDIWHUVLQDFFRUGDQFHZLWKWKHSODQV 3 &HQWHU6XSSRUW6WUXFWXUH5HPRYHDQGUHSODFHFHQWHUVXSSRUWVWUXFWXUHLQOLNHNLQG DVGHWHUPLQHGQHFHVVDU\E\WKH(QJLQHHU 4 ,QOHW3LSH'LIIXVHU$//5HPRYHWKHH[LVWLQJLQOHWGLIIXVHUER[DQGEUDFLQJDQGLQVWDOOD QHZIODQJHSLSHHOERZDQGLQOHWGLIIXVHUER[LQDFFRUGDQFHZLWKWKHSODQV7KHLQWHULRU RIWKHSLSHHOERZDQGGLIIXVHUER[VKDOOEHFRDWHGLQDFFRUGDQFHZLWK6HFWLRQSULRU WRLQVWDOODWLRQ 5 &RQFUHWH*UDGH%DQG$//5HPRYHDVSKDOWJUDYHODQGGLUWEHWZHHQWKHFRQFUHWHJUDGH EDQGDQGERWWRPSODWHH[WHQVLRQ5HPRYHDQGGLVSRVHRIWKHJUDYHODQGGLUWZLWKLQWKH JUDGHEDQGWRDGHSWKRIEHORZWKHERWWRPSODWHH[WHQVLRQDURXQGWKHHQWLUHSHULPHWHU RIWKHUHVHUYRLU3ODFHòPD[LPXPJUDYHOZLWKLQWKHJUDGHEDQGXSWRWKHERWWRPRIWKH ERWWRPSODWHH[WHQVLRQ$Q\YRLGVXQGHUWKHUHVHUYRLUVKDOOEHILOOHGDQGFRPSDFWHGZLWK VRLOSULRUWRSODFLQJWKHQHZJUDYHO 6 &RXSOLQJDQG%DOO9DOYH$//)XUQLVKDQGLQVWDOODLQFKGLDPHWHUIXOOIHPDOH WKUHDGHGFRXSOLQJZLWKQ\ORQEXVKLQJVDQGZLWKLQFKGLDPHWHUVWDLQOHVVVWHHOEDOOYDOYH DWORFDWLRQGHVLJQDWHGE\WKH&LW\ 7 ,QWHULRU/DGGHU5XQJ 5HPRYHDQGGLVSRVHRIWKHWRSUXQJRIWKHH[LVWLQJ LQWHULRUODGGHU7KHUXQJVKDOOEHFXWIOXVKZLWKWKHVLGHUDLOVDQGVKDOOEHJURXQGVPRRWK WRSUHVHQWDQLQWHJUDWHGLQWHUIDFHZLWKWKHVLGHUDLOV 8 3LW3HUIRUDWLRQ7UHDWPHQW$//([FHVVLYHO\SLWWHGFRUURGHGRUSHUIRUDWHGDUHDVVKDOO EHHLWKHUILOOHGZLWKZHOGPHWDODQGJURXQGVPRRWKRUFRYHUHGZLWKDPHWDOSODWHRIWKH VDPHSODWHWKLFNQHVVDVGHWHUPLQHGQHFHVVDU\E\WKH(QJLQHHU3ODWHVKDOOH[WHQGVL[ +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV LQFKHVEH\RQGSLWRUSHUIRUDWLRQZLWKDILOOHWZHOGDURXQGSHULPHWHURISODWH7KLV ZRUNZLOOEHDFFRPSOLVKHGRQDQKRXUO\UDWHWLPHDQGPDWHULDOEDVLV 9 *ULQGLQJ$//([FHVVLYHO\FRUURGHGDUHDVRQWKHUDIWHUIODQJHVNQXFNOHEUDFHVDQG VWUXFWXUDO PHPEHUV WKDW FRPSULVH RI VKDUS HGJHV IURP VDQGEODVWLQJ VKDOO EH JURXQG VPRRWK DQG URXQGHG DV GHWHUPLQHG QHFHVVDU\ E\ WKH (QJLQHHU 7KLV ZRUN ZLOO EH DFFRPSOLVKHGRQDQKRXUO\UDWHWLPHDQGPDWHULDOEDVLV : ,QVSHFWLRQ%ODVWLQJ$//([FHVVLYHO\FRUURGHGDUHDVRIWKHVWUXFWXUDOPHPEHUVVKDOOEH DEUDVLYH EODVW FOHDQHG WR UHPRYH VHYHUH FRUURVLRQ DV GHWHUPLQHG QHFHVVDU\ E\ WKH (QJLQHHU(QJLQHHUVKDOOLQVSHFWWKHEODVWFOHDQHGDUHDVXVLQJ&RQWUDFWRU¶VVFDIIROG IROORZLQJWKHEODVWLQJWRGHWHUPLQHZKHWKHURSWLRQDOELGLWHPVZLOOEHQHHGHG ; 5DIWHU5HSODFHPHQW5HPRYHIWVHFWLRQRIH[LVWLQJVHYHUHO\FRUURGHGUDIWHUVDWWKH FHQWHUVXSSRUWDVGHWHUPLQHGQHFHVVDU\E\WKH(QJLQHHUDQGUHSODFHZLWKQHZUDIWHU VHFWLRQVLQOLNHNLQG7KHWRSRIWKHUDIWHUVVKDOOEHVKRSFRDWHGLQDFFRUGDQFHZLWK6HFWLRQ SULRU WR LQVWDOODWLRQ :RUNVKDOO EH DFFRPSOLVKHGRQ WKH EDVLV RI HDFK 7KH &RQWUDFWRUPD\127FXWKROHVLQWKHURRIWRLQVWDOOWKHUDIWHUV ([LVWLQJUDIWHUVIRUWKHUHVHUYRLUDUHDSSUR[LPDWHO\:[7KH&RQWUDFWRUVKDOO ILHOGYHULI\WKHUDIWHUVL]HVDQGOHQJWKVSULRUWRIDEULFDWLQJ < 1XWV DQG %ROWV $// 5HSODFH VHYHUHO\ FRUURGHG QXWV DQG EROWV DW WKH VWUXFWXUDO FRQQHFWLRQVDVGHWHUPLQHGQHFHVVDU\E\WKH(QJLQHHULQDFFRUGDQFHZLWK6HFWLRQ *352'8&767KHEROWVVKDOOEH$670$JDOYDQL]HGEROWVDQGWKHVL]HVKDOOPDWFK WKHH[LVWLQJ 0,;,1*$1'&+(0,&$/)(('6<67(0 $ )XUQLVKDQGLQVWDOOWKHFRPSOHWH%LJ:DYH:DWHU7HFKQRORJLHVPL[LQJDQGFKHPLFDOIHHG V\VWHPLQDFFRUGDQFHZLWK6HFWLRQ+WKHSODQVDQGDVIROORZV )XUQLVK DQG LQVWDOO IRXU HDFK LQFK GLDPHWHU IXOO IHPDOH WKUHDGHG FRXSOLQJVZLWKQ\ORQEXVKLQJVDQGZLWKLQFKGLDPHWHUVWDLQOHVVVWHHOEDOOYDOYHV DWORFDWLRQVQRWHGRQWKHSODQV )XUQLVK DQG LQVWDOO 7\SH . FRSSHU SLSLQJ IURP WKH GHVLJQDWHG FRXSOLQJ XQGHUJURXQGWRWKHORFDWLRQQRWHGRQWKHSODQVDGMDFHQWWRWKHFRQWUROSDQHO 7HUPLQDWHWKHFRSSHUSLSLQJZLWKLQFKGLDPHWHUVWDLQOHVVVWHHOEDOOYDOYHE\ VHFXULQJWRWKHXQLVWUXWRQWKHVKHOOLQDFFRUGDQFHZLWKWKHSODQV &RQGXLW8QLVWUXW)XUQLVKDQGVHDOZHOGQHZIRRWORQJXQLVWUXWVWRWKHVKHOO DGMDFHQWWRWKHFRQWUROSDQHOWRVXSSRUWWKHQHZPL[LQJV\VWHPFRQGXLW7KH XQLVWUXWVVKDOOEHVSDFHGDPD[LPXPRIIHHWDSDUW )XUQLVKDQGLQVWDOOD[DOXPLQXPMXQFWLRQER[DGMDFHQWWRWKHQHZURRI KDWFK )XUQLVKDQGLQVWDOODULJLGPHWDOKRWGLSSHGJDOYDQL]HGFRQGXLWLQDFFRUGDQFHZLWK $16,&IURPWKHFRQWUROSDQHOWRMXQFWLRQER[DGMDFHQWWRWKHKDWFKDQGWRWKH URRIKDWFK +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV 6HDOZHOG[[ó[ ORQJEUDFHVWRWKHVKHOOIRUPRXQWLQJWKHFRQWUROSDQHO EHORZWKHVHFRQGDU\URRIKDWFK7KHERWWRPRIWKHFRQWUROSDQHOVKDOOEHIHHW PD[LPXPDERYHWKHJUDGH 7(67,1* $ 7KH &RQWUDFWRU VKDOO IXUQLVK DOO PDWHULDO ODERU DQG HTXLSPHQW QHFHVVDU\ WR WHVW WKH PRGLILFDWLRQVDVVSHFLILHGKHUHLQ7HVWLQJVKDOOEHFRPSOHWHGSULRUWRDFFHSWDQFHRIZRUN DVFRPSOHWHDQGPHHWLQJWKHUHTXLUHPHQWVRIWKHVSHFLILFDWLRQ % 6SRWH[DPLQDWLRQRIWKHZHOGHGMRLQWVVKDOOEHPDGHDVWKHZRUNSURJUHVVHVE\PDJQHWLF SDUWLFOHG\HSHQHWUDQWPHWKRGRUE\VSRWUDGLRJUDSKLFH[DPLQDWLRQDVDSSOLFDEOH & $OOGHIHFWVXQFRYHUHGE\WHVWLQJSURFHVVVKDOOEHFRUUHFWHGDQGUHWHVWHGXQWLOVXFKGHIHFWV DUHHOLPLQDWHG ' &RQWUDFWRUVKDOOSURYLGHDZDWHUWLJKWLQVWDOODWLRQ$IWHUIOXVKLQJRIWKHFKORULQDWHGZDWHU DQGXSRQILOOLQJRIWKHUHVHUYRLUDQ\OHDNVZKLFKRFFXURQWKHUHVHUYRLURUDSSXUWHQDQW SLSLQJVKDOOEHUHSDLUHGE\WKH&RQWUDFWRUDWKLVH[SHQVHDQGWRWKHVDWLVIDFWLRQRIWKH (QJLQHHU &/($183 8SRQFRPSOHWLRQRIWKHZRUNDOOVWDJLQJHUHFWLRQEUDFNHWVVFDIIROGLQJDQGGHEULVVKDOO EH UHPRYHG IURP WKH UHVHUYRLU DQG VLWH DQG GLVSRVHG LQ D PDQQHU DSSURYHG E\ WKH (QJLQHHU7KHHQWLUHMREVLWHVKDOOEHOHIWLQDFOHDQFRQGLWLRQ (1'2)6(&7,21 +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV 6(&7,21&$7+2',&3527(&7,21%<*$/9$1,&$12'(6 3$57*(1(5$/ '(6&5,37,21 $ 7KLVVHFWLRQDGGUHVVHVPDWHULDOVLQVWDOODWLRQDQGWHVWLQJUHTXLUHPHQWVIRUQHZLQWHULRU VDFULILFLDO DQRGH FDWKRGLF SURWHFWLRQ V\VWHPV RQ WKUHH H[LVWLQJ VWHHO ZDWHU VWRUDJH UHVHUYRLUV7KHUHVHUYRLUVDUHNQRZQDVWKHDQGUHVHUYRLUVUHVSHFWLYHO\DQG HDFKKDVDFDSDFLW\RI0JDOORQVDQGDUHLGHQWLFDOLQGLPHQVLRQV7KHLQWHULRURIWKH UHVHUYRLUVZLOOKDYHDQHZHSR[\FRDWLQJ % 7KHZRUNLQFOXGHVVXSSO\LQJDOOPDWHULDOVWRROVDQGODERUWRLQVWDOOWKHIROORZLQJVDFULILFLDO PDJQHVLXPURGDQRGHVDQGFDEOHVFXWWLQJRIQHZILYHLQFKGLDPHWHUDQRGHKDQGKROHV LQWKHURRISODWHVSURYLGLQJVL[LQFKGLDPHWHUVWHHODQRGHKDQGKROHFRYHUVDQRGHDQG FDEOH PRXQWLQJ DQG VXVSHQVLRQ KDUGZDUH DQG LQWHUQDOH[WHUQDO PRXQWHG SRWHQWLDO PRQLWRULQJWHVWHTXLSPHQW & $GGLWLRQDOO\WKHUHLVDQH[LVWLQJVDFULILFLDODQRGHFDWKRGLFSURWHFWLRQV\VWHPLQ5HVHUYRLU LQWHULRUZKLFKZLOOUHTXLUHUHPRYDOLQLWVHQWLUHW\LQFOXGLQJDOODQRGHVFDEOLQJPRXQWLQJ DQGFRQQHFWLRQKDUGZDUHDQGKDQGKROHFRYHUV ' 7KH&RQWUDFWRUSHUIRUPLQJDOOFDWKRGLFSURWHFWLRQLQVWDOODWLRQVVKDOOEHDOLFHQVHG(OHFWULFDO &RQWUDFWRULQWKH6WDWHRI&DOLIRUQLD&PLQLPXPFODVVLILFDWLRQDQGVKDOOKDYHDPLQLPXP RI ILYH \HDUV RI SUDFWLFDO H[SHULHQFH ZLWK VXFFHVVIXO KLVWRULHV RI VLPLODU FDWKRGLF SURWHFWLRQUHVHUYRLUZRUN8SRQUHTXHVWWKH&RQWUDFWRUVKDOOVXEVWDQWLDWHWKLVUHTXLUHPHQW E\IXUQLVKLQJDZULWWHQOLVWRIDSSURSULDWHUHIHUHQFHVZLWKFRQWDFWQDPHVSKRQHQXPEHUV DQG\HDUVRILQVWDOODWLRQDQGSURMHFWWLWOHV 5()(5(1&(63(&,),&$7,216&2'(6$1'67$1'$5'6 $ &RPPHUFLDO6WDQGDUGV7KHSXEOLFDWLRQVOLVWHGEHORZIRUPDSDUWRIWKLVVSHFLILFDWLRQWRWKH H[WHQWUHIHUHQFHG7KHSXEOLFDWLRQVDUHUHIHUUHGWRLQWKHWH[WE\WKHEDVLFGHVLJQDWLRQVRQO\ $670%6WDQGDUG6SHFLILFDWLRQIRU0DJQHVLXP$OOR\([WUXGHG%DUV5RGV 7XEHVDQG:LUH $670 ' 6WDQGDUG 6SHFLILFDWLRQ IRU 3RO\HWK\OHQH 3ODVWLF ([WUXVLRQ 0DWHULDOVIRU:LUHDQG&DEOH 1$&(63*DOYDQLF$QRGH&DWKRGLF3URWHFWLRQRI,QWHUQDO6XEPHUJHG 6XUIDFHVRI6WHHO:DWHU5HVHUYRLUV 16)$16,'ULQNLQJ:DWHU6\VWHP&RPSRQHQWV±+HDOWK(IIHFWV 68%0,77$/6 $ 6XEPLWRQO\WKHIROORZLQJIRUUHYLHZDQGDSSURYDOE\WKH2ZQHU¶V&RUURVLRQ(QJLQHHU $QRGHV +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV :LUHDQG&DEOH $QRGH+DQGKROH&RYHUV 3RWHQWLDO0HWHUDQG(QFORVXUH 3HUPDQHQW5HIHUHQFH(OHFWURGH % 6XEPLWVKRSGUDZLQJVLQDFFRUGDQFHZLWK2ZQHU¶VUHTXLUHPHQWV6KRSGUDZLQJVWRLQFOXGH VSHFLILFDQRGHFRUHWROHDGZLUHFRQQHFWLRQV & $QHOHFWURQLFVXEPLWWDOZLOOEHDFFHSWHGRQO\LQWKHIROORZLQJIRUPDW 7KHILOHVKDOOEHLQSGIIRUPDW (DFKSURMHFWVXEPLWWDOVKDOOEHDVHSDUDWHILOH (DFKILOHVKDOOEHODEHOHGLQWKHIROORZLQJVHTXHQFH D 2ZQHU¶V1DPH3URMHFW1DPH E 6XEPLWWDO1R F 'HVFULSWLRQ 0$18)$&785(56 $OOPDWHULDOVIXUQLVKHGXQGHUWKLVVSHFLILFDWLRQVKDOOEHVWDQGDUGSURGXFWVRIPDQXIDFWXUHUV UHJXODUO\HQJDJHGLQWKHPDQXIDFWXUHRIVXFKSURGXFWVDQGHTXLSPHQWDQGVKDOOEHWKH PDQXIDFWXUHU¶VODWHVWGHVLJQWKDWFRPSOLHVZLWKWKHVSHFLILFDWLRQUHTXLUHPHQWV$OOPDWHULDOV VKDOOEHPDQXIDFWXUHGLQWKH86$ZKHUHIHDVLEOH 3$570$7(5,$/6 $12'(+$1'+2/(&29(56 $QRGHKROHFRYHUVVKDOOEHFLUFXODUPLQWKLFNJDOYDQL]HGFDGPLXPSODWHGRU]LQF SODWHGPLOGVWHHORUEDUHVWDLQOHVVVWHHOVL[LQFKHVLQGLDPHWHUZLWKDGLDPHWHU FHQWHUHGVWDLQOHVVVWHHOWKURXJKEROW$JDOYDQL]HGRUFDGPLXPSODWHGVWHHOEDURUWKLFN )53ILEHUJODVVUHLQIRUFHGSODVWLFQRW39&EDUVKDOOEHXWLOL]HGWRKROGWKHFRYHULQSODFH DQGVKDOOEHGLPHQVLRQHGDVVKRZQLQWKH3ODQV7KHEDUVKDOOEHIDFWRU\GULOOHGDQGWDSSHG WRDFFHSWWKHFRYHUEROW7KHHQGRIWKHEROWVKDOOEHSHHQHGRUVDZFXWZLWKDVORWWR SUHYHQWWKHEDUIURPFRPLQJRIIWKHEROW$GLDIXOOIDFHWKLFNPLQQHRSUHQH UXEEHUJDVNHWZLWKDGLDPHWHUFHQWHUKROHVKDOOEHSURYLGHGXQGHUWKHFRYHUWRVHDO WKHFRYHUWRWKHDQRGHKDQGKROHLQWKHURRISODWH$QDGGLWLRQDO(3'0RUQHRSUHQHUXEEHU JURPPHW VKDOO EH SURYLGHG EHWZHHQ WKH URRI SODWH DQG WKH QHRSUHQH FRYHU JDVNHW WR IDFLOLWDWHIXWXUHUHPRYDORIWKHFRYHU $12'(6 $ $670%0DJQHVLXP5RG*DOYRURG$OOR\'RZ&KHPLFDO&HUWLILHG6WDQGDUG3RWHQWLDO 9'&±PD[RSHQFLUFXLWYROWDJHWR&6(RUDSSURYHGHTXDO+LJKSRWHQWLDOSULPDU\ JUDGHDQRGHVVKDOOQRWEHXWLOL]HGIRUWKLVSURMHFW$QRGHVVKDOOEH16)$16,6WDQGDUG FHUWLILHGZLWKDFFRPSDQ\LQJFHUWLILFDWLRQSDSHUZRUN &KHPLFDOFRPSRVLWLRQRIWKHDQRGHVKDOOEHDVIROORZV D $OXPLQXP PD[LPXP E 0DQJDQHVH PLQLPXP +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV F =LQF G 6LOLFRQ PD[LPXP H &RSSHU PD[LPXP I 1LFNHO PD[LPXP J ,URQ PD[LPXP K 2WKHUHDFK PD[LPXP L 2WKHUWRWDO PD[LPXP M 0DJQHVLXP 5HPDLQGHU %DUH$QRGH:HLJKWSRXQGVPLQIRUIRRWORQJURGGLD $QRGH'LDPHWHU LQFKHV2' 5RGDQRGHVVKDOOEHFRQWLQXRXVO\FDVWRUH[WUXGHGZLWKDFHQWUDOO\ORFDWHG GLDPHWHULURQZLUHFRUHDQGVKDOOEHVXSSOLHGZLWKWKHDQRGHOHDGZLUHFRQGXFWRU ERWKIDFWRU\VLOYHUVROGHUHGDQGK\GUDXOLFDOO\FULPSHGRUVSOLWEROWHGWRWKHFRUH7KH HQWLUHVROGHUHGFULPSHGFRQQHFWLRQVKDOOEHFRPSOHWHO\HQFDSVXODWHGLQDZDWHU SURRIKHDWVKULQNDEOHVOHHYHIROORZHGE\DQHSR[\SRWWLQJFRPSRXQGFRQWDLQHG ZLWKLQDQDGGLWLRQDO39&VOHHYHRUDQRYHUDOOKHDWVKULQNDEOHVOHHYH $QRGHVPXVWEH16)FHUWLILHGZLWKDFFRPSDQ\LQJ16)SDSHUZRUNDQGDSSURYHG PDQXIDFWXUHV DUH *DOYRWHF $OOR\V ,QF 7LPPLQFR /LPLWHG 0D[0DJ 0DJ 6SHFLDOWLHVRURWKHUDSSURYHGHTXDO $12'(/($':,5(6 $QRGHOHDGZLUHVVKDOOEH$:*VWUDQGHGFRSSHUFRQGXFWRUV$670'7\SH &ODVV$7\SH&3+0:3(LQVXODWHGEODFNLQVXODWLRQWKLFNQHVVQRWOHVVWKDQ LQOHQJWKDQGH[WHQGWRWKHURRISODWHFRQQHFWLRQZLWKRXWVSOLFLQJ 327(17,$/0(7(5$1'(1&/2685( $Q DQDORJ '& YROWPHWHU VKDOO EH SURYLGHG LQ DQ H[WHUQDO HQFORVXUH WR DOORZ IRU PHDVXUHPHQWRILQWHULRUVWUXFWXUHWRZDWHUSRWHQWLDOV7KHPHWHUVKDOOUHDGIURP YROWV'&9'&DQGKDYHDPLQLPXPLQWHUQDOUHVLVWDQFHRI.RKPVSHUYROW9 VHQVLWLYLW\ 0HWHU VKDOO EH DW OHDVW VTXDUH DQG WKH IDFH RI WKH PHWHU VKDOO EH SHUPDQHQWO\PDUNHGZLWKD³JUHHQDUF´IURP9WR9DQGD³\HOORZDUF´IURP 9WR97KHPHWHUFLUFXLWVKDOOEHSURYLGHGZLWKDQH[WHUQDO³SXVKWRUHDG´ PRPHQWDU\VZLWFKZKLFKLVQRUPDOO\³RII´RU³RSHQ´127KHYROWPHWHUDQGVZLWFKVKDOO EHPRXQWHGRQD39&RUDFU\OLFERDUGDVVKRZQ 7KHHQFORVXUHIRUWKHPHWHUVKDOOEHDSRO\FDUERQDWHRUILEHUJODVVQRWVWHHO1(0$5 UDLQWLJKWER[ZLWKDKLQJHGFRYHU7KHER[VKDOOEHVLPLODUWRD6WDKOLQW\SHRUVW\OHZLWK DJDVNHWEXLOWLQWRWKHFRYHUIRUVHDOLQJ%R[VL]HVKDOOEH[[DQGWKHFRYHUVKDOO KDYHDKDVSIRUSDGORFNLQJWKHFRYHUWRWKHER[7KHPHWHUDQGHQFORVXUHVKDOOEHWKH 0RGHO *0&+3/ DV PDQXIDFWXUHG E\ *0& (OHFWULFDO RI &RURQD&DOLIRUQLD RU DSSURYHGHTXDO 3(50$1(175()(5(1&((/(&752'( 7KHFRSSHUFRSSHUVXOSKDWHSHUPDQHQWUHIHUHQFHHOHFWURGHVKDOOEHWKH³6WDSHUP´0RGHO +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV &X):DQGVKDOOEHDGLDPHWHU[ORQJ$%6\HOORZSODVWLFKRXVLQJZLWKDQ LQWHUQDOO\FRLOHGVSLUDOZRXQGGLDPHWHUSXUHFRSSHUURGVXVSHQGHGLQD VDWXUDWHG ODERUDWRU\JUDGH FRSSHU VXOSKDWH &X62 FRQGXFWLYH SDVWH 7KH HOHFWURGH VKDOOFRQWDLQDFKORULGHLRQ&OWUDSDQGXWLOL]HDFHUDPLFHOHFWURO\WHFRQWDFWSOXJRQWKH ERWWRPHQG7KHGHVLJQOLIHVKDOOEHDPLQLPXPRI\HDUVZLWKDVWDELOLW\RIPLOOLYROW P9XQGHUDPLFURDPS$ORDG7KHHOHFWURGHFDEOHVL]HVKDOOEHVWUDQGHG$:* FRSSHUZLWK5++5+:\HOORZLQVXODWLRQDQGEHRIVXIILFLHQWOHQJWKWRUHDFKIURPWKH HOHFWURGHWRWKHH[WHUQDOSRWHQWLDOPHWHUHQFORVXUHZLWKRXWVSOLFLQJ'RQRWDOORZDQ\RWKHU FDEOLQJ RU OHDG ZLUHV WR EH ZLWKLQ WKH UHIHUHQFH FRQGXLW 7KH HOHFWURGH VKDOO EH DV PDQXIDFWXUHGE\*0&(OHFWULFDORI&RURQD&DOLIRUQLDRUDSSURYHGHTXDO 3$57(;(&87,21 ,167$//$7,21 7KHIROORZLQJLQVWDOODWLRQSURFHGXUHVVKDOOEHDFFRPSOLVKHGZLWKWKHUHVHUYRLUZHWLQ VHUYLFHRUGU\2ZQHU¶VRSWLRQ7KHDQRGHVZLOOEHVXVSHQGHGIURPWKHLQWHULRUURRISODWHV DVVKRZQLQWKH3ODQVDQGVKDOOPHHWDOOUHTXLUHPHQWVRI1$&(6WDQGDUG63 $12'(+$1'+2/(6 7KH&RQWUDFWRUVKDOOFXWQHZH[DFWO\FLUFXODUGLDPHWHUKROHVLQWKHURRISODWHVDWWKH ORFDWLRQVVKRZQ+ROHVPD\EHHLWKHUIODPHFXWRUE\WKHXVHRIDPDJQHWPRXQWPRWRU GULYHQKROHVDZ'RQRWDOORZDQ\RIWKHKROHFXWWLQJPDWHULDOVWRIDOOLQWRWKHUHVHUYRLU &RDWWKHH[SRVHGHGJHVRIHDFKFXWKROHZLWKHLWKHUPDWFKLQJURRISDLQWRUHSR[\DIWHU JULQGLQJWKHHGJHVVPRRWK3DLQWWKHH[WHULRUWRSVRIDOOQHZKDQGKROHFRYHUVDVGLUHFWHG E\WKH2ZQHURUDVVKRZQLQWKH3DLQWLQJ6SHFLILFDWLRQV6WDLQOHVVVWHHOFRYHUVLIXWLOL]HG GRQRWUHTXLUHSDLQWLQJ $12'(,167$//$7,21 $ ,QVWDOOHDFKDQRGHDQGOHDGZLUHDWWKHLQGLFDWHGORFDWLRQVE\WKHXVHRIWKHLQGLYLGXDODQRGH FOHYLVDVVHPEO\ 127('21273(5)250,7(06³&´$1'³'´%(/2:817,/$)7(57+(WK 0217+&2$7,1*:$55$17<,163(&7,21+$6%((13(5)250('%<27+(56 % 6XVSHQGHDFKDQRGHIURPLWVFOHYLVDVVHPEO\DVVKRZQ9HULI\WKDWWKHLQVWDOOHGDQRGHLV WKHFRUUHFWGHVLJQGLVWDQFH RIIWKHUHVHUYRLUIORRU&RYHUWKHOHDGZLUHVROGHUOHVV OXJVZLWKWKUHHODSVRIUXEEHUWDSHIROORZHGE\WKUHHODSVRIYLQ\OHOHFWULFDOWDSHRURWKHU VXLWDEOHZDWHUSURRIFRYHULQJWRSUHYHQWFRUURVLRQRIWKHFRQQHFWRUXQWLOLW¶VILQDOO\LQVWDOOHG FRQQHFWHGWRWKHURRISODWH & &RQQHFWWKHLQGLYLGXDOOHDGZLUHFRSSHUFRQGXFWRUVWRWKHURRISODWHE\WKHXVHRIWKH VROGHUOHVVOXJFRQQHFWRUDQG66WKURXJKEROWDVVKRZQDIWHUILUVWHLWKHUJULQGLQJWKHLQWHULRU URRISODWHWREDUHPHWDORUGULOOLQJDQGWDSSLQJWKHURRISODWHWRDFFHSWWKH66EROW$QRGH VXSSOLHUWRSURYLGHDVXIILFLHQWOHQJWKRIDQRGHOHDGFDEOHWRFRQQHFWWRWKHOXJZLWKRXW VSOLFLQJWKHFDEOH ' $IWHUHDFKFRQQHFWLRQLVPDGHFRDWWKHH[SRVHGOXJFRQQHFWRUDQGDQ\H[SRVHGFDEOH FRSSHUFRQGXFWRUDQGLQWHULRUEDUHVWHHOURRISODWHZLWKHSR[\RURWKHUDSSURYHGLQVXODWLQJ +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV FRDWLQJWRDWKLFNQHVVRIDWOHDVW6OLGHHDFKLQGLYLGXDOKDQGKROHFRYHUFHQWHUHGDQG LQSODFHRQWKHH[WHULRUURRISODWHDQGWLJKWHQWKHò66EROWXQWLOLWLVMXVWVQXJ'RQRWRYHU WLJKWHQ 0(7(5(1&/2685( 0RXQWWKHPHWHUHQFORVXUHER[RQWKHH[WHULRUVKHOODWWKHKHLJKWVKRZQDQGEHORZWKH UHVSHFWLYHURRIKDWFKHVE\WKHXVHRIWKHPRXQWLQJWDEVSURYLGHGRQWKHER[DQGSLQEUD]HG VWXGVRU³8QLVWUXW´RUDQJOHLURQW\SHPRXQWLQJKDUGZDUHZHOGHGWRWKHVKHOO$WWDFKWKHER[ WRWKHVWXGVRUPRXQWLQJDQJOHVZLWKVWDLQOHVVVWHHOKH[DJRQDOEROWVQXWVDQGZDVKHUV 5RXWHôULJLGJDOYDQL]HGFRQGXLWIURPWKHER[WRWKHH[WHULRUURRISODWHDQGDGMDFHQWWRWKH URRIKDWFK7HUPLQDWHWKHFRQGXLWDWWKHURRISODWHHQWU\ZLWKDô7\SH/%JDOYDQL]HGRU ]LQFSODWHGVWHHOFRQGXOHWILWWLQJ$WWDFKDQ$:*7+:1EODFNLQVXODWHGFRSSHUFDEOH IURPWKHYROWPHWHUQHJDWLYHWHUPLQDOWRWKHVZLWFKDQGWKHQWRWKHJURXQGLQJOXJRU SURYLGHGJURXQGLQJZLUHLQWKHER[DVVKRZQ9HULI\E\FRQWLQXLW\WHVWLQJWKDWWKHPHWHU ER[LVHOHFWULFDOO\FRQWLQXRXVZLWKWKHUHVHUYRLUVKHOO 3(50$1(175()(5(1&((/(&752'( 6XVSHQGWKHSHUPDQHQWUHIHUHQFHHOHFWURGHIURPLWVRZQOHDGZLUHXWLOL]LQJDFHUDPLFSLQ LQVXODWRUDWWKHORFDWLRQVKRZQRQWKHSODQV2QNQXFNOHVW\OHURRIVDWWDFKWKHOHDGZLUH WRWKHLQWHULRUODGGHUZLWKDJDOYDQL]HGRUVWDLQOHVVVWHHOEHDPFODPSwell aboveWKHKLJK ZDWHUOLQH5RXWHWKHHOHFWURGHOHDGZLUHXSWKHLQWHULRUUHVHUYRLUVKHOODGMDFHQWWRRUEHKLQG WKHLQWHULRUODGGHUDQGWKURXJKWKHôFRQGXOHWILWWLQJDQGLQVLGHWKHH[WHULRUôVWHHOFRQGXLW WRWKHPHWHUHQFORVXUH'RQRWVSOLFHRUQLFNWKHHOHFWURGHFDEOH'RQRWDOORZDQ\RWKHU FRQGXFWRUVZLWKLQWKHôFRQGXLW&RQQHFWWKHUHIHUHQFHOHDGFRSSHUFRQGXFWRUWRWKH YROWPHWHUSRVLWLYHWHUPLQDOZLWKDULQJWRQJXHVROGHUOHVVFRQQHFWRU)LOOERWKVLGHVRIWKH URRIPRXQWHG/%FRQGXOHWLQWHULRULQOHWDQGRXWOHWVDQGWKHFRQGXLWHQWU\LQWRWKHPHWHU HQFORVXUHZLWKDFDQQHGW\SHH[SDQGDEOH³IRDPVHDODQW´WRSUHYHQWFRQGHQVDWLRQDQG KXPLGLW\IURPHQWHULQJWKHôVWHHOFRQGXLWDQGPHWHUHQFORVXUH/RFDWHWKHôFRQGXLW HQWU\WRWKHPRQLWRULQJER[RQWKHERWWRPRIWKHER[DVVKRZQRQWKH3ODQV'RQRWUHPRYH WKHSURWHFWLYHERWWRPFDSRQWKHHOHFWURGHXQWLOUHDG\IRUXVHXQOHVVWKHUHVHUYRLUKDV FRQWLQXRXVVXIILFLHQWZDWHUGHSWKWRSHUPDQHQWO\FRPSOHWHO\FRYHUWKHHOHFWURGH 3$577(67,1*$1':$55$17< &$7+2',&3527(&7,216<67(07(67,1* 7KH&3LQVWDOODWLRQ&RQWUDFWRUVKDOODFFRPSOLVKLQLWLDOL]DWLRQVWUXFWXUHWRZDWHUWHVWLQJRIWKH JDOYDQLFDQRGHFDWKRGLFSURWHFWLRQV\VWHP7HVWLQJVKDOOEHDFFRPSOLVKHGDIWHUWKHLQWHUQDO FRDWLQJ ZDUUDQW\ LQVSHFWLRQ KDV EHHQ SHUIRUPHG E\ RWKHUV DQGWKH UHVHUYRLU UHILOOHG 7HVWLQJZLOOEHFRQGXFWHGSHUWKHUHTXLUHPHQWVRI1$&(6WDQGDUG637HVWLQJVKDOO FRQVLVWRIPHDVXULQJZLWKDKLJKLPSHGDQFHGLJLWDO'&YROWPHWHUDQGDFDOLEUDWHGSRUWDEOH &X62UHIHUHQFHHOHFWURGHSRUWDEOHUHIHUHQFHHOHFWURGHWRSHUPDQHQWUHIHUHQFHHOHFWURGH SRWHQWLDO GLIIHUHQFH DOO LQGLYLGXDO DQRGH RSHQFLUFXLW XQFRQQHFWHG SRWHQWLDOV LQLWLDOO\ FRQQHFWHGVWUXFWXUHWRZDWHUSRWHQWLDOVZLWKDOODQRGHVFRQQHFWHGDQGILQDOVWUXFWXUHWR ZDWHUSRWHQWLDOVDIWHUDWOHDVWDPLQLPXPRIRQHKRXUKDVHODSVHG6WUXFWXUHSRWHQWLDOVVKDOO EHPHDVXUHGIURPWKHURRIKDWFKDQGGRZQWKHLQWHULRUVKHOODQGEHKLQGWKHLQWHULRUODGGHU DW PD[LQWHUYDOVIURPWKHKLJKZDWHUOLQHWRWKHERWWRP&RQWUDFWRUVKDOORQO\EHKHOG UHVSRQVLEOHIRUVXSSO\LQJWKHVSHFLILHGDQRGHPDWHULDOSHUPDQHQW&X62UHIHUHQFHDQGRU PRQLWRULQJHTXLSPHQWunlessGHILFLHQFLHVDUHQRWHGLQDQ\PDWHULDOV3UHVHQWDOHWWHUW\SH +DUSHU $VVRFLDWHV(QJLQHHULQJ,QF 6HFWLRQ $XJXVW±5HV UHSRUWZLWKDOO5HVXOWVRIWKHWHVWLQJWRWKH2ZQHU :$55$17< $OOPDWHULDOVHVSHFLDOO\WKHDQRGHVVKDOOEHZDUUDQWHGIRUDSHULRGRIDWOHDVWWZHOYH PRQWKV DIWHU WKH FDWKRGLF SURWHFWLRQ V\VWHP KDV EHHQ HQHUJL]HGFRQQHFWHG $Q\ GHILFLHQFLHVLQWKHPDWHULDOVHVSHFLDOO\LQWKHLQLWLDOPHDVXUHGDQRGHRSHQFLUFXLWYROWDJH WR&6(RUODFNRI16)FHUWLILFDWLRQVKDOOEHFDXVHWRUHMHFWWKHHQWLUHORWRIPDWHULDOV7KH &RQWUDFWRUVKDOOUHSODFHDOOGHILFLHQWPDWHULDOVLQFOXGLQJODERUWRUHLQVWDOODQGDQ\UHWHVWLQJ UHTXLUHGDWQRFRVWWRWKH2ZQHU &/($183 $OOGHEULVWRROVVWRUDJHPDWHULDOVZHOGLQJFXWWLQJDQGSDLQWLQJPDWHULDOVVKDOOEHUHPRYHG IURPWKHUHVHUYRLUURRIDQGIURPWKHSUHPLVHVDWWKHFRPSOHWLRQRIWKHZRUNKHUHLQVSHFLILHG $Q\FRVWLQFXUUHGE\WKH2ZQHUWRFOHDQXSGHEULVRURWKHUPDWHULDOVUHVXOWLQJIURPWKLVZRUN VKDOOEHEDFNFKDUJHGWRWKH&RQWUDFWRU (1'2)6(&7,21 WĂŐĞϲŽĨϴ $WWDFKPHQW 6SHFLILFDWLRQVIRUWKH5HVHUYRLU0L[HUV SUBMERSIBLE MIXER Rehabilitation of Reservoir 2-1, 2-2, and 2-3 1 Reservoir MIXER Rehabilitation of Reservoirs 2-1, 2-2, and 2-3 PART 1 – GENERAL 1.1 SCOPE A. This section covers the submersible reservoir/tank mixing systems up to 1.5 HP in size intended for continuous use while submersed in potable water storage tanks. Mixer will operate 24 hours a day, 7 days per week. Each mixer shall consist of a water-lubricated submersible motor, an impeller, and a non-submersible control center that houses all controller electronics. 1.2 THE REQUIREMENT A. CONTRACTOR shall furnish a Big Wave Water Technologies Tidal Wave Mixer with a control center and install mixer together with control center and accessories necessary for operable system. B. UTILITY shall furnish electrical conduit with either 115VAC or 230VAC single phase voltage based on system configuration, a safety disconnect switch and a 20amp non-GFCI circuit breaker up to the point of installation of the mixing system control center. C. UTILITY shall also provide conduit from control center to tank penetration for submersible motor cable and penetration through tank for same cable. 1.3 REFERENCE SPECIFICATIONS, CODES, AND STANDARDS A. Classified UL Water Quality NSF/ANSI 61, NSF/ANSI 372 B. Underwriters Laboratories Inc., UL 508A C. NEMA Type 3R, 4, and 12 D. CSA Type 3R, 4, and 12 1.4 CONTRACTOR SUBMITTALS A. NSF Certification 1. Copy of the NSF-61 certified listing for reservoir mixer material being placed inside the tank. B. Installation, O & M’s shall be obtained from the equipment manufacturer 1. General equipment specifications and data sheets 2. Installation, start-up, operation, and maintenance instructions 3. Factory-recommended maintenance schedule 4. Wiring diagram 1.5 QUALITY ASSURANCE A. Each reservoir mixer shall be tested prior to shipment. B. Complete mixing system is NSF/ANSI Standard 61 certified. 1.6 WARRANTY A. For the period beginning with shipment to buyer and ending at the time frame listed below, the reservoir mixer is warranted to be free from shortcomings in material and workmanship and to coincide to manufacturers specifications. 1. Three (3) years on all supplied parts 2. One full year labor 3. Lifetime warranty on impeller 1.7 SATISFACTION GUARANTEE A. For the Period of 12 months after equipment is installed and started up, if the owner is not satisfied with the performance and results, then the owner will receive a refund for the total cost of the mixer from the manufacturer. 1. To receive a refund, the mixer must be returned to Big Wave Water Technologies without noticeable damage and normal wear and tear. SUBMERSIBLE MIXER Rehabilitation of Reservoir 2-1, 2-2, and 2-3 2 PART 2 – PRODUCTS 2.1 PERFORMANCE A. Reservoir mixer shall completely mix reservoir according to the following minimum performance requirements. These requirements can be measured and validated after installation by operators with readily available tools such as temperature probes and total chlorine grab samplers. 1. Temperature Uniformity For tanks up to 4,000,000 gallons in volume: All temperatures shall converge to within 0.50°C (0.9°F) within 24 hours after mixer is installed and activated. 2. Disinfectant Residual Uniformity For tanks up to 4,000,000 gallons in volume: Disinfectant residual within top five feet of tank and bottom five feet of tank will converge to within 0.20 ppm within 24 hours after mixer is installed and activated. During continuous operation of the mixer, under normal disinfectant dosing parameters, disinfectant residual will converge to within 0.20 ppm at least once every 24 hours. 2.2 GENERAL A. Reservoir mixer consists of an impeller mounted on a submersible motor and supported thirty (30) inches from the tank floor in order for it to launch a jet of water from the bottom of the tank up toward the surface of the water. Mixer control and operation shall be independent of tank drain and fill cycles to ensure constant mixing. Wet-side of mixer shall weigh less than 40 pounds and dry-side shall weigh less than 20 pounds for safety of installation. Both wet-side and dry-side shall be able to be hoisted, installed, and/or removed by on-site personnel without additional equipment needed so that there is no crush hazard or entanglement hazard present, and so that weight of mixer on tank floor does not cause damage to interior coating. B. Reservoir mixer active components shall be elevated at a minimum of 30 inches above tank floor to avoid disturbing accumulated tank sediment or entraining particles and causing accelerated wear of moving parts. Tripod configurations shall not be acceptable. C. Mixers using submersible pump with slit or “water sheet” or horizontal motor mounting designs are not acceptable. D. The use of an unstable tripod as a base shall not be used to assure no damage to tank coatings. E. Mixer shall produce 35 lbs. of downward thrust while mixing. F. Oil-filled motors shall not be acceptable. G. All wet-side mixer components shall be certified by NSF to the NSF/ANSI Standard 61. . H. Power for mixer shall be 120VAC single phase grid power. I. No maintenance shall be required on the wet-side components in typical potable water application. J. Passive mixing system shall not be acceptable. K. Pumped water or jet mixers shall not be acceptable. L. Mixer shall utilize VFD control center to maximize mixing efficiency. Constant speed mixers shall be modified to accommodate this feature. 2.3 CONSTRUCTION A. Components – wet-side: Shall be NSF/ANSI Standard 61 certified. Equipment entering tank shall not adhere to, scratch, or otherwise cause any damage to internal tank coating or put undue stress on the materials of the tank construction. Equipment shall fit through a standard hatch of size 24-inch x 24-inch or larger. UTILITY may prefer to penetrate side wall or ceiling of tank (in place of penetrating the hatch) to allow motor cable entry into the tank for ease of installation and protection against freezing/ice damage. Each submersible mixer shall consist of the following components, regardless of the power source selected: SUBMERSIBLE MIXER Rehabilitation of Reservoir 2-1, 2-2, and 2-3 3 1. Impeller Balanced to within 0.5 gram-inches Not more than 1.5 inches in overall height Not more than 5.2 inches in diameter Not more than .5 lbs. in weight Shall not create cavitation at any rotational speed up to 3450 RPM 2. Motor AISI Type 304 stainless steel body Chlorine/Chloramine resistant rubber seals Fully submersible Low power (1.5 HP maximum) Water-lubricated motor 3. Mounting Mixer Frame shall be constructed High density Polyethylene Attachments secure motor cable away from impeller Overall weight of wet-side unit not to exceed 40 lbs. for ease of installation and operator safety when installing Overall height of unit shall not exceed 42 inches. including lifting arm B. Components – dry-side: Each 120VAC control center shall consist of the following components: 1. Enclosure Type (NEMA 3R) lockable Weather resistant Overall weight of control center not to exceed 40 lbs. Green and Red LED Indicator lights show motor status Cooling fan Power Switch located inside of panel 2. Motor Controller/VFD Rated to 1.5 HP Operating temperature range -4 ºF to 131 ºF (-20 ºC to 55 ºC) Start/stop switch mounted internally Manual speed control Built in thermal shut-off protection Built in current overload protection SCADA outputs included: Digital output signal indicating motor running 4-20mA signal 3. Branch Circuit Protection Panel equipped with a 120VAC 20-Amp main breaker 2.4 CONTROLS A. Each unit shall be equipped with all necessary controls, inter-wired, to provide the following minimum functions: 1. On/Off switch to control power to mixer. 2. Alarm dry contact for to indicate mixer running. 3. 4:20 mA signal to indicate mixer current draw 3.5 ACCEPTABLE MANUFACTURERS: A. Big Wave Water Technologies Model TWM15050, or pre-approved equal. SUBMERSIBLE MIXER Rehabilitation of Reservoir 2-1, 2-2, and 2-3 4 PART 3 – EXECUTION 3.1 INSTALLATION A. The CONTRACTOR shall furnish services of a factory-trained installation contractor or crew having experience with installation procedures, operations, and maintenance requirements for the type of equipment installed under these specifications. Mixer must be able to be installed through a 24”x24” hatch. Mixer must be able to be installed without draining tank or taking tank out of service. Wet-side of mixer shall weigh less than 40 pounds and dry-side shall weigh less than 42 pounds. Both wet-side and dry-side shall able to be hoisted, installed, and/or removed by on-site personnel without additional equipment needed so that there is no crush hazard or entanglement hazard present, and so that weight of mixer on tank floor does not cause damage to interior coating. B. Tank penetration is recommended to be above tank water line, typically through the hatch side wall. 1. Fitting will prevent moisture intrusion into tank and ideally be horizontally oriented. 2. Fitting shall be 1” diameter fitting to allow cable to pass through. 3. A water-tight penetration may be installed under the water line. C. Installation of the in-tank components may be performed in any of the following ways: 1. Installation by a factory-trained and drinking-water-certified potable water tank diver. 2. Installation by personnel with confined space training while the tank is drained and empty. 3. Installation below a hatch opening in a full tank D. Installation of the outside-of-tank components may be performed by: 1. Third party representatives or CONTRACTORS according to the manual provided. 2. UTILITY personnel according to the manual provided 3. Safety disconnect provided by others E. The mixer and control center shall be installed in accordance with approved procedures submitted and as shown, unless otherwise approved in writing. 3.2 TRAINING A. Big Wave Water Technologies personnel (or representative) will direct designated personnel in the correct operation of the reservoir mixer. This instruction will cite the operations manual provided with equipment and show how to check for correct operation of the equipment. WĂŐĞϳŽĨϴ $WWDFKPHQW 3KRWRJUDSKLF6XUYH\RI5HVHUYRLUDQG 3+272*5$3+,&6859(< 352-(&7 &RUURVLRQ(QJLQHHULQJ(YDOXDWLRQRI6L[:DWHU6WRUDJH5HVHUYRLUV 6758&785( ([WHULRURIWKH0*5LYHWHG6WHHO:DWHU6WRUDJH5HVHUYRLU 5HVHUYRLU 2:1(5 &LW\RI9HUQRQ /2&$7,21 9HUQRQ&DOLIRUQLD 3+272*5$3+('%< 'DYLG$VKWRQ(QJLQHHULQJ7HFKQLFLDQ '$7( )HEUXDU\ (9LHZRIWKHH[WHULRURI5HVHUYRLULOOXVWUDWLQJPRGHUDWHR[LGDWLRQDQGIDGLQJDQG RWKHUZLVHJRRGFRQGLWLRQRIWKHSDLQWV\VWHP +$53(5 $662&,$7(6(1*,1((5,1*,1& &2168/7,1*(1*,1((56 1240 E. Ontario Ave., Ste. 102-312, Corona, CA 92881-8671 Phone (951) 372-9196 Fax (951) 372-9198 www.harpereng.com (9LHZRIWKHURRI LOOXVWUDWLQJPRGHUDWH R[LGDWLRQDQGIDGLQJ DQGRWKHUZLVHJRRG FRQGLWLRQRIWKHSDLQW V\VWHP (9LHZRIWKHFHQWHUYHQW FRYHULOOXVWUDWLQJJRRG FRQGLWLRQRIWKHSDLQW V\VWHP (9LHZRIWKHFHQWHUYHQW LOOXVWUDWLQJUDQGRP VSRWVRIFRUURVLRQ ZKHUHWKHYHQWVWUXFWXUH PHHWVWKHURRI (&ORVHXSYLHZRIWKH URRIQHDUWKHFHQWHU YHQWLOOXVWUDWLQJUXVW VFDOHDQGEOLVWHUHG SDLQW (6DPHDV3KRWR( H[FHSWDIWHUWKHUXVW VFDOHDQGEOLVWHUZHUH UHPRYHGH[SRVLQJ VHYHUHFRUURVLRQDQGD KROHLQWKHURRISODWH (9LHZRIWKHURRIQHDU WKHFHQWHUYHQW LOOXVWUDWLQJDODUJH EOLVWHU (6DPHDV3KRWR( H[FHSWDIWHUWKHEOLVWHU ZDVUHPRYHGH[SRVLQJ VHYHUHFRUURVLRQDQGD KROHLQWKHURRISODWH (9LHZRIDSRUWLRQRIWKH URRILOOXVWUDWLQJ JHQHUDOO\JRRG FRQGLWLRQRIWKHSDLQW V\VWHP (6DPHDV3KRWR( H[FHSWDGLIIHUHQW SRUWLRQRIWKHURRI (&ORVHXSYLHZRIWKH URRILOOXVWUDWLQJJRRG FRQGLWLRQRIWRXFKXS SDLQWRQDURRIODS ZHOG (&ORVHXSYLHZRID ZHOGLQWHUVHFWLRQ LOOXVWUDWLQJJRRG FRQGLWLRQRIWKHSDLQW V\VWHP1RWHWRXFKXS SDLQWRQWKHULJKWVLGH RIWKHSKRWR (9LHZRIDQDGKHVLRQ WHVWRQWKHURRI LOOXVWUDWLQJJRRG DGKHVLRQRIWKHSDLQW V\VWHP (9LHZRIDFDWKRGLF SURWHFWLRQKDQGKROH FRYHULOOXVWUDWLQJ PRGHUDWHFRUURVLRQ DURXQGWKHFRYHUDQG FHQWHUEROW (9LHZRIWKHSHULPHWHU RIWKHURRILOOXVWUDWLQJ VWDLQLQJDQGRWKHUZLVH JRRGFRQGLWLRQRIWKH SDLQWV\VWHP (9LHZRIWKHURRI KDWFKZRUNDUHD LOOXVWUDWLQJJHQHUDOO\ JRRGFRQGLWLRQRIWKH SDLQWV\VWHP (9LHZRIWKHOLTXLGOHYHO LQGLFDWRU//,SLSLQJ DQGJXDUGUDLOLQJ LOOXVWUDWLQJIDLU FRQGLWLRQRIWKHSDLQW V\VWHP1RWHUXQVDQG VDJVLQWKHSDLQWRQWKH SLSLQJ (9LHZRIWKHURRIKDWFK LOOXVWUDWLQJPLQRU FRUURVLRQDQGVWDLQLQJ DORQJWKHWRSHGJHRI WKHKDWFKFXUE (9LHZRIWKH JXDUGUDLOLQJRSHQLQJDW WKHODGGHULOOXVWUDWLQJ JHQHUDOO\JRRG FRQGLWLRQRIWKHSDLQW V\VWHP (9LHZRIWKHXSSHU SRUWLRQRIWKHODGGHU VKHOODQG//,JDXJH ERDUGLOOXVWUDWLQJ UDQGRPFRUURVLRQRQ WKHODGGHUDQGDGMDFHQW ULYHWUXQVDQGPRGHUDWH GHWHULRUDWLRQRIWKH JDXJHERDUGVWLFNHU (9LHZRIWKHERWWRPRI WKHODGGHUDQGYDQGDO JXDUGLOOXVWUDWLQJ UDQGRPFRUURVLRQRQ WKHODGGHUDQGEROW KROHVRQWKHYDQGDO JXDUG (9LHZRIWKHXQGHUVLGH RIWKHWRSDQJOH LOOXVWUDWLQJJHQHUDOO\ JRRGFRQGLWLRQRIWKH SDLQWV\VWHP (9LHZRIDSRUWLRQRIWKH VKHOOLOOXVWUDWLQJJRRG FRQGLWLRQRIWKHSDLQW V\VWHP (9LHZRIWKHVKHOO LOOXVWUDWLQJUDQGRP VSRWVRIFRUURVLRQRQ WKHULYHWVDQG PHFKDQLFDOGDPDJH ZLWKFRUURVLRQRQWKH VKHOO (&ORVHXSYLHZRIWKH VKHOOLOOXVWUDWLQJDQ DUHDRIFUDFNHGDQG GHODPLQDWLQJSDLQW 1RWHPLQRUFRUURVLRQ FRPLQJWKURXJKLQ VRPHDUHDV (&ORVHXSYLHZRIWKH VKHOOLOOXVWUDWLQJVSRWV RIPHFKDQLFDOGDPDJH ZLWKFRUURVLRQ (9LHZRIDQDGKHVLRQ WHVWRQWKHVKHOO LOOXVWUDWLQJIDLU DGKHVLRQRIWKHSDLQW V\VWHP (9LHZRIDPDQKROH LOOXVWUDWLQJPHFKDQLFDO GDPDJHZLWKFRUURVLRQ DWWKHQXWVDQGEROWVDQG UDQGRPULYHWVRQWKH UHLQIRUFLQJSODWH (9LHZRIWKHRWKHU PDQKROHLOOXVWUDWLQJ JRRGFRQGLWLRQRIWKH SDLQWV\VWHP (9LHZRIDQLQOHWRXWOHW LOOXVWUDWLQJUDQGRP FRUURVLRQRQWKHQXWV DQGEROWVDQGH[SRVHG SULPHFRDWRQWKH FRPSUHVVLRQIODQJH (6DPHDV3KRWR( H[FHSWDFORVHXSYLHZ RIWKHGHODPLQDWLRQDQG H[SRVHGSULPHFRDW (9LHZRIWKHRYHUIORZ LOOXVWUDWLQJJHQHUDOO\ JRRGFRQGLWLRQRIWKH SDLQWV\VWHP1RWHDUHD RIOLJKWJHQHUDO FRUURVLRQRQWKHVKHOO EHORZWKHVWDQGRII EUDFNHWV (9LHZRIWKHLQOHWSLSH LOOXVWUDWLQJPLQRUWR PRGHUDWHFRUURVLRQDW WKHIODQJHGFRQQHFWLRQ (6DPHDV3KRWR( H[FHSWIXUWKHUGRZQWKH LQOHWSLSH (6DPHDV3KRWRV( DQG(H[FHSWDWWKH ERWWRPRIWKHLQOHW 1RWHPHFKDQLFDO GDPDJHZLWKFRUURVLRQ DWWKHERWWRPRIWKH SLSH (9LHZRIDVDPSOHWDS LOOXVWUDWLQJIDLU FRQGLWLRQRIWKHVDPSOH WDSDQGDGMDFHQWSDLQW V\VWHP (9LHZRIDEOLQGIODQJHG YDOYHLOOXVWUDWLQJ UDQGRPPLQRUFRUURVLRQ RQWKHQXWVDQGEROWV DQGLUUHJXODUVXUIDFHV (9LHZRIDSDUWLDOO\ EXULHGYDOYH LOOXVWUDWLQJJHQHUDO FRUURVLRQRQWKHYDOYH 1RWHPHFKDQLFDO GDPDJHZLWKFRUURVLRQ RQWKHDGMDFHQWVKHOO (6DPHDV3KRWR( H[FHSWDWDGLIIHUHQW SDUWLDOO\EXULHGYDOYH (9LHZRIWKHORZHUVKHOO LOOXVWUDWLQJPHFKDQLFDO GDPDJHDQG GHODPLQDWLRQDWVRPHRI WKHULYHWV 3+272*5$3+,&6859(< 352-(&7 &RUURVLRQ(QJLQHHULQJ(YDOXDWLRQRI6L[:DWHU6WRUDJH5HVHUYRLUV 6758&785( ,QWHULRURIWKH0*5LYHWHG6WHHO:DWHU6WRUDJH5HVHUYRLU 5HVHUYRLU 2:1(5 &LW\RI9HUQRQ /2&$7,21 9HUQRQ&DOLIRUQLD 3+272*5$3+('%< 'DYLG$VKWRQ(QJLQHHULQJ7HFKQLFLDQ '$7( )HEUXDU\ ,9LHZRIWKHLQWHULRUURRIDQGVWUXFWXUDOPHPEHUVLOOXVWUDWLQJPLQRUFRUURVLRQDQGVWDLQLQJ DORQJWKHURRIODSMRLQWVDQGXSSHUUDIWHUIODQJHV +$53(5 $662&,$7(6(1*,1((5,1*,1& &2168/7,1*(1*,1((56 1240 E. Ontario Ave., Ste. 102-312, Corona, CA 92881-8671 Phone (951) 372-9196 Fax (951) 372-9198 www.harpereng.com ,9LHZRIWKHFHQWHU VXSSRUWVWUXFWXUH LOOXVWUDWLQJPRGHUDWH FRUURVLRQDWWKHUDIWHU HQGVDQGDORQJWKHXSSHU UDIWHUIODQJHV ,&ORVHXSYLHZRIWKH UDIWHUHQGVLOOXVWUDWLQJ VHYHUHFRUURVLRQDWWKH ORZHUUDIWHUIODQJHV ,6DPHDV3KRWR, H[FHSWIURPDGLIIHUHQW DQJOH1RWHPRGHUDWHWR VHYHUHFRUURVLRQDWWKH XSSHUUDIWHUIODQJHVDQG DGMDFHQWURRIVXUIDFHV ,6DPHDV3KRWRV,DQG ,H[FHSWDFORVHUYLHZ RIDUDIWHUHQG1RWH VHYHUHFRUURVLRQDERYH WKHUDIWHU ,6DPHDV3KRWRV, WKURXJK,H[FHSWIURP DGLIIHUHQWDQJOH ,9LHZRIWKHFHQWHU VXSSRUWVWUXFWXUHORZHU SODWHLOOXVWUDWLQJVHYHUH FRUURVLRQRIWKHQXWVDQG EROWVVHFXULQJWKHGRXEOH SODWHFRQQHFWLRQ ,6DPHDV3KRWR, H[FHSWIURPDGLIIHUHQW DQJOH1RWHJUHHQPRVV RQWKHWRSVLGHRIWKH SODWH ,9LHZRIDSRUWLRQRIWKH URRILOOXVWUDWLQJUDQGRP PLQRUFRUURVLRQDWWKH URRIODSMRLQWVDQGXSSHU UDIWHUIODQJHVDQG RWKHUZLVHJHQHUDOO\JRRG FRQGLWLRQRIWKHFRDWLQJ V\VWHP ,6DPHDV3KRWR, H[FHSWDGLIIHUHQWSRUWLRQ RIWKHURRI ,9LHZRIDMDFNUDIWHUDQG ODWHUDOEUDFHLOOXVWUDWLQJ PLQRUFRUURVLRQDWWKH MDFNUDIWHUWRVXSSRUW FRQQHFWLRQDQGDORQJWKH HGJHRIWKHODWHUDOEUDFH ,9LHZRIDMDFNUDIWHU VXSSRUWWRUDIWHU FRQQHFWLRQLOOXVWUDWLQJ FRUURVLRQDQGVWDLQLQJ DORQJWKHWRSVLGHRIWKH FRQQHFWLRQDQGDGMDFHQW UDIWHUIODQJH ,9LHZRIDODWHUDOEUDFH EHORZDMDFNUDIWHU LOOXVWUDWLQJJHQHUDOO\ JRRGFRQGLWLRQRIWKH FRDWLQJV\VWHP ,9LHZRIODWHUDOVHLVPLF EUDFLQJDWDUDIWHU LOOXVWUDWLQJPLQRU FRUURVLRQRQWKHWRSVLGH RIWKHJXVVHWSODWHDQG DORQJWKHDGMDFHQWODS MRLQWDQGUDIWHUIODQJH ,6DPHDV3KRWR, H[FHSWLQDGLIIHUHQW ORFDWLRQ ,6DPHDV3KRWRV,DQG ,H[FHSWLQD GLIIHUHQWORFDWLRQ1RWH PRGHUDWHFRUURVLRQDW WKHHQGRIWKHDQJOH ,9LHZRIWKHWRSVLGHRID ODWHUDOEUDFHLOOXVWUDWLQJ PRGHUDWHFRUURVLRQ ,9LHZRIWKHURRI LOOXVWUDWLQJPLQRU FRUURVLRQDORQJDURRI ODSMRLQWDQGDGMDFHQW UDIWHUIODQJHV ,6DPHDV3KRWR, H[FHSWLQDGLIIHUHQW ORFDWLRQ ,6DPHDV3KRWRV,DQG ,H[FHSWLQD GLIIHUHQWORFDWLRQ1RWH PLQRUWRPRGHUDWH FRUURVLRQLVSUHVHQW DORQJWKHODSMRLQWV ,9LHZRIFDWKRGLF SURWHFWLRQ&3KDQGKROH DQGKDQJHUDVVHPEO\ LOOXVWUDWLQJPLQRU FRUURVLRQDWWKH FLUFXPIHUHQFHRIWKH KDQGKROH1RWH&3 ZLULQJLVQRWFRQQHFWHG ,9LHZRIDUDIWHUWRVKHOO FRQQHFWLRQLOOXVWUDWLQJ PRGHUDWHFRUURVLRQRI WKHQXWVDQGEROWV VHFXULQJWKHUDIWHUWRWKH JXVVHWSODWH ,6DPHDV3KRWR, H[FHSWIURPWKHRSSRVLWH VLGHRIDFRQQHFWLRQ 1RWHPRGHUDWHWRVHYHUH FRUURVLRQRQWKHWRSVLGH RIWKHUDIWHU ,6DPHDV3KRWRV,DQG ,H[FHSWDFORVHXS YLHZRIDVHYHUHO\ FRUURGHGQXWDQGEROW ,9LHZRIDMDFNUDIWHUWR VKHOOFRQQHFWLRQ LOOXVWUDWLQJPRGHUDWH FRUURVLRQDORQJWKHHGJH RIWKHJXVVHWSODWH ,6DPHDV3KRWR, H[FHSWIURPWKHRSSRVLWH VLGHRIDFRQQHFWLRQ ,9LHZRIWKHURRIWRVKHOO WUDQVLWLRQLOOXVWUDWLQJ PLQRUWRPRGHUDWH FRUURVLRQDWWKH WUDQVLWLRQ1RWH JHQHUDOO\JRRGFRQGLWLRQ RIWKHFDXONLQJLQWKH YRLGEHWZHHQWKHURRI DQGVKHOO ,9LHZRIDSRUWLRQRIWKH VKHOOLOOXVWUDWLQJ JHQHUDOO\JRRGFRQGLWLRQ RIWKHFRDWLQJV\VWHP DERYHWKHKLJKZDWHU OHYHODQGGDUNEURZQ VWDLQLQJEHORZ ,6DPHDV3KRWR, H[FHSWDGLIIHUHQWSRUWLRQ RIWKHVKHOO ,&ORVHXSYLHZRIWKH VKHOOLOOXVWUDWLQJJRRG FRQGLWLRQRIWKHFRDWLQJ V\VWHPDQGGDUNEURZQ VWDLQLQJDQGUHVLGXH EHORZWKHKLJKZDWHU OHYHO ,9LHZRIWKHLQOHWZHLU ER[LOOXVWUDWLQJUDQGRP PLQRUFRUURVLRQRQWKH ZHLUVXSSRUWEUDFNHWDQG RWKHUZLVHJHQHUDOO\JRRG FRQGLWLRQRIWKHFRDWLQJ V\VWHP ,6DPHDV3KRWR, H[FHSWDFORVHUYLHZRI WKHVLGHRIWKHZHLU ,6DPHDV3KRWRV,DQG ,H[FHSWDWWKHXSSHU VXSSRUWEUDFNHW ,9LHZRIWKHLQOHW SHQHWUDWLRQDWWKHVKHOO LOOXVWUDWLQJPLQRU FRUURVLRQRQWKHLQWHULRU RIWKHSLSHDQGDGMDFHQW VKHOO ,9LHZRIWKHRYHUIORZ DQGYRUWH[EUHDNHUSODWH LOOXVWUDWLQJJRRG FRQGLWLRQRIWKHFRDWLQJ V\VWHPDERYHWKHKLJK ZDWHUOHYHODQGGDUN EURZQVWDLQLQJEHORZWKH KLJKZDWHUOHYHO ,9LHZRIWKHOLTXLGOHYHO LQGLFDWRU//, SHQHWUDWLRQVLOOXVWUDWLQJ PLQRUFRUURVLRQDWWKH SHQHWUDWLRQVDQGVWDLQLQJ RQWKHDGMDFHQWUDIWHU DQGVKHOO ,9LHZRIWKH//,IORDW LOOXVWUDWLQJJHQHUDOO\ JRRGFRQGLWLRQRIWKH IORDWDQGGDUNEURZQ VWDLQLQJRQWKHDGMDFHQW VKHOO ,9LHZRIWKHURRIKDWFK LOOXVWUDWLQJPLQRU FRUURVLRQDORQJWKH XSSHUHGJHRIWKHFXUE DQGVWDLQLQJRQWKH DGMDFHQWURRIODSMRLQWV DQGXSSHUUDIWHUIODQJH ,9LHZRIWKHXSSHU SRUWLRQRIWKHODGGHU LOOXVWUDWLQJUDQGRPVSRWV RIPLQRUFRUURVLRQRQ WKHODGGHU ,9LHZRIWKHODGGHUMXVW EHORZWKHZDWHUOLQH LOOXVWUDWLQJJHQHUDOO\ JRRGFRQGLWLRQRIWKH FRDWLQJV\VWHPDVFRXOG EHREVHUYHGZKHUHWKH GDUNUHVLGXHZDVZLSHG RIIWKHUXQJV ,6DPHDV3KRWR, H[FHSWIXUWKHUGRZQWKH ODGGHU1RWHFRDWLQJ V\VWHPDSSHDUVWREHLQ JHQHUDOO\JRRG FRQGLWLRQ ,6DPHDV3KRWRV,DQG ,H[FHSWIXUWKHU GRZQWKHODGGHU ,9LHZRIWKHVKHOODWDQ LQWHUVHFWLRQRIULYHWUXQV LOOXVWUDWLQJKHDY\UHVLGXH FOLQJLQJWRWKHVKHOODQG ULYHWV ,6DPHDV3KRWR, H[FHSWLQDGLIIHUHQW ORFDWLRQ ,6DPHDV3KRWRV,DQG ,H[FHSWLQD GLIIHUHQWORFDWLRQ1RWH VWUHDNVRIFRDWLQJFDQEH VHHQWKURXJKWKHKHDY\ UHVLGXHLQWKLVORFDWLRQ ,6DPHDV3KRWRV, WKURXJK,H[FHSWLQD GLIIHUHQWORFDWLRQ ,&ORVHXSYLHZRIWKH VKHOOLOOXVWUDWLQJ JHQHUDOO\JRRGFRQGLWLRQ RIWKHFRDWLQJV\VWHPLQ WKLVORFDWLRQ1RWH FRDWLQJSDWFKZRUNDERYH DQGEHORZWKHULYHWUXQ ,9LHZRIWKHHGJHRID PDQKROHLOOXVWUDWLQJ KHDY\VHGLPHQWDGKHUHG WRDOOVXUIDFHV1RWH JRRGFRQGLWLRQRIWKH FRDWLQJV\VWHPWKDWFDQ EHVHHQDORQJWKHHGJHRI WKHPDQKROH ,6DPHDV3KRWR, H[FHSWDWWKHRWKHU PDQKROH ,6DPHDV3KRWR, H[FHSWDWWKHRWKHUVLGH RIWKHPDQKROH1RWH UDQGRPFRDWLQJ SDWFKZRUNDURXQGWKH PDQKROH ,9LHZRIDQLQOHWRXWOHW LOOXVWUDWLQJPRGHUDWH FRUURVLRQRQWKHH[WHULRU RIWKHSLSH ,9LHZRIDVPDOOGLDPHWHU SHQHWUDWLRQLOOXVWUDWLQJ VRPHWKLQJFORJJLQJWKH SHQHWUDWLRQDQG JHQHUDOO\JRRGFRQGLWLRQ RIWKHFRDWLQJV\VWHPRQ WKHDGMDFHQWVXUIDFHV ,9LHZRIDGHIOHFWRUSODWH IRUDQLQOHWRXWOHW LOOXVWUDWLQJJHQHUDOO\ JRRGFRQGLWLRQRIWKH FRDWLQJV\VWHPDVFRXOG EHREVHUYHGWKURXJKWKH KHDY\UHVLGXHDGKHUHGWR WKHVKHOODQGGHIOHFWRU SODWH ,9LHZRIWKHERWWRPDW WKHLQWHULRURIWKH LQOHWRXWOHWGHIOHFWRU SODWHLOOXVWUDWLQJ JHQHUDOO\JRRGFRQGLWLRQ RIWKHFRDWLQJV\VWHPDV FRXOGEHREVHUYHG WKURXJKWKHVHGLPHQWDQG GHEULVRQWKHERWWRP 1RWHERWWRPRQO\YLVLEOH LQVLGHWKHLQOHWRXWOHW GHIOHFWRUSODWHDUHD ,9LHZRIWKHFROXPQ LOOXVWUDWLQJJHQHUDOO\ JRRGFRQGLWLRQRIWKH FRDWLQJV\VWHPDVFRXOG EHREVHUYHGWKURXJKWKH KHDY\UHVLGXHDGKHUHGWR WKHFROXPQ 3+272*5$3+,&6859(< 352-(&7 &RUURVLRQ(QJLQHHULQJ(YDOXDWLRQRI6L[:DWHU6WRUDJH5HVHUYRLUV 6758&785( ([WHULRURID0*:HOGHG6WHHO:DWHU6WRUDJH5HVHUYRLU 5HVHUYRLU 2:1(5 &LW\RI9HUQRQ /2&$7,21 9HUQRQ&DOLIRUQLD 3+272*5$3+('%< %UDQGRQ%D[WHU(QJLQHHULQJ7HFKQLFLDQ '$7( )HEUXDU\ (9LHZRI5HVHUYRLULOOXVWUDWLQJPRGHUDWHR[LGDWLRQDQGIDGLQJDQGRWKHUZLVHJHQHUDOO\ IDLUFRQGLWLRQRIWKHSDLQWV\VWHP +$53(5 $662&,$7(6(1*,1((5,1*,1& &2168/7,1*(1*,1((56 1240 E. Ontario Ave., Ste. 102-312, Corona, CA 92881-8671 Phone (951) 372-9196 Fax (951) 372-9198 www.harpereng.com (9LHZRIWKHURRI LOOXVWUDWLQJPRGHUDWH R[LGDWLRQDQGIDGLQJ DQGRWKHUZLVHJHQHUDOO\ JRRGFRQGLWLRQRIWKH SDLQWV\VWHP (9LHZRIWKHFHQWHUYHQW LOOXVWUDWLQJFRUURVLRQRQ WKHYHQWVWUXFWXUHDQG VWDLQLQJRQWKHDGMDFHQW URRISODWHV (9LHZRIWKHEDVHRIWKH FHQWHUYHQWQHFN LOOXVWUDWLQJUXVWVFDOH DQGVWDLQLQJDORQJWKH ORZHUQHFNDQGDGMDFHQW URRI (6DPHDV3KRWR( H[FHSWUXVWVFDOHKDV EHHQUHPRYHGZLWKD FKLVHO1RWHSHUIRUDWLRQ ZKHUHWKHUXVWVFDOHZDV UHPRYHG (6DPHDV3KRWRV(DQG (H[FHSWLQD GLIIHUHQWORFDWLRQ (6DPHDV3KRWRV( WKURXJK(H[FHSWUXVW VFDOHKDVEHHQUHPRYHG ZLWKDFKLVHO1RWH SHUIRUDWLRQZKHUHWKH UXVWVFDOHZDVUHPRYHG (9LHZRIDSRUWLRQRIWKH URRILOOXVWUDWLQJ JHQHUDOO\JRRG FRQGLWLRQRIWKHSDLQW V\VWHP (6DPHDV3KRWR( H[FHSWDGLIIHUHQW SRUWLRQRIWKHURRI (9LHZRIWKHURRI LOOXVWUDWLQJFUDFNHGDQG GHODPLQDWLQJSDLQWZLWK H[SRVHGUHGSULPHFRDW (6DPHDV3KRWR( H[FHSWLQDGLIIHUHQW ORFDWLRQ (6DPHDV3KRWRV( DQG(H[FHSWQHDU WKHHGJHRIWKHURRI (6DPHDV3KRWR( H[FHSWLQDGLIIHUHQW ORFDWLRQ (9LHZRIWKHURRI KDWFKZRUNDUHD LOOXVWUDWLQJJHQHUDOO\ JRRGFRQGLWLRQRIWKH SDLQWV\VWHP (9LHZRIWKHOLTXLGOHYHO LQGLFDWRU//,SLSLQJ LOOXVWUDWLQJPLQRU FRUURVLRQDWWKHSLSH WKUHDGVDQGRQWKH EDFNVLGHRIWKHJDXJH ERDUG1RWH GHODPLQDWLQJSDLQWRQ WKHDGMDFHQWURRI VXUIDFHV (9LHZRIWKHURRIKDWFK LOOXVWUDWLQJPLQRU FRUURVLRQDORQJWKHWRS HGJHRIWKHKDWFKFXUE DQGXSSHUSRUWLRQRIWKH LQWHULRUODGGHU (9LHZRIWKHVWDLUZD\ SODWIRUPLOOXVWUDWLQJ UDQGRPVSRWVRI GHODPLQDWLQJSDLQW (9LHZRIWKHXSSHU SRUWLRQRIWKHVWDLUZD\ LOOXVWUDWLQJJHQHUDOO\ IDLUWRJRRGFRQGLWLRQ RIWKHSDLQWV\VWHP (6DPHDV3KRWR( H[FHSWDWWKHORZHU SRUWLRQRIWKHVWDLUZD\ (&ORVHXSYLHZRIDVWDLU WUHDGDWWKHVKHOO LOOXVWUDWLQJFUDFNHGDQG GHODPLQDWLQJSDLQWZLWK PRGHUDWHFRUURVLRQ (9LHZRIWKHVWDLUZD\ LOOXVWUDWLQJJHQHUDOO\ IDLUWRJRRGFRQGLWLRQ RIWKHSDLQWV\VWHPRQ WKHVWDLUZD\DQG DGMDFHQWVKHOO (9LHZRIWKHXQGHUVLGH RIWKHXSSHUSRUWLRQRI WKHVWDLUZD\LOOXVWUDWLQJ PRGHUDWHFRUURVLRQRQ WKHXQGHUVLGHRIWKH VWDLUZD\SODWIRUP (9LHZRIWKHXQGHUVLGH RIWKHVWDLUZD\ LOOXVWUDWLQJUDQGRP DUHDVRIJHQHUDO FRUURVLRQ (9LHZRIWKHXQGHUVLGH RIWKHWRSDQJOH LOOXVWUDWLQJUDQGRP VSRWVRIPLQRU FRUURVLRQ (9LHZRIDSRUWLRQRIWKH VKHOOLOOXVWUDWLQJ UDQGRPVSRWVRI PHFKDQLFDOGDPDJH ZLWKFRUURVLRQ (9LHZRIWKHORZHUVKHOO LOOXVWUDWLQJDODUJHDUHD ZLWKVSRWVRI PHFKDQLFDOGDPDJH ZLWKFRUURVLRQ (9LHZRIDQDGKHVLRQ WHVWRQWKHVKHOO LOOXVWUDWLQJWKHSRRU DGKHVLRQRIWKHSDLQW V\VWHP (9LHZRIWKHSULPDU\ PDQKROHLOOXVWUDWLQJ FRUURVLRQDWWKHQXWV DQGEROWVDQGSHULPHWHU RIWKHDGMDFHQW LGHQWLILFDWLRQ,' SODWH1RWHPHFKDQLFDO GDPDJHZLWKFRUURVLRQ RQWKHDGMDFHQWVKHOO VXUIDFHV (9LHZRIWKH,'SODWH LOOXVWUDWLQJSDLQW FRYHULQJWKHSODWHDQG PRGHUDWHFRUURVLRQ DORQJWKHSHULPHWHU (9LHZRIWKHVHFRQGDU\ PDQKROHLOOXVWUDWLQJ PHFKDQLFDOGDPDJH ZLWKFRUURVLRQDWWKH QXWVDQGEROWVFRYHU KDQGOHVDQGDGMDFHQW VKHOO (6DPHDV3KRWR( H[FHSWIURPDGLIIHUHQW DQJOH1RWHFRUURVLRQ DQGVWDLQLQJDWWKHYRLG EHWZHHQWKHPDQKROH FRYHUDQGQR]]OH (9LHZRIWKHXSSHU SRUWLRQRIWKHRYHUIORZ LOOXVWUDWLQJUDQGRP FRUURVLRQDWWKHQXWV DQGEROWVDQGIODQJHV (6DPHDV3KRWR( H[FHSWDWWKHERWWRPRI WKHRYHUIORZ (6DPHDV3KRWRV( DQG(H[FHSWD FORVHXSYLHZRIWKH VFUHHQLQJIODQJH1RWH SLOHRIGHEULVRQWKH LQWHULRURIWKHSLSH (9LHZRIWKHXSSHU SRUWLRQRIWKHLQOHW LOOXVWUDWLQJUDQGRP FRUURVLRQRQWKHQXWV DQGEROWVDQGIODQJHV (9LHZRIWKHERWWRPRI WKHLQOHWLOOXVWUDWLQJ UDQGRPGHODPLQDWLRQDW WKHERWWRPRIWKHSLSH DQGUDQGRPVSRWVRI FRUURVLRQRQWKHIODQJH (9LHZRIWKHXSSHU SRUWLRQRIWKH//, JDXJHERDUG LOOXVWUDWLQJJHQHUDOO\ JRRGFRQGLWLRQRIWKH ERDUG (6DPHDV3KRWR( H[FHSWDWWKHORZHU SRUWLRQRIWKH//, JDXJHERDUG1RWH PHFKDQLFDOGDPDJH ZLWKFRUURVLRQRQWKH DGMDFHQWVKHOO (9LHZRIDQLQOHWRXWOHW LOOXVWUDWLQJPHFKDQLFDO GDPDJHZLWKFRUURVLRQ (9LHZRIDVDPSOHWDS LOOXVWUDWLQJPHFKDQLFDO GDPDJHZLWKFRUURVLRQ RQWKHDGMDFHQWVKHOO (9LHZRIDVPDOO GLDPHWHUSHQHWUDWLRQ LOOXVWUDWLQJPLQRU FRUURVLRQRQWKHYDOYH DQGPHFKDQLFDOGDPDJH ZLWKFRUURVLRQRQWKH DGMDFHQWVKHOO (9LHZRIWKHORZHUVKHOO LOOXVWUDWLQJPHFKDQLFDO GDPDJHZLWKFRUURVLRQ (9LHZRIWKHERWWRP SODWHH[WHQVLRQ%3( LOOXVWUDWLQJPLQRU FRUURVLRQDORQJWKH HGJHRIWKH%3(ZKHUH WKHGLUWDQGDVSKDOW ZHUHVFUDSHGEDFN 3+272*5$3+,&6859(< 352-(&7 &RUURVLRQ(QJLQHHULQJ(YDOXDWLRQRI6L[:DWHU6WRUDJH5HVHUYRLUV 6758&785( ,QWHULRURID0*:HOGHG6WHHO:DWHU6WRUDJH5HVHUYRLU 5HVHUYRLU 2:1(5 &LW\RI9HUQRQ /2&$7,21 9HUQRQ&DOLIRUQLD 3+272*5$3+('%< %UDQGRQ%D[WHU(QJLQHHULQJ7HFKQLFLDQ '$7( )HEUXDU\ ,9LHZRIWKHLQWHULRUURRIDQGVWUXFWXUDOPHPEHUVLOOXVWUDWLQJUDQGRPLQVSHFWLRQPDUNVDQG RYHUDOOIDLUWRJRRGFRQGLWLRQRIWKHFRDWLQJV\VWHP +$53(5 $662&,$7(6(1*,1((5,1*,1& &2168/7,1*(1*,1((56 1240 E. Ontario Ave., Ste. 102-312, Corona, CA 92881-8671 Phone (951) 372-9196 Fax (951) 372-9198 www.harpereng.com ,9LHZRIWKHFHQWHU VXSSRUWVWUXFWXUH LOOXVWUDWLQJPRGHUDWH FRUURVLRQDWWKHQXWVDQG EROWVDQGKHDY\UXVW VFDOHDWWKHERWWRPRIWKH YHUWLFDOVXSSRUWV ,9LHZRIWKHUDIWHUHQGV DWWKHFHQWHUYHQW LOOXVWUDWLQJUDQGRP PLQRUFRUURVLRQRQWKH HQGVRIWKHUDIWHUV ,6DPHDV3KRWR, H[FHSWIURPDGLIIHUHQW DQJOH1RWHPRGHUDWH FRUURVLRQRIWKHQXWVDQG EROWVVHFXULQJWKHUDIWHUV WRWKHVXSSRUWULQJ ,6DPHDV3KRWRV,DQG ,H[FHSWIURPD GLIIHUHQWDQJOH ,9LHZRIWKHWRSRIWKH VXSSRUWSODWHLOOXVWUDWLQJ KHDY\UXVWVFDOHEXLOGXS DWWKHERWWRPRIWKH YHUWLFDOVXSSRUWV ,9LHZRIDSRUWLRQRIWKH URRILOOXVWUDWLQJPLQRU FRUURVLRQDQGVWDLQLQJ DORQJWKHURRIODSMRLQWV DQGUDQGRPXSSHUUDIWHU IODQJHV1RWHEURZQ LQVSHFWLRQPDUNVRQWKH VLGHVRIWKHUDIWHUV ,6DPHDV3KRWR, H[FHSWDGLIIHUHQWSRUWLRQ RIWKHURRI ,&ORVHXSYLHZRID UDIWHULOOXVWUDWLQJJRRG FRQGLWLRQRIWKHFRDWLQJ V\VWHPLQWKLVDUHD ,&ORVHXSYLHZRIDUDIWHU DWWKHWRSIODQJH LOOXVWUDWLQJUXVWVFDOH EXLOGXSRQWKHWRSVLGHRI WKHIODQJH ,9LHZRIDMDFNUDIWHUWR ODWHUDOVXSSRUWEUDFH LOOXVWUDWLQJPLQRU FRUURVLRQDORQJWKHWRS RIWKHODWHUDOVXSSRUWDQG DGMDFHQWXSSHUUDIWHU IODQJHV ,9LHZRIDODWHUDOVXSSRUW WRUDIWHUFRQQHFWLRQ LOOXVWUDWLQJFRUURVLRQ DORQJWKHHGJHVRIWKH DQJOHEUDFNHWDQGWRS IODQJHRIWKHUDIWHU ,9LHZRIWKHURRI LOOXVWUDWLQJPLQRU FRUURVLRQDORQJWKHURRI ODSMRLQWVDQGUDIWHU IODQJHV ,6DPHDV3KRWR, H[FHSWLQDGLIIHUHQW ORFDWLRQ1RWHDUHDVRI FRUURVLRQRQDGMDFHQW URRISODWH ,6DPHDV3KRWRV,DQG ,H[FHSWLQD GLIIHUHQWORFDWLRQ ,9LHZRIDUDIWHUWRVKHOO FRQQHFWLRQLOOXVWUDWLQJ PLQRUFRUURVLRQDORQJ WKHXSSHUUDIWHUIODQJH ,6DPHDV3KRWR, H[FHSWIURPWKHRSSRVLWH VLGHRIDFRQQHFWLRQ ,6DPHDV3KRWRV,DQG ,H[FHSWDWDVPDOOHU MDFNUDIWHUFRQQHFWLRQ ,6DPHDV3KRWR, H[FHSWIURPWKHRSSRVLWH VLGHRIDMDFNUDIWHU FRQQHFWLRQ ,9LHZRIWKHURRIWRVKHOO WUDQVLWLRQLOOXVWUDWLQJ PLQRUFRUURVLRQDORQJ WKHWUDQVLWLRQ ,9LHZRIDSRUWLRQRIWKH VKHOOLOOXVWUDWLQJEURZQ VWDLQLQJLQWKHZDWHU IOXFWXDWLRQ]RQH ,6DPHDV3KRWR, H[FHSWDGLIIHUHQWSRUWLRQ RIWKHVKHOO ,&ORVHXSYLHZRIWKH VKHOOLOOXVWUDWLQJ FUDFNLQJRIWKHFRDWLQJ V\VWHP ,9LHZRIWKHRYHUIORZ LOOXVWUDWLQJPRGHUDWHWR VHYHUHFRUURVLRQRQWKH LQWHULRURIWKHSLSHDWWKH ZHOGV1RWHFUDFNHG FRDWLQJRQDGMDFHQWVKHOO VXUIDFHV ,6DPHDV3KRWR, H[FHSWIURPDGLIIHUHQW DQJOH1RWHGHODPLQDWLQJ FRDWLQJRQWKHLQWHULRU HOERZ ,9LHZRIWKHLQOHWZHLU ER[LOOXVWUDWLQJVWDLQLQJ RQWKHZHLUER[DQG DGMDFHQWVKHOO ,6DPHDV3KRWR, H[FHSWIURPDGLIIHUHQW DQJOH ,9LHZRIDQDQJOH VXSSRUWLQJWKHZHLUER[ EHWZHHQUDIWHUV LOOXVWUDWLQJJHQHUDOO\ JRRGFRQGLWLRQRIWKH FRDWLQJV\VWHP ,9LHZRIWKHOLTXLGOHYHO LQGLFDWRU//,JXLGH ZLUHSHQHWUDWLRQV LOOXVWUDWLQJPLQRUWR PRGHUDWHFRUURVLRQDW WKHSHQHWUDWLRQVDQG DORQJWKHDGMDFHQWUDIWHU IODQJH ,9LHZRIWKH//,IORDW LOOXVWUDWLQJVWDLQLQJDQG GHEULVDGKHULQJWRWKH IORDW ,9LHZRIWKHURRIKDWFK LOOXVWUDWLQJPLQRU FRUURVLRQDORQJDURRI ODSMRLQWDQGWKHDGMDFHQW UDIWHUIODQJH ,9LHZRIWKHXSSHU SRUWLRQRIWKHODGGHU LOOXVWUDWLQJEURZQ VWDLQLQJRQWKHODGGHU DQGVKHOOLQWKHZDWHU IOXFWXDWLRQ]RQH ,9LHZRIWKHODGGHUMXVW EHORZWKHZDWHUOLQH LOOXVWUDWLQJEURZQ VWDLQLQJRQWKHODGGHU DQGSRRUYLVLELOLW\GXHWR FRQWDPLQDQWVLQWKH ZDWHU ,6DPHDV3KRWR, H[FHSWIXUWKHUGRZQWKH ODGGHU ,6DPHDV3KRWRV,DQG ,H[FHSWIXUWKHU GRZQWKHODGGHU1RWH FRDWLQJV\VWHPDSSHDUV WREHLQJHQHUDOO\JRRG FRQGLWLRQRQWKHODGGHU VWDQGRIIEUDFNHWDQG DGMDFHQWVKHOO ,9LHZRIWKHVKHOO LOOXVWUDWLQJKHDY\UHVLGXH FOLQJLQJWRWKHVKHOO ,6DPHDV3KRWR, H[FHSWLQDGLIIHUHQW ORFDWLRQ ,6DPHDV3KRWRV,DQG ,H[FHSWLQD GLIIHUHQWORFDWLRQ ,6DPHDV3KRWRV, WKURXJK,H[FHSWLQD GLIIHUHQWORFDWLRQ1RWH UHVLGXHLVOLJKWHULQWKLV ORFDWLRQDQGFRDWLQJFDQ EHVHHQWKURXJKWKH UHVLGXH ,9LHZRIDPDQKROH LOOXVWUDWLQJFRUURVLRQRQ WKHPDQKROHFRYHUDQG SRVVLEO\DORQJWKHORZHU HGJHRIWKHVWLIIHQHUULQJ ,6DPHDV3KRWR, H[FHSWDWWKHRWKHUVLGH RIWKHPDQKROH1RWH EOLVWHULQJDQGRU FRUURVLRQWKURXJKWKH UHVLGXHDORQJWKHHGJHRI WKHVWLIIHQHUULQJ ,9LHZRIWKHRWKHU PDQKROHDQGWKH DGMDFHQWVKHOO LOOXVWUDWLQJUDQGRP FRUURVLRQRQWKHORZHU SRUWLRQRIWKHVWLIIHQHU ULQJDQGRQWKHVKHOORQ WKHULJKWVLGHRIWKH VWLIIHQHUULQJ ,6DPHDV3KRWR, H[FHSWDFORVHXSYLHZ RIWKHOHIWVLGHRIWKH VWLIIHQHUULQJ ,9LHZRIDVDPSOHWDS LOOXVWUDWLQJFRUURVLRQDW WKHSHQHWUDWLRQDQG KHDY\UHVLGXHRQWKH DGMDFHQWVKHOO ,9LHZRIWKHLQOHWRXWOHW GHIOHFWRUSODWH LOOXVWUDWLQJJHQHUDOO\ JRRGFRQGLWLRQRIWKH FRDWLQJV\VWHPWKDWFDQ EHVHHQZLWKRXWWKH KHDY\UHVLGXH ,9LHZRIWKHWRSHGJHRI WKHGHIOHFWRUSODWHLQD GLIIHUHQWORFDWLRQ LOOXVWUDWLQJUDQGRPVSRWV RIFRUURVLRQ ,9LHZRIWKHFROXPQ LOOXVWUDWLQJJHQHUDOO\ JRRGFRQGLWLRQRIWKH FRDWLQJV\VWHPDVFRXOG EHREVHUYHGWKURXJKWKH OLJKWUHVLGXHFOLQJLQJWR WKHFROXPQ ,9LHZRIWKHFROXPQ EDVHLOOXVWUDWLQJKHDY\ UHVLGXHFOLQJLQJWRWKH FROXPQDQGUHWDLQHUFOLSV DQGKHDY\VHGLPHQWRQ WKHERWWRPVXUIDFHV ,9LHZRIWKHERWWRP LOOXVWUDWLQJDWKLFNOD\HU RIVHGLPHQW1RWH SRVVLEOHFRUURVLRQLQ OLJKWHUDUHDV 3+272*5$3+,&6859(< 352-(&7 &RUURVLRQ(QJLQHHULQJ(YDOXDWLRQRI6L[:DWHU6WRUDJH5HVHUYRLUV 6758&785( ([WHULRURID0*:HOGHG6WHHO:DWHU6WRUDJH5HVHUYRLU 5HVHUYRLU 2:1(5 &LW\RI9HUQRQ /2&$7,21 9HUQRQ&DOLIRUQLD 3+272*5$3+('%< 'DYLG$VKWRQ(QJLQHHULQJ7HFKQLFLDQ '$7( )HEUXDU\ (9LHZRIWKHH[WHULRURI5HVHUYRLULOOXVWUDWLQJPRGHUDWHR[LGDWLRQDQGIDGLQJDQG RWKHUZLVHJRRGFRQGLWLRQRIWKHSDLQWV\VWHP +$53(5 $662&,$7(6(1*,1((5,1*,1& &2168/7,1*(1*,1((56 1240 E. Ontario Ave., Ste. 102-312, Corona, CA 92881-8671 Phone (951) 372-9196 Fax (951) 372-9198 www.harpereng.com (9LHZRIWKHURRI LOOXVWUDWLQJ GHODPLQDWLRQRIWKH WRSFRDWV1RWHSDWWHUQ RIGHODPLQDWLRQLV SHUSHQGLFXODUWRWKH OHQJWKRIWKHURRI SODWHV (9LHZRIWKHFHQWHUYHQW FRYHULOOXVWUDWLQJ GHODPLQDWLRQRIWKH SDLQWV\VWHPDQG UDQGRPVSRWVRI FRUURVLRQDW GHODPLQDWLQJDUHDV (9LHZRIWKHXQGHUVLGH RIWKHFHQWHUYHQWFRYHU LOOXVWUDWLQJUDQGRP VSRWVRIFRUURVLRQRQ WKHXQGHUVLGHRIWKH FRYHUDQGDGMDFHQWYHQW VXSSRUWVWUXFWXUH (9LHZRIWKHEDVHRIWKH FHQWHUYHQWQHFN LOOXVWUDWLQJFUDFNHG SDLQWDQGFRUURVLRQ 1RWHWRXFKXSSDLQW DSSHDUVWREHSUHVHQWLQ WKLVDUHD (6DPHDV3KRWR( H[FHSWUXVWVFDOHKDV EHHQUHPRYHGZLWKD FKLVHO1RWHGHHS SLWWLQJDQGDVPDOOKROH LQWKHURRISODWH (6DPHDV3KRWRV(DQG (H[FHSWLQD GLIIHUHQWORFDWLRQ (9LHZRIDSRUWLRQRIWKH URRILOOXVWUDWLQJVHYHUH GHODPLQDWLRQRIWKH WRSFRDWV (6DPHDV3KRWR( H[FHSWDGLIIHUHQW SRUWLRQRIWKHURRI 1RWHDUHDVRIPLQRU FRUURVLRQDWUDQGRP GHODPLQDWLQJDUHDV (6DPHDV3KRWR( H[FHSWDFORVHXSYLHZ RIRQHRIWKHDUHDVRI FRUURVLRQ (9LHZRIWKHSHULPHWHU RIWKHURRILOOXVWUDWLQJ DUHDVRISRQGLQJZDWHU GLUWDQGGHODPLQDWLRQ DORQJWKHHGJHRIWKH URRI (9LHZRIWKHURRI KDWFKZRUNDUHD LOOXVWUDWLQJ GHODPLQDWLRQRIWKH SDLQWV\VWHPRQWKHURRI SODWHV (9LHZRIWKHOLTXLGOHYHO LQGLFDWRU//,SLSLQJ LOOXVWUDWLQJPLQRU FRUURVLRQRQWKHSLSHV SLSHWKUHDGVDQG DGMDFHQWURRI (9LHZRIWKHURRIKDWFK LOOXVWUDWLQJPLQRU FRUURVLRQDWWKHHGJHRI WKHKDWFKFXUE (9LHZRIWKHVWDLUZD\ SODWIRUPLOOXVWUDWLQJ UDQGRPPLQRUVSRWVRI FRUURVLRQRQWKH SODWIRUPDQG JXDUGUDLOLQJ (9LHZRIDSRUWLRQRIWKH VWDLUZD\LOOXVWUDWLQJ PHFKDQLFDOGDPDJH ZLWKFRUURVLRQRQWKH VWDLUWUHDGV (6DPHDV3KRWR( H[FHSWIXUWKHUGRZQWKH VWDLUZD\ (6DPHDV3KRWRV( DQG(H[FHSWIURPD GLIIHUHQWDQJOH (9LHZRIWKHXSSHU SRUWLRQRIWKHVKHOO//, JDXJHERDUGDQG VWDLUZD\LOOXVWUDWLQJ FRUURVLRQRQWKH XQGHUVLGHRIWKH SODWIRUPDQGJHQHUDOO\ JRRGFRQGLWLRQRIWKH VKHOODQG//,JDXJH ERDUG (9LHZRIWKHWRSDQJOH LOOXVWUDWLQJUDQGRP VSRWVRIFRUURVLRQDORQJ WKHHGJHRIWKHWRS DQJOH (9LHZRIDSRUWLRQRIWKH VKHOOLOOXVWUDWLQJ RYHUDOOJRRGFRQGLWLRQ RIWKHSDLQWV\VWHP (6DPHDV3KRWR( H[FHSWDGLIIHUHQW SRUWLRQRIWKHVKHOO 1RWHLVRODWHGVSRWVRI PHFKDQLFDOGDPDJH ZLWKFRUURVLRQ (&ORVHXSYLHZRIWKH VKHOOLOOXVWUDWLQJ FRUURVLRQDORQJD KRUL]RQWDOZHOG (9LHZRIDQDGKHVLRQ WHVWRQWKHVKHOO LOOXVWUDWLQJWKHSRRU DGKHVLRQRIWKHSDLQW V\VWHP (9LHZRIDPDQKROH LOOXVWUDWLQJPHFKDQLFDO GDPDJHZLWKFRUURVLRQ RQWKHQXWVDQGEROWV DQGKDQGOHV (9LHZRIWKH LGHQWLILFDWLRQSODWH LOOXVWUDWLQJFRUURVLRQDW WKHSHULPHWHURIWKH SODWH (6DPHDV3KRWR( H[FHSWDWWKHRWKHU PDQKROH (9LHZRIWKHRYHUIORZ LOOXVWUDWLQJFRUURVLRQDW WKHQXWVDQGEROWVDQG IODQJHGFRQQHFWLRQV (6DPHDV3KRWR( H[FHSWDWWKHERWWRPRI WKHRYHUIORZ (6DPHDV3KRWRV( DQG(H[FHSWD FORVHXSYLHZRIWKH VFUHHQHGRSHQLQJ1RWH SLOHRIGHEULVLQVLGHWKH SLSH (9LHZRIWKHLQOHW LOOXVWUDWLQJFRUURVLRQDW WKHQXWVDQGEROWVDQG IODQJHGFRQQHFWLRQV (6DPHDV3KRWR( H[FHSWDWWKHERWWRPRI WKHLQOHWSLSH1RWH PHFKDQLFDOGDPDJH ZLWKFRUURVLRQRQWKH SLSH (9LHZRIDQLQOHWRXWOHW LOOXVWUDWLQJPHFKDQLFDO GDPDJHZLWKFRUURVLRQ DWWKHYDOYHIODQJHV DQGDGMDFHQWVKHOO (9LHZRIDVPDOO GLDPHWHUSHQHWUDWLRQ LOOXVWUDWLQJPLQRU FRUURVLRQRQWKHSLSLQJ DQGDGMDFHQWVKHOO (9LHZRIDVDPSOHWDS LOOXVWUDWLQJJHQHUDOO\ JRRGFRQGLWLRQRIWKH YDOYHDQGVWDLQLQJ UXQQLQJGRZQWKH DGMDFHQWVKHOO (9LHZRIWKHORZHUVKHOO DQGERWWRPSODWH H[WHQVLRQ%3( LOOXVWUDWLQJDVSKDOW UDQGRPO\FRYHULQJWKH %3( (6DPHDV3KRWR( H[FHSWLQDGLIIHUHQW ORFDWLRQ1RWH PHFKDQLFDOGDPDJH ZLWKFRUURVLRQDQG VWDLQLQJ 3+272*5$3+,&6859(< 352-(&7 &RUURVLRQ(QJLQHHULQJ(YDOXDWLRQRI6L[:DWHU6WRUDJH5HVHUYRLUV 6758&785( ,QWHULRURID0*:HOGHG6WHHO:DWHU6WRUDJH5HVHUYRLU 5HVHUYRLU 2:1(5 &LW\RI9HUQRQ /2&$7,21 9HUQRQ&DOLIRUQLD 3+272*5$3+('%< 'DYLG$VKWRQ(QJLQHHULQJ7HFKQLFLDQ '$7( )HEUXDU\ ,9LHZRIWKHLQWHULRUURRIDQGVWUXFWXUDOPHPEHUVLOOXVWUDWLQJUDQGRPPLQRUFRUURVLRQDW ODWHUDOVXSSRUWEUDFHVDQGRWKHUZLVHJHQHUDOO\JRRGFRQGLWLRQRIWKHFRDWLQJV\VWHP +$53(5 $662&,$7(6(1*,1((5,1*,1& &2168/7,1*(1*,1((56 1240 E. Ontario Ave., Ste. 102-312, Corona, CA 92881-8671 Phone (951) 372-9196 Fax (951) 372-9198 www.harpereng.com ,9LHZRIWKHFHQWHU VXSSRUWVWUXFWXUH LOOXVWUDWLQJJHQHUDOO\ JRRGFRQGLWLRQRIWKH FRDWLQJV\VWHP ,6DPHDV3KRWR, H[FHSWDFORVHUYLHZ 1RWHUDQGRPFRUURVLRQ DWWKHUDIWHUHQGV ,&ORVHXSYLHZRIUDIWHU HQGVLOOXVWUDWLQJ PRGHUDWHWRVHYHUH FRUURVLRQDWWKHUDIWHU HQGVDQGDGMDFHQWYHQW VWUXFWXUH ,6DPHDV3KRWR, H[FHSWIURPDGLIIHUHQW DQJOH ,9LHZRIWKHORZHU SRUWLRQRIWKHFHQWHU VXSSRUWVWUXFWXUH LOOXVWUDWLQJJHQHUDOO\ JRRGFRQGLWLRQRIWKH FRDWLQJV\VWHP ,6DPHDV3KRWR, H[FHSWDFORVHXSYLHZ RIWKHVXSSRUWSODWH ,9LHZRIWKHFROXPQ LOOXVWUDWLQJFUDFNHG FRDWLQJ ,9LHZRIDSRUWLRQRIWKH URRILOOXVWUDWLQJUDQGRP PLQRUFRUURVLRQDORQJ XSSHUUDIWHUIODQJHVDQG URRIODSMRLQWVDQG RWKHUZLVHJHQHUDOO\JRRG FRQGLWLRQRIWKHFRDWLQJ V\VWHP ,9LHZRIDMDFNUDIWHUDQG ODWHUDOVXSSRUW LOOXVWUDWLQJJHQHUDOO\ JRRGFRQGLWLRQRIWKH FRDWLQJV\VWHP1RWH PLQRUFRUURVLRQDWWKH DGMDFHQWURRIODSMRLQW ,6DPHDV3KRWR, H[FHSWDFORVHUYLHZRID MDFNUDIWHUWRODWHUDO EUDFHFRQQHFWLRQ ,9LHZRIWKHURRIDQG UDIWHUVLOOXVWUDWLQJ JHQHUDOO\JRRGFRQGLWLRQ RIWKHFRDWLQJV\VWHP ,9LHZRIWKHURRI LOOXVWUDWLQJPRGHUDWH FRUURVLRQDORQJDURRI ODSMRLQWDQGOLJKW VWDLQLQJRQWKHDGMDFHQW URRISODWHV ,6DPHDV3KRWR, H[FHSWDFORVHXSYLHZ RIWKHURRIODSMRLQW ,9LHZRIWKHOLTXLGOHYHO LQGLFDWRU//, SHQHWUDWLRQVLOOXVWUDWLQJ PRGHUDWHFRUURVLRQDW WKHSHQHWUDWLRQV ,9LHZRIWKH//,IORDW LOOXVWUDWLQJVWDLQLQJRQ WKHDOXPLQXPIORDWDQG WKHIORDWLVVWXFNDERYH WKHZDWHUOLQH1RWH EURZQVWDLQLQJRQWKH VKHOOLQWKHZDWHU IOXFWXDWLRQ]RQH ,9LHZRIDUDIWHUWRVKHOO FRQQHFWLRQLOOXVWUDWLQJ PLQRUWRPRGHUDWH FRUURVLRQRQWKHQXWVDQG EROWVVHFXULQJWKH FRQQHFWLRQDQGDWWKH XSSHUIODQJH ,6DPHDV3KRWR, H[FHSWIURPWKHRSSRVLWH VLGHRIDFRQQHFWLRQ ,9LHZRIDMDFNUDIWHUWR VKHOOFRQQHFWLRQ LOOXVWUDWLQJPLQRU FRUURVLRQDWWKHQXWVDQG EROWVDQGPRGHUDWH FRUURVLRQDWWKHDGMDFHQW URRIWRVKHOOWUDQVLWLRQ ,6DPHDV3KRWR, H[FHSWIURPWKHRSSRVLWH VLGHRIDFRQQHFWLRQ ,9LHZRIWKHURRIWRVKHOO WUDQVLWLRQLOOXVWUDWLQJ PLQRUFRUURVLRQDORQJ WKHWUDQVLWLRQ ,&ORVHXSYLHZRIWKH URRIWRVKHOOWUDQVLWLRQ LOOXVWUDWLQJPRGHUDWHWR VHYHUHFRUURVLRQDORQJ WKHWUDQVLWLRQ ,6DPHDV3KRWR, H[FHSWLQDGLIIHUHQW ORFDWLRQ1RWHFRUURVLRQ DORQJWKHDGMDFHQWURRI ODSMRLQW ,9LHZRIDSRUWLRQRIWKH VKHOOLOOXVWUDWLQJGDUN EURZQVWDLQLQJLQWKH ZDWHUIOXFWXDWLRQ]RQH ,6DPHDV3KRWR, H[FHSWDGLIIHUHQWSRUWLRQ RIWKHVKHOO ,&ORVHXSYLHZRIWKH VKHOOLOOXVWUDWLQJ FUDFNLQJRIWKHFRDWLQJ V\VWHP ,6DPHDV3KRWR, H[FHSWDFORVHUYLHZRI WKHFUDFNHGFRDWLQJ ,9LHZRIWKHRYHUIORZ LOOXVWUDWLQJJHQHUDOO\ JRRGFRQGLWLRQRIWKH FRDWLQJV\VWHPRQWKH SLSHDQGDGMDFHQWVKHOO VXUIDFHV ,9LHZRIWKHLQWHULRURI WKHRYHUIORZSLSH LOOXVWUDWLQJGHODPLQDWLQJ FRDWLQJZLWKPRGHUDWH FRUURVLRQSUHVHQW ,9LHZRIWKHLQOHWZHLU ER[LOOXVWUDWLQJEURZQ VWDLQLQJRQWKHORZHU SRUWLRQRIWKHLQOHWZHLU DQGDGMDFHQWVKHOO ,6DPHDV3KRWR, H[FHSWIURPWKH XQGHUVLGHRIWKHZHLU ER[ ,6DPHDV3KRWRV,DQG ,H[FHSWIURPWKH ULJKWVLGHRIWKHZHLU ER[ ,9LHZRIWKHURRIKDWFK LOOXVWUDWLQJPLQRU FRUURVLRQDORQJWKH SHULPHWHURIWKHKDWFK FXUE ,9LHZRIWKHODGGHUMXVW EHORZWKHZDWHUOLQH LOOXVWUDWLQJDKHDY\ UHVLGXHRQWKHODGGHUDQG DGMDFHQWVKHOO ,6DPHDV3KRWR, H[FHSWIXUWKHUGRZQWKH ODGGHU ,6DPHDV3KRWRV,DQG ,H[FHSWIXUWKHU GRZQWKHODGGHU1RWH UHVLGXHLVOLJKWHUDQG FRDWLQJDSSHDUVWREHLQ JHQHUDOO\JRRG FRQGLWLRQ ,6DPHDV3KRWRV, WKURXJK,H[FHSWDW WKHERWWRPRIWKHODGGHU 1RWHVSRWRIPLQRU FRUURVLRQRQDODGGHU VLGHUDLO ,9LHZRIWKHVKHOO LOOXVWUDWLQJDOLJKWEURZQ UHVLGXHDQGJHQHUDOO\ JRRGFRQGLWLRQRIWKH FRDWLQJV\VWHPDVFRXOG EHREVHUYHGWKURXJKWKH OLJKWUHVLGXH ,6DPHDV3KRWR, H[FHSWLQDGLIIHUHQW ORFDWLRQ ,6DPHDV3KRWRV,DQG ,H[FHSWLQD GLIIHUHQWORFDWLRQ1RWH UHVLGXHLVKHDYLHULQWKLV ORFDWLRQ ,6DPHDV3KRWRV, WKURXJK,H[FHSWLQD GLIIHUHQWORFDWLRQ ,9LHZRIDPDQKROH LOOXVWUDWLQJDKHDY\ UHVLGXHRQDOOVXUIDFHV ,6DPHDV3KRWR, H[FHSWDFORVHUYLHZRI WKHORZHUSRUWLRQRIWKH PDQKROH1RWHFRUURVLRQ DORQJWKHORZHUSRUWLRQ RIWKHVWLIIHQHUULQJDQG DWWKHULJKWVLGHRIWKH FRYHU ,6DPHDV3KRWRV,DQG ,H[FHSWDWWKHOHIW VLGHRIWKHPDQKROH ,9LHZRIWKHRWKHU PDQKROHLOOXVWUDWLQJD KHDY\UHVLGXHRQDOO VXUIDFHV ,9LHZRIWKHVKHOOWR ERWWRPWUDQVLWLRQ LOOXVWUDWLQJKHDY\UHVLGXH FOLQJLQJWRWKHVKHOODQG DWKLFNOD\HURIVHGLPHQW RQWKHERWWRP ,9LHZRIWKHFROXPQ LOOXVWUDWLQJJHQHUDOO\ JRRGFRQGLWLRQRIWKH FRDWLQJV\VWHPDVFRXOG EHREVHUYHGWKURXJKWKH OLJKWUHVLGXHFOLQJLQJWR WKHFROXPQ ,9LHZRIWKHFROXPQ EDVHLOOXVWUDWLQJDKHDY\ UHVLGXHRQWKHFROXPQ EDVHDQGWKLFNVHGLPHQW RQWKHERWWRPVXUIDFHV ,9LHZRIWKHERWWRPDW WKHLQWHULRURIWKHRXWOHW GHIOHFWRUSODWH LOOXVWUDWLQJOLJKW VHGLPHQWDQGJHQHUDOO\ JRRGFRQGLWLRQRIWKH FRDWLQJV\VWHP1RWH ERWWRPZDVRQO\YLVLEOH LQWKLVDUHD WĂŐĞϴŽĨϴ $WWDFKPHQW /DERUDWRU\$QDO\VLVRI,QWHULRU&RDWLQJDQG([WHULRU3DLQW ! "# $%#& $% $%#& & %# %' % % %' ()) * * *+ * *** ,,,-./-01.-1.2314 155326-./-01.-1.2314 -7215* ! !"#" $%&'%() *+ *&( , -. / + ()0123456265564206,##7 * 7 7 6 + 8 * 7 7 6 * ! ! )*) &6 + 8 1 ) " 0 +& & %,++ + * ++& + & & + % + 9&* 8 98* %&( !" # $ % & $ ! "# $%#& $% $%#& & %# %' % % %' ()) * * *+ * *** ,,,-./-01.-1.2314 155326-./-01.-1.2314 -72*15* -2281.29 -2232:29 ;:132!1 < 2.4!<402. <142. "+ *) !"#$#%# &' (& ) * +, *==* *=)=* - +)$.(& /#00 1#2 3## ##456 : " 7 " ;'" # " <="$ >< ? < + $@5- A @ ! ) ( )$@5B @ (A ! ()*+( $ $@5B @ (A ! +),-( +$@5B @ A( ! -*)(( : " 7 " ;'" !.. " <="$ >< ? < + $@5- A @ ! ) ( )$@5B @ (A ! ,/)*( $ $@5B @ (A ! ,0,11 ( +$@5B @ A( ! --(1 ( >2;?@2;7 -0 .231. ! " # $ % & " # # ' " # ((")*+ " # , & - . / +/ # 0 & # % 1 #'2 + # '2 " +# !" # $%&''$()&(* +,! - * ++& + & & + % + 9&* 8 98* %&( !" # $ % & $ !" # $ $% & '% # ( )) * *# *+ * *** ,--./012314,21,2/"$.,5 666$12314,21,2/"$.,5 17/ ,- !" !#$ %&&#&'( ) * + ) ,+ , - . / ) .*0+ %!$(( !&% !1 1!! - . 2 345"1"# 1!(1!! 1! 1!! %% ! " "#" $% $%& $% '( % '( %& '( % !" #" $ ) " $% $% '(% % % % % % % % % % % % % % % % % % % % % % % % % * +, "#"- + . ! ) 8/9 :;/97 2/"</9 ! "# $ %& ' # ! "# $%#& $% $%#& & %# %' % % %' ()) * * *+ * *** ,,,-./-01.-1.2314 155326-./-01.-1.2314 -7215 ! !"#" $ %&'(&)* +, +') - .# / , )*0123456265564206-##$ + $ $ 6 , 7 + $ $ 6 + ! ! *+* '6 , 7 1 * " 0 ,' ' &-,, , + ,,' , ' ' , & , 8'+ 7 87+ &') !" # $ % & $ ! "# $%#& $% $%#& & %# %' % % %' ()) * * *+ * *** ,,,-./-01.-1.2314 155326-./-01.-1.2314 -72*15 -2281.29 -2232:29 ;:132!1 < 2.4!<402. <142. + "+ *) !"#$#%# &' (& ) * +, *==* *=)=* - +)$.(& /#00 1#2 3## ##44456 9 " $ ":;'" # " <="$ >< ? < , %@5. : @ ! * ) *%@5A @ ): ! ()*)) % %@5A @ ): ! (+*,) ,%@5A @ :) ! -.,/) 9 " $ ":;'" !00 " <="$ >< ? < , %@5. : @ ! * ) *%@5A @ ): ! 1*,.) % %@5A @ ): ! )12//) ,%@5A @ :) ! +((/) . 9 " $ ". ; " # " <="$ >< ? < , %@5. : @ ! * ) *%@5A @ ): ! )*12 ) % %@5A @ ): ! 3*.)) ,%@5A @ :) ! -+*3 ) $ 9 " $ ". ; " #" " <="$ >< ? < , %@5. : @ ! * ) *%@5A @ ): ! -*/,) % %@5A @ ): ! ,*(+) ,%@5A @ :) ! (2*)) : 9 " $ ". ; " !00 " <="$ >< ? + ,,' , ' ' , & , 8'+ 7 87+ &') !" # $ % & $ ! "# $%#& $% $%#& & %# %' % % %' ()) * * *+ * *** ,,,-./-01.-1.2314 155326-./-01.-1.2314 -7215 -2281.29 -2232:29 ;:132!1 < 2.4!<402. <142. + "+ *) !"#$#%# &' (& ) * +, *==* *=)=* - +)$.(& /#00 1#2 3## ##44456 : 9 " $ ". ; " !00 " <="$ ))))), < , %@5. : @ ! * ) *%@5A @ ): ! +*3() % %@5A @ ): ! ,*+,) ,%@5A @ :) ! -+*() >2;?@2;7 -0 .231. ! " # $ % & " # # ' " # ((")*+ " # , & - . / +/ # 0 & # % 1 #'2 + # '2 " +# !" # $%&''$()&(* +,! - + ,,' , ' ' , & , 8'+ 7 87+ &') !" # $ % & $ !" # $ $% & '% # ( )) * *# *+ * *** ,--./012314,21,2/"$.,5 666$12314,21,2/"$.,5 17/ ,- !" !#$ %&&#&'( ) * + ) ,+ , - . / ) .*0+ %!$(& !&% !1 1!! - . 2 345"1"# 1!(1!! 1! 1!! %% ! " "#" $% $%& $% '( % '( %& '( % ! " # " $ ) " $% $% '(% % % % % % % % % % % % % % % % % % % % % % % % % * +, "#"- + . ! ) 8/9 :;/97 2/"</9 ! "# $ %& ' # ! "# $%#& $% $%#& & %# %' % % %' ()) * * *+ * *** ,,,-./-01.-1.2314 155326-./-01.-1.2314 -7215 ! !"#" $ %&'(&)* +, +') - . / , )* 0123456265564206-7##. + . . 6 , 8 + . . 6 + ! ! *+* '6 , 8 1 * " 0 ,' ' &-,, , + ,,' , ' ' , & , 9'+ 8 98+ &') !" # $ % & $ ! "# $%#& $% $%#& & %# %' % % %' ()) * * *+ * *** ,,,-./-01.-1.2314 155326-./-01.-1.2314 -72*15 -2281.29 -2232:29 ;:132!1 < 2.4!<402. <142. "+ *) ! "#"$"% &' (& ) * +, *==* *=)=* - +)#.(& /"00 1"2 "" % ""344456 : " . $"7 ;'" # " <="$ >< ? < , %@57 A @ ! * ) *%@5B @ )A ! ()*+) % %@5B @ )A ! ,,)-) ,%@5B @ A) ! +(+.) : " . $"7 ;'" !// " <="$ >< ? < , %@57 A @ ! * ) *%@5B @ )A ! +0.) % %@5B @ )A ! +12..) ,%@5B @ A) ! 1,-) 7 : " . $".A; " # " <="$ >< ? < , %@57 A @ ! * ) *%@5B @ )A ! +).2 ) % %@5B @ )A ! ++),) ,%@5B @ A) ! -)3,) . : " . $".A; " #" " <="$ >< ? < , %@57 A @ ! * ) *%@5B @ )A ! +)++) % %@5B @ )A ! 2),-) ,%@5B @ A) ! -)+.) A : " . $".A; " !// " <="$ >< ? + ,,' , ' ' , & , 9'+ 8 98+ &') !" # $ % & $ ! "# $%#& $% $%#& & %# %' % % %' ()) * * *+ * *** ,,,-./-01.-1.2314 155326-./-01.-1.2314 -7215 -2281.29 -2232:29 ;:132!1 < 2.4!<402. <142. "+ *) ! "#"$"% &' (& ) * +, *==* *=)=* - +)#.(& /"00 1"2 "" % ""344456 A : " . $".A; " !// " <="$ ))))), < , %@57 A @ ! * ) *%@5B @ )A ! ,).() % %@5B @ )A ! 1).() ,%@5B @ A) ! *)10 ) >2;?@2;7 -0 .231. ! " # $ % & " # # ' " # ((")*+ " # , & - . / +/ # 0 & # % 1 #'2 + # '2 " +# !" # $%&''$()&(* +,! - + ,,' , ' ' , & , 9'+ 8 98+ &') !" # $ % & $ !" # $ $% & '% # ( )) * *# *+ * *** ,--./012314,21,2/"$.,5 666$12314,21,2/"$.,5 17/ ,- !" !#$ %&&#&'( ) * + ) ,+ , - . / ) .*0+ %!$(% !&% !1 1!! - . 2 345"1"#$ 1!(1!! 1! 1!! %% ! " "#" $% $%& $% '( % '( %& '( % ! " # " $ ) " $% $% '(% % % % % % % % % % % % % % % % % % % % % % % % % * +, "#"- + . ! ) 8/9 :;/97 2/"</9 ! "# $ %& ' # Page 116 of 117 EXHIBIT C EQUAL EMPLOYMENT OPPORTUNITY PRACTICES PROVISIONS A. Contractor certifies and represents that, during the performance of this Agreement, the contractor and each subcontractor shall adhere to equal opportunity employment practices to assure that applicants and employees are treated equally and are not discriminated against because of their race, religious creed, color, national origin, ancestry, handicap, sex, or age. Contractor further certifies that it will not maintain any segregated facilities. B. Contractor agrees that it shall, in all solicitations or advertisements for applicants for employment placed by or on behalf of Contractor, state that it is an "Equal Opportunity Employer" or that all qualified applicants will receive consideration for employment without regard to their race, religious creed, color, national origin, ancestry, handicap, sex or age. C. Contractor agrees that it shall, if requested to do so by the City, certify that it has not, in the performance of this Agreement, discriminated against applicants or employees because of their membership in a protected class. D. Contractor agrees to provide the City with access to, and, if requested to do so by City, through its awarding authority, provide copies of all of its records pertaining or relating to its employment practices, except to the extent such records or portions of such records are confidential or privileged under state or federal law. E. Nothing contained in this Agreement shall be construed in any manner as to require or permit any act which is prohibited by law. Page 117 of 117 EXHIBIT D SCHEDULE OF WORK ITEMS REHABILITAITON OF RESERVOIRS 2-1, 2-2, and 2-3 INCLUDING OPTIONAL BID ITEMS NOTICE INVITING BIDS Page 7 of 8 NOTICE INVITING BIDS for Rehabilitation of Reservoirs 2-1, 2-2, and 2-3 in the City of Vernon, California Bids are to be signed and submitted in TRIPLICATE. ONE ORIGINAL AND TWO COPIES of sealed bids must be received prior to 2:00 p.m., February 28, 2022,by the City Clerk, City of Vernon, 4305 Santa Fe Avenue, Vernon, CA 90058, (“Bid Deadline”). All bids shall be enclosed in sealed envelopes, distinctly marked “Bid” with the title of the bid and the bidder’s name address appearing on the outside. Bids should be mailed or delivered in person before 2:00 p.m. on the Bid Deadline.LATE SUBMITTALS WILL NOT BE ACCEPTED.Bids must be received in the City Clerk’s Office before that time.Bids will be opened in the City Clerk’s Office immediately after the Bid Deadline.At the bid opening, the City Clerk shall open bid packages and acknowledge the receipt of Bids. Once all bid packages are opened and announced, the Bid Forms will be made available for public review. The bids shall be clearly titled. Copies of Bid Documents, Plans, and Specifications are available at no charge at: www.cityofvernon.org/planetbids. It is the responsibility of all prospective bidders to register on the City’s PlanetBids website to ensure receipt of any addendum(a) prior to bid submittals. Additionally, information on any addendum(a) issued for any bid specifications for any project will be available on the City’s PlanetBids website at: www.cityofvernon.org/planetbids. The City reserves the right to reject as nonresponsive any bid that fails to include the information required by any addendum(a) posted on the City’s PlanetBids website. Pre-Bid Meeting: A pre-bid meeting to answer any questions regarding the project plans and specifications is scheduled for February 17, 2022 at 10:00 a.m. at 3570 Vernon Avenue, Vernon, California. This meeting is to answer any questions regarding the project plans and specifications. Attendees must adhere to the State and local guidelines regarding COVID-19, including applicable industry guidelines for construction sites. City of Vernon Contact Person: Vernon Public Utilities Attention: Mark Aumentado, P.E. Phone: (323) –583-8811 ext. 309 Email: maumentado@ci.vernon.ca.us Page 8 of 9 General Scope of Work: Contractor shall furnish labor, materials, equipment, services, and specialized skills to perform work involved in the Project. The Work in the Bid is defined in the Project Drawings and Specifications and will generally include the following: Application of protective coatings to interior surfaces and paint to exterior surface, including surface preparation, handling of hazardous and nonhazardous materials/wastes, disinfection of interior surfaces, and modifications of miscellaneous structural items to bring the structures into compliance with current safety and health codes, standards and regulations and other work necessary to accomplish the approved end result of totally protected and usable structures, including attachments, accessories, and appurtenances. Removal of existing interior and exterior coating surfaces of above ground steel reservoirs. Additional equipment and accessories include but are not limited to new reservoir mixing units. Work will be limited to one reservoir at a time. Reservoirs are linked together via manifold but individual reservoirs can be isolated using valves. Mandatory Qualifications for Bidder and Designated Subcontractors: A Bid may be rejected as non-responsive if the Bid fails to document that Bidder meets the essential requirements for qualification. As part of the Bidder’s Statement of Qualifications, each Bid must establish that: Bidder satisfactorily completed at least three (3) prevailing wage public contracts in California; each comparable in scope and scale to this Project, within five (5) years prior to the Bid Deadline and with a dollar value in excess of the Bid submitted for this Project. In addition, if the Bidder intends to self-perform the “Painting and Decorating” and “Cathodic Protection Installation”, Bidder shall satisfy the mandatory qualifications described in the Specialty Contractor Statement of Qualifications applicable to such Work and submit the completed forms with the Bid. Subcontractors listed for the “Painting and Decorating” and “Cathodic Protection Installation” Work must satisfy the mandatory qualifications described in the Specialty Contractors’ Statements of Qualifications applicable to the Work to be performed by each Subcontractor and Bidder must submit the completed forms with the Bid. Other Bidding Information: 1. Contract Time: This Work must be completed within 320 calendar days from the date of commencement as established by the City’s written Notice to Proceed. 2. Amount of Liquidated Damages: $500.00 per calendar day. 3. Not in Use. 4. Not in Use. 5. Bidding Documents. Bids must be made on the Proposal Form contained herein. 6. Engineer’s Estimate. An Engineer’s Estimate of the cost of construction of this Work has Page 9 of 10 been prepared. Said estimate is in the range of $1,900,000.00 to $2,000,000.00. 7. Acceptance or Rejection of Bids. The City reserves the right to reject any and all bids, to award all or any individual part/item of the bid, and to waive any informalities, irregularities or technical defects in such bids and determine the lowest responsible bidder, whichever may be in the best interests of the City. No late bids will be accepted, nor will any oral, facsimile or electronic bids be accepted by the City. 8. Contractor’s License. At the time of the Bid Deadline and at all times during performance of the Work, including full completion of all corrective work during the Correction Period, Contractor must possess a California contractor’s license or licenses, current and active, of the classification required for the Work, in accordance with the provisions of Chapter 9, Division 3, Section 7000 et seq. of the Business and Professions Code. In compliance with Public Contract Code Section 3300, the City has determined that the Bidder must possess the following license(s): General Engineering Contractor A and/or Painting and Decorating Contractor C-33.In addition, if Bidder intends to self-perform “Painting and Decorating”, “Cathodic Protection Installation”, and “Mechanical” Work, Bidder must possess the following licenses: Painting and Decorating Contractor C-33,Electrical Contractor C-10, or General Engineering Contractor A as applicable to such self-performed Work. The Bidder will not receive a Contract award if at the time of submitting the bid, the Bidder is unlicensed, does not have all of the required licenses, or one or more of the licenses are not current and active. If the City discovers at the time of the Bid Deadline that Contractor is unlicensed, does not have all of the required licenses, or one or more of the licenses are not current and active, the City may reject the Bid, cancel the award, declare the Bid Bond as forfeited, keep the Bid Bond’s proceeds, and exercise any one or more of the remedies in the Contract Documents in addition to those provided by law. 9. Subcontractors’ Licenses and Listing. Bidders must list each Subcontractor whom the Bidder must disclose under Public Contract Code Section 4104 (Subcontractor Listing Law), and the Bidder must provide all of the Subcontractor information that Section 4104 requires (name, address, license number, and portion of the Work). An inadvertent error in the license number will not be considered nonresponsive if it is corrected within 24 hours after the bid opening. In addition, the City requires the Bidder to list the dollar value of each Subcontractor’s labor or services. The City reserves the right to review and disqualify any proposed Subcontractor. The City’s disqualification of a Subcontractor does not disqualify a Bidder. In such case, prior to and as a condition to award of the Contract, the successful Bidder shall substitute a properly licensed and qualified Subcontractor without an adjustment of the Bid Amount. At the time of the Bid Deadline and at all times during performance of the Work, each listed Subcontractor’s license must be current and active for the portion of the Work listed and shall hold all specialty certifications required for such Work. 10. Permits, Inspections, Plan Checks, Governmental Approvals, Utility Fees and Similar Authorizations. Unless specified otherwise, all Governmental Approvals and Utility Fees shall be obtained and paid for by Contractor and will be reimbursed based on Contractor’s actual direct cost without markup. 11. Bid Forms and Security: Each Bid must be made on the Bid Forms obtainable at the Public Utilities Department. Each Bid shall be accompanied by a cashier’s check or certified check drawn on a solvent bank, payable to “City of Vernon,” for an amount equal to ten percent (10%) of the Page 10 of 11 total maximum amount of the Bid. Alternatively, a satisfactory corporate surety Bid Bond for an amount equal to ten percent (10%) of the total maximum amount of the Bid may accompany the Bid. Said security shall serve as a guarantee that the successful Bidder will, within fifteen (15) calendar days after the date of the award of the contract, enter into a valid contract with the City for said Work in accordance with the Contract Documents. 12. Bid Irrevocability. Bids shall remain open and valid for ninety (90) calendar days after the Bid Deadline. 13. Substitution of Securities. Pursuant to California Public Contract Code Section 22300, substitution of securities for withheld funds is permitted in accordance therewith. 14. Prevailing Wages. This Project is a “public work” as defined in California Labor Code Section 1720. Contractor awarded this Contract and all Subcontractors of any tier shall not pay less than the minimum prevailing rate of per diem wages for each craft, classification, or type of worker needed to perform the Work. The Director of Industrial Relations of the State of California, pursuant to the California Labor Code, and the rates determined by the California Director of Industrial Relations are available online at www.dir.ca.gov/DLSR/PWD/. 15. Payroll Records. Pursuant to SB 854, Contractor and any Subcontractors shall furnish electronic certified payroll records directly to the Labor Commissioner (aka Division of Labor Standards Enforcement). 16. Registration with the Department of Industrial Relations (DIR). No contractor or subcontractor may be listed on a bid proposal for a public works project unless currently registered and qualified (including payment of any required fee) with the DIR pursuant to Labor Code section 1725.5 [with limited exceptions from this requirement for bid purposes only under Labor Code section 1771.1(a)]. No contractor or subcontractor may be awarded a contract for public work on a public works project unless currently registered and qualified (including payment of any required fee) with the DIR pursuant to Labor Code section 1725.5. This project is subject to compliance monitoring and enforcement by the DIR. Carlos Fandino City Administrator Dated: ___________ (Approved as to form by the City Attorney’s Office) Published: _______ INSTRUCTION TO BIDDERS Page 11 of 12 City of Vernon Instructions for Bidders Project: Rehabilitation of Reservoirs 2-1, 2-2, and 2-3 for the Public Utilities Department City personnel with whom prospective bidders will deal with are: Mark Aumentado, P.E., Vernon Public Utilities, 4305 Santa Fe Avenue, Vernon, CA 90058 (323) 583-8811 Ext. 309. Bid opening date and time: 2:00 p.m. on February 28, 2022 (“Bid Deadline”) Bids will be received and opened at the Office of the City Clerk, 4305 Santa Fe Avenue, Vernon, CA 90058 The bid must be received by the City Clerk prior to the time set for bid opening. A bid received by the City Clerk after the time set for the bid opening is a non-responsive bid and shall not be considered. GENERAL BID REQUIREMENTS To be considered, a bidder must strictly follow the format for bids in the specifications. Bids must be binding and firm. Any bids may be withdrawn before bid opening, but bids shall remain open and valid for ninety (90) calendar days after the Bid Deadline. 1.CONTRACTORS LICENSE The Bidder must possess a valid State of California Contractors License and must list type in the classification(s) specified in the Notice Inviting Bids at the time of the Bid Deadline and at all times during the performance of the Work, except as otherwise provided in California Business and Professions Code Section 7028.15. 2.INTERPRETATION OF BIDDING DOCUMENTS, SPECIFICATIONS AND ADDENDA A. If any Bidder contemplating submitting a Bid is in doubt as to the true meaning of any part of the Bidding Documents, or who finds discrepancies, errors or omissions therein or who finds variances in any of the Bidding Documents with applicable law, such Bidder shall at once submit a written request for an interpretation or correction thereof to the City’s representative identified in the Notice Inviting Bids, or other designated individual. All Bidders shall submit such written requests to City not less than ten (10) calendar days prior to the Bid Deadline. The person or entity submitting the request shall be responsible for its prompt delivery to City’s Contact Person identified in the Notice Inviting Bids. Any interpretation or correction will be made only by Addendum issued by the City and a copy of such Addendum will be delivered to all Interested Bidders of record. Page 12 of 13 Any Addenda so issued must be acknowledged in the Bid and the cost of performing Work described in the Addenda shall be included in the Bid. Bidder’s failure to acknowledge receipt of all Addenda may result in rejection of the Bid as nonresponsive. No person is authorized to render an oral interpretation or correction of any Bidding Documents and no Bidder may rely on any such oral interpretation or correction issued by the City. The City shall not be responsible for any other explanation or interpretation of the Drawings or Specifications, or for any oral instructions. City reserves the right to extend the Bid Deadline by issuing an Addendum to Interested Bidders no later than 72 hours prior to the Bid Deadline. Bidders shall use complete sets of Bidding Documents in preparing Bids; City shall not assume responsibility for errors or misinterpretations resulting from the use of incomplete sets of Bidding Documents. B. Copies of Addenda will be made available for inspection wherever Bidding Documents are on file for that purpose. Each Bidder shall ascertain prior to submitting a Bid that the Bidder has received all Addenda issued and the Bidder shall acknowledge their receipt in the Bid. 3.OBTAINING DRAWINGS AND DOCUMENTS Bidder may secure Bidding Documents only from the location specified in the Notice Inviting Bids. City will maintain a list of persons who obtained a copy of these Specifications (“Interested Bidders”). Only Interested Bidders will receive Addenda, if so issued. 4.BID FORMS – SUBMITTAL A. The Bids shall be made on the forms provided herein with all blank spaces properly filled in. B. The phraseology shall not be changed, and no additions shall be made to the items mentioned herein. Unauthorized conditions, exemptions, limitations, or provisions attached to a Bid will render it informal and may cause its rejection. All forms requiring specific information shall be completed with all applicable information for a Bid to be considered responsive. C. Include all Bid Forms, properly executed, and intact on forms provided. Enclose the Bid Forms in a sealed envelope; type or print on the envelope "BIDS for" followed by the title and Specification Number and the date and time of the Bid Deadline, and the Bidder's name and address. The envelope may be mailed, hand delivered, or delivered by courier or package delivery service. D. One Original Bid and two copies shall be hand delivered, delivered by courier or package delivery service to the City Clerk, City of Vernon, 4305 Santa Fe Avenue, Vernon, CA 90058. E. Bids received after the Bid Deadline or at any place other than the Office of the Page 13 of 14 City Clerk will not be considered. 5.BID FORMS – AUTHORIZED SIGNATURES A. The full name, business address, zip code, and business telephone number, with area code of the individual, partnership, joint venture, or corporation submitting the Bid shall be typewritten or legibly printed on the Bid Forms. The Bidder shall sign the form with his/her usual wet ink signature. B. Sole Proprietorship:An individual shall sign. C. Partnership (General or Limited):A partner shall sign for a partnership; the partner shall give the names and addresses of all partners. D. Corporation:An officer shall sign for a corporation. The corporate name must be attested by the corporate seal. The names and titles of the president and all officers of the corporation who are authorized to sign the Bid Forms must be listed in an authenticated Incumbency Certificate signed by the corporate secretary. A signature other than a corporate officer’s will be accepted only if an authenticated Incumbency Certificate is attached. E.Joint Venture:Bidders shall use the appropriate section(s) listed above in B-D, based on their applicable situation. 6.BID FORMS – SCHEDULE OF BID PRICES A. The Bidder shall include in his/her Bid price(s) any and all expense or costs that may be necessary to complete the project in accordance with the requirements of the Contract. The cost of all mobilization, preparatory work and operations for the multiple movements of personnel, equipment, supplies, and incidentals to the various project sites must be included in the various bid items, and no extra compensation will be paid to Contractor. B. The Bidder shall state for each item on the Schedule of Bid Prices form, in clearly legible figures, the Base Bid, the alternates, and the unit price and item total or lump sum, as the case may be, for which he/she proposes to supply labor, materials, and equipment and to perform the Work. Bids must not contain any erasures, interlineations, strike-throughs or other corrections unless the same are suitably authenticated by affixing in the margin immediately opposite such erasure or correction the initials of the person(s) signing the Bid. If any Bid, or portion thereof, is determined by the City to be illegible, ambiguous or inconsistent, City may reject such a Bid as being non-responsive. C. In the case of a unit price item, the amount set forth, as the item total shall be the product of the estimated quantity times the unit price Bid. In the event of a discrepancy between the unit price Bid and the item total, the unit price shall prevail; however, if the unit price is ambiguous, unintelligible, or uncertain for Page 14 of 15 any cause, or is omitted, or is the same amount as the entry for the item total, then the item total shall prevail and shall be divided by the estimated quantity for the item and the price thus obtained shall be the unit price. Where so indicated by the makeup of the Bid Form, sums shall be expressed in both words and figures, and in case of discrepancy between the two, the amount written in words shall govern. D. All requested Alternates, if any, shall be Bid. See the Schedule of Bid Prices for more information and the list of Bid Alternates, if any. If no change in the Base Bid is required, enter “No Change.” 7.BID SECURITY A. Each Bid shall be accompanied by cash or a cashier’s check or a certified check, drawn on a responsible bank doing business in the United States payable to the City, or a satisfactory Bid Bond in favor of the City executed by the Bidder as a principal and a California admitted surety company (as defined by California Code of Civil Procedure §§995.120 and 995.311) as surety (“Bid Security”). B. All bonds must be issued by a California admitted surety insurer with the minimum A.M Best Company Financial strength rating of “A:VII” or better. Bonds issued by a California admitted surety not listed on Treasury Circular 570 will be deemed accepted unless specifically rejected by the City. Bonds issued from admitted surety insurers not listed in Treasury Circular 570 must be accompanied by all documents enumerated in California Code of Civil Procedure Section 995.660. All such bonds must be accompanied by a power of attorney from the surety company authorizing the person executing the bond to sign on behalf of the company. If the bonds are executed outside the State of California, all copies of the bonds must be countersigned by a California representative of the surety. The signature of the person executing the bond on behalf of Surety must be acknowledged by a Notary Public as the signature of the person designated in the power of attorney. C. Bid Security shall be in an amount not less than 10% of the Base Bid. Any Bid submitted without Bid Security will be rejected as non-responsive. The Bid Security shall be given as a guarantee that the successful Bidder will execute the Contract and will provide the insurance, bonds and other required forms within fourteen (14) calendar days after award of the Contract. Bidders will be entitled to return of Bid Security except when a successful Bidder forfeits its Bid Security. A forfeit may occur, for example, if the successful Bidder withdraws its Bid prior to the expiration of ninety (90) calendar days after award of the Contract; attempts to withdraw its Bid when the requirements of Public Contract Code § 5101 et seq.are not met; or refuses or fails to execute the Contract and provide the required bonds, insurance or certificates within fourteen (14) calendar days after award of the Contract. In any one or more of these events, if City awards the Contract for the Work to the next lowest responsible Bidder, the amount of the original lowest Bidder’s security shall be applied to the Contract Price differential between the lowest Bid and the second lowest Bid. Any surplus will be returned to the original Page 15 of 16 lowest Bidder. If the City rejects all other Bids presented and re-advertises, the lowest Bidder’s Bid Security may be used to offset the City’s cost of re-advertising and receiving new Bids. In that case, the surplus if any, will be returned to the original lowest Bidder. D. The Bid Security shall be held for ninety (90) calendar days after the award of the Contract or until posting by the successful Bidder of the payment and performance bonds, proof of insurance, return of executed copies of the Contract and necessary certification(s), whichever first occurs, after which time the Bid Security will be returned to all Bidders. E. If a Bid Bond is to be submitted, Bidder shall use the form entitled "Bid Bond" contained in the Bidding Documents, which Bid Bond shall be properly executed and acknowledged by the Bidder and by a corporate surety authorized to transact such business in the State of California. F. Any alteration of said form of Bid Bond, or imperfection in the execution thereof, as herein required, will render it informal and may, at the option of the City, result in the rejection of the Bid under which the Bid Bond is submitted. 8.BIDDER'S AND SPECIALTY CONTRACTORS’ STATEMENTS OF QUALIFICATIONS A. Each Bidder shall be required to complete, execute and submit with its Bid, the form entitled "Bidder's Statement of Qualifications." In addition, if the Bidder intends to have “Painting and Decorating” and “Cathodic Protection Installation” Work, Bidder shall satisfy the mandatory qualifications described in the Specialty Contractors’ Statements of Qualifications applicable to such Work and submit the completed forms with the Bid. Subcontractors listed for the “Painting and Decorating” and “Cathodic Protection Installation” Work must satisfy the mandatory qualifications described in the Specialty Contractor or Subcontractor Statement of Qualifications applicable to the Work to be performed by each Subcontractor and Bidder must submit the completed forms with the Bid. Notwithstanding the provisions of Paragraph 22 herein, the Bidder’s Statement of Qualifications and the Specialty Contractor or Subcontractor Statement of Qualifications shall not be public records. All information required by a Bidder’s or Specialty Contractor Statement of Qualifications shall be completely and fully provided. If no information is to be filled in a blank space, then write "none." Any Bid not accompanied by a Bidder’s Statement of Qualifications and Specialty Contractor or Subcontractor Statement of Qualifications form completed with all information required may render the Bid non-responsive. If the City determines that any information provided by a Bidder in the Bidder’s or Specialty Contractors’ Statement of Qualifications is false or misleading, or is incomplete so as to be false or misleading, the City may reject the Bid submitted by such Bidder as being non- responsive. Page 16 of 17 B. A responsible Bidder is a Bidder who has demonstrated the attribute of trustworthiness, as well as quality, fitness, capacity and experience to satisfactorily perform fully the requirements of the contract documents. In selecting the lowest responsible Bidder, consideration will be given not only to the Bidder’s financial standing but also to the general competency of the Bidder for the performance of the work covered by the Bid including, but not limited to, the experience of the Bidder in construction of public buildings for public agencies. By submitting a Bid, each Bidder agrees that the City, in determining the successful Bidder and its eligibility for the award, may consider the Bidder’s experience with similar types of construction projects and facilities, conduct and performance under other contracts, financial condition, reputation in the industry, and other factors which could affect the Bidder’s performance of the work. 9.DESIGNATION OF SUBCONTRACTORS A. Subcontractor Listing. On the Designation of Subcontractors form, the Bidder shall list each Subcontractor whom the Bidder must disclose under the Subletting and Subcontracting Fair Practice Act, Public Contract Code Section 4104. The Bidder shall provide: each Subcontractor’s name, the trade and type of work that the Subcontractor will perform, the location (address) of the Subcontractor’s place of business, each Subcontractor’s license number, and the dollar value of each Subcontractor’s labor or services. If additive Alternate Bid Items are included in the Bidding Documents, the Bidder shall identify each Subcontractor performing additive Alternate Bid Items, when such Work or the combination of base Contract Work and Alternate Work exceeds one-half of one percent of the total Bid Amount. B. Subcontractors’ Licenses. At the time of the Bid Deadline and at all times during performance of the Work, each listed Subcontractor shall possess a current and active California Contractor’s license appropriate for the portion of the Work listed for such Subcontractor, and hold all specialty certifications required for such Work. C. Disqualification of a Subcontractor. The City has the right to review the suitability and qualifications of any Subcontractor proposed by the Bidder. As part of this review, the City may request a Bidder to submit additional information about one or more of the listed Subcontractors including, but not limited to a statement detailing the Subcontractor’s experience with pertinent information as to similar projects and other evidence of the Subcontractor’s qualifications. If requested, the Bidder shall provide the information to the City within the time specified in the City’s written request. After due investigation, if the City has a reasonable objection to any proposed Subcontractor, the City may, before giving the notice of award, require the apparent successful Bidder to submit an acceptable substitute. The City’s disqualification of a Subcontractor does not disqualify a Bidder. However, prior to and as a condition to award of the Contract, the successful Bidder shall substitute a properly licensed and qualified Subcontractor without an adjustment of the Bid Price. Page 17 of 18 D. Work of Subcontractors. The organization or arrangement of the Specifications and Drawings do not limit the extent of the Work for the Contract Documents. Accordingly, all Bidders are encouraged to disseminate all of the Specifications, Drawings and other Contract Documents to all persons or entities submitting sub- bids to the Bidder. The omission of any portion or item of Work from the Bid or from sub-bids, which is reasonably inferable from the Contract Documents, will not be a basis for adjustment of the Contract Price or the Contract Time. E. Ineligible Subcontractors. The successful Bidder is prohibited from performing Work on the Project with any Subcontractor who is ineligible to perform work on a public works project pursuant to California Labor Code Sections 1777.1 or 1777.7. In submitting its Bid, the Bidder certifies that it has investigated the eligibility of each and every listed Subcontractor and has determined that none is ineligible to perform work pursuant to the above code provisions. 10.CONTRACTOR’S AFFIDAVIT OF NON-COLLUSION An Affidavit of Non-Collusion in the form provided by the City shall be signed under penalty of perjury, certifying that the Bid is not the result of and has not been influenced by collusion. Bidder shall submit this form with its Bid. Any Bid made without such affidavit, or believed to be made in violation of the requirements set forth in the affidavit form, may be rejected. 11.INSURANCE REQUIREMENTS The Bidder shall submit to its insurance company or insurance agent the Insurance Requirements in this Specification and the Contract Documents. The insurance company’s underwriter or agent must complete the Insurance Requirements documentation which states that the insurer’s underwriter or agent will furnish the City with the required insurance documents within fourteen (14) days after the Bidder’s having been notified of the Contract’s award. The Bidder shall submit this form with its Bid. Any Bid made without this statement, or made with an incomplete statement, may be rejected. 12.EXAMINATION OF DRAWINGS, SPECIFICATIONS, AND SITE OF WORK A. The Bidder shall examine carefully the site of the Work contemplated and the Drawings and Specifications. The submission of a Bid will be conclusive evidence that the Bidder has investigated and is satisfied as to the conditions to be encountered, as to the character, quality, and quantities of Work to be performed and materials to be furnished, the difficulties to be encountered, and to the requirements of the Drawings, Specifications, and other Contract Documents. The Bidder shall ascertain the locations of the existing utility services, and other underground facilities, and provide for carrying out its operations so as to cause the minimum possible inconvenience to the occupants of properties along any streets affected. All Work and costs involved in the safeguarding of the properties of others shall be at the expense of the Bidder to whom the Contract may be awarded. Page 18 of 19 B. The Bidder hereby certifies that it has examined the local conditions, has read each and every clause of the Contract Documents, and that it has included all costs necessary to complete the specified Work in its Bid prices, and the Bidder agrees that if it is awarded the Contract, it will make no claim against the City based upon ignorance of local conditions or misunderstanding of any of the provisions of the Contract. Should the conditions turn out otherwise than the Bidder anticipated, the Bidder agrees to assume all risks incident thereto. 13.PRICES AND PAYMENTS Approximate quantities listed in the Schedule of Bid Prices are estimates given for comparing Bids, and no claim shall be made against the City for excess or deficiency therein, actual or relative. Payment at the prices agreed upon will be in full for the completed Work and will cover materials, supplies, labor, tools, equipment, and all other expenditures incident to a satisfactory compliance with the Contract, subject to all applicable provisions in the Contract and General Conditions. 14.PERMIT FEES (Optional) If provided in the General Conditions, Contractor shall be reimbursed for the actual direct cost of all Permit Fees, as defined in Paragraph 1.01 and addressed in 1.03 of the General Conditions. Bidder shall exclude the cost of Permit Fees from Bidder’s Base Bid sum; Base Bid sum shall include the cost of administration and coordination for all Governmental Approvals and Utility Fees. 15.SUBSTITUTIONS No requests for substitution of any material, device, product, equipment, fixture, form, or type of construction shall be considered by City prior to award of the Contract. Bidders shall submit all requests for substitution and substantiating data, within fourteen (14) calendar days from the date of the Notice to Proceed. Bidder shall refer to the appropriate provisions of the General Conditions for additional information regarding substitutions. Authorization of a substitution is solely within the discretion of the City. 16.RETURN OF IMPROPER BIDS Bids submitted after the Bid Deadline are non-responsive and shall be returned to the Bidder unopened. Oral, telephonic, telegraphic, facsimile or electronically transmitted Page 19 of 20 Bids shall not be considered unless the Notice Inviting Bids expressly permits such means of transmittal. 17.WITHDRAWAL OF BIDS Bidder may withdraw its Bid either personally or by written request any time prior to the scheduled Bid Deadline by notice to the City’s Contact Person designated in the Notice Inviting Bids. If such notice is written, it shall be signed by the Bidder and shall be date- stamped and time-stamped by the City upon receipt. Withdrawn Bids may be resubmitted before the Bid Deadline provided that they are in full conformance with these Instructions to Bidders. Once submitted, all Bids are irrevocable, except as otherwise provided by law. Requests for withdrawal of Bids after the Bid Deadline shall be made only in accordance with California Public Contract Code § 5100, et seq.Bidder agrees by submitting a Bid that such Bid shall remain open, is irrevocable, and may not be modified, withdrawn, or cancelled for a period of ninety (90) days after award of the Contract. 18.OPENING AND EVALUATION OF BIDS A.Bid Opening and Tabulation. The Bids shall be opened and read in public after the Bid Deadline has expired at the time and location listed in the Notice Inviting Bids. A tabulation of all Bids received will be available for public inspection at the Office of the Public Utilities Department, 4305 Santa Fe Avenue, Vernon, CA 90058 during regular business hours for a period of not less than thirty (30) calendar days following the Bid Deadline. The City reserves the right to accept or reject any or all Bids and be the sole judge regarding the suitability of the products, services or supplies offered; and/or to waive any irregularities or informalities in any Bids or in the bidding process. The City further reserves the right to purchase all or fewer than all items or quantities of each item listed in the Bidding Documents. The award of the Contract, if made by the City, shall be to the lowest responsive and responsible Bidder. If Bid Alternate Items are called for, the lowest Bid shall be determined according to Paragraph 20 below. B.Evaluation of Bids. 1. Mandatory Qualifications. A Bid shall be rejected as non-responsive if the Bidder fails to document in the Bid that Bidder meets the essential requirements for qualification described in the Notice Inviting Bids. As part of the Bidder’s Statement of Qualifications each Bidder must establish that it, as the current entity: (1) has successfully completed at least three (3) similar projects involving similar work within the last five (5) years with a cost equal to or in excess of the Bidder’s Bid; and (2) has successfully completed at least three (3) public works projects. The City’s disqualification of a Subcontractor listed for the “Painting and Decorating” and “Cathodic Protection Installation” Work does not disqualify a Bidder. However, prior to and as a condition to award of the Contract, the successful Bidder shall substitute a properly licensed and qualified Subcontractor — without an adjustment of the Bid Price. Page 20 of 21 2. Responsive Bid. A responsive Bid is a Bid which conforms, in all material respects, to the Bidding Requirements and Contract Documents. 3. Responsible Bidder. A responsible Bidder is a Bidder who has demonstrated the attribute of trustworthiness, as well as quality, fitness, capacity and experience to satisfactorily perform fully the requirements of the Contract Documents. 4. Competency of Bidders. In selecting the lowest responsible Bidder, consideration will be given not only to the financial standing but also to the general competency of the Bidder for the performance of the Work covered by the Bid including, but not limited to, the experience of the Bidder in construction of public works for public agencies. By submitting a Bid, each Bidder agrees that the City, in determining the successful Bidder and its eligibility for the award, may consider the Bidder’s experience with similar types of construction projects and facilities, conduct and performance under other contracts, financial condition, reputation in the industry, safety record and protocols and other factors which could affect the Bidder’s performance of the Work. 19.AWARD OF CONTRACT The City reserves the right to reject any or all Bids and to waive any or all information or technical defects, as the interest of the City may require. Award of Contract or rejection of Bids will be made by the City within ninety (90) calendar days following the Bid Opening. 20.BASIS OF AWARD A. A Contract will be awarded to the lowest responsive and responsible Bidder meeting all requirements set forth in these Bidding Documents. The City will award the Contract based on the lowest Base Bid including all alternates. B. City reserves the right in its sole discretion to select any, all, or none of the Bid Alternates at the time of award of the Contract, regardless of whether such Bid Alternates were used in the analysis to determine the lowest Bid. 21.EXECUTION OF CONTRACT Within fourteen (14) calendar days after being notified by City that it has been awarded the Contract, Contractor shall deliver to the City the following documents: Page 21 of 22 A. Two (2) copies of the Contract in the form included herein, properly executed by Contractor and, if Contractor is a corporation, evidence of its corporate existence and that the persons signing the Contract are authorized to do so. All signatures must be notarized. B. Properly executed copies of the (a) Performance Bond, (b) Labor and Material (Payment) Bond and (c) Maintenance Bond in accordance with the requirements set forth in Article 13 of the General Conditions and in the form shown on Exhibits A1, A2 and A3 attached thereto. All signatures must be notarized. C. Properly executed policies of all of the following: (a) the Commercial General Liability Insurance, (b) the Automotive Liability Insurance, and (c) Professional Liability, if required, and (e) the corresponding endorsements for each policy in accordance with the requirements set forth in Article 12 of the General Conditions. In the event that the fourteenth calendar day falls on Saturday, Sunday, a legal holiday for the State of California, or on days when City Hall is closed, the aforesaid documents shall be delivered by the following working day. After receipt of said documents within said time period or any extension thereof granted by the City, the City shall execute the Contract and return one (1) of said two (2) copies to Contractor for its files. 22.PUBLIC RECORDS City seeks to conduct its business openly. Except as set forth in paragraph 8.A., uponopening, all Bids shall become a matter of public record and shall be regarded as public, with the exception of those elements of each Bid that are identified by the Bidder and plainly marked as “trade secret,” “confidential,” or “proprietary,” including any Statement of Qualifications and financial statements to be submitted by Bidders. Each element of a Bid which a Bidder desires not to be considered a public record must be clearly marked as set forth above, and any blanket statement (i.e. regarding entire pages, documents, or other, non-specific designations) shall not be sufficient and shall not bind the City in any way whatsoever. If City receives a request from a third party to make a Bid available for inspection and copying, the City will notify the Bidder of the request. If a Bidder instructs the City that the information is not to be released, City will withhold the information, provided, the Bidder expeditiously seeks a protective order from a court of competent jurisdiction to prevent such release. If disclosure is required under the California Public Records Act or otherwise by law (despite the Bidder’s request for confidentiality), the City shall not in any way be liable or responsible for the disclosure of any such records or part thereof. Bidder shall indemnify, defend (including Bidder’s providing and paying for legal counsel for City), and hold harmless City, its officers, agents, employees, and representatives from and against all liability, claims, suits, demands, damages, fines, penalties, costs, or expenses Page 22 of 23 arising out of or alleging City’s refusal to publicly disclose one or more records that Bidder identifies as protectable, or asserts is protectable. 23.PREVAILING WAGE RATES AND EMPLOYMENT OF APPRENTICES A. Prevailing Wage Rates. The Bidder and all Subcontractors shall utilize the relevant prevailing wage rate determinations in effect on the first advertisement date of the Notice Calling for Bids in preparing the Bid Proposal and all component price quotations, provided, however, that when Davis Bacon wage rates apply, such rates are subject to increase by written notice, issued by Addendum not less than 10 calendar days before the Bid Deadline. Pursuant to California Labor Code Section 1770 et seq., the Director of the Department of Industrial Relations of the State of California and the United States Secretary of Labor have determined the general prevailing wage rates in the locality in which the Work is to be performed. Said rate schedules are available on the Internet at www.dir.ca.gov/DLSR/PWD/. The wage rate for any classification not listed, but which may be required to execute the Work, shall be commensurate and in accord with specified rates for similar or comparable classifications for those performing similar or comparable duties. To comply with California Labor Code Section 1773.2, Contractor shall post, at appropriate and conspicuous locations on the job site, a schedule showing all applicable prevailing wage rates and shall also comply with the requirements of California Labor Code Sections 1773 et seq. B. Apprenticeship Committee Contract Award Information. Pursuant to California Labor Code § 1777.5 and Title 8 of the California Code of Regulations § 230, Contractor and Subcontractors of any tier who are not already approved to train by an apprenticeship program sponsor shall, within ten (10) calendar days of signing the Contract or subcontract, as applicable, but in any event prior to the first day in which Contractor or Subcontractor has workers employed on the Project, submit the Public Works Contract Award Information form (DAS Form 140) to the appropriate local apprenticeship committees whose geographic area of operation include the area of the Project and who can supply apprentices to the Project. City reserves the right to require Contractors and Subcontractors to submit a copy of said forms to the City. C. Statement of Employer Fringe Benefit Payments. Within five (5) calendar days of signing the Contract or subcontract, as applicable, the Statement of Employer Payments (DLSE Form PW 26) shall be completed for each Contractor and Subcontractor of any tier who pays benefits to a third party trust, plan or fund for health and welfare benefits, vacation funds or makes pension contributions. The form must contain, for each worker classification, the fund, plan or trust name, address, administrator, the amount per hour contributed and the frequency of contributions. Training fund contributions shall also be reported in this form. City reserves the right to require Contractors and Subcontractors to submit a copy of said forms to the City. Page 23 of 24 D. Notice to Subcontractors. Bidders shall notify all potential Subcontractors submitting price quotations for portions of the Work of the requirements concerning payment of prevailing wage rates, payroll records, hours of Work, and employment of apprentices. 24.REGISTRATION WITH THE DEPARTMENT OF INDUSTRIAL RELATIONS (DIR) No contractor or subcontractor may be listed on a bid proposal for a public works project unless currently registered and qualified (including payment of any required fee) with the DIR pursuant to Labor Code section 1725.5 [with limited exceptions from this requirement for bid purposes only under Labor Code section 1771.1(a)]. No contractor or subcontractor may be awarded a contract for public work on a public works project unless currently registered and qualified (including payment of any required fee) with the DIR pursuant to Labor Code section 1725.5. This project is subject to compliance monitoring and enforcement by the DIR. 25.SPECIAL CITY REQUIREMENTS Special City forms and their instructions are an integral part of these specifications and failure to submit same may be grounds, in the sole discretion of the City, for rejection of any Bidder. A. Prevailing Wage Where Applicable. Upon request, certified payroll documents shall be provided to the City. B. Equal Employment Opportunity in Contracting. The City of Vernon is committed to a policy of equal opportunity in contracting. Qualified firms including small businesses and businesses owned by women, minorities, and disabled persons are encouraged to submit bids or proposals. Contractors expressly agree to comply with the City's ordinances and regulations regarding Equal Opportunity Employment as well as regulations that may be mandated by the source of the funds supporting the Contract. Contractor certifies and represents that during the performance of this Contract, it and any other parties with whom it may subcontract shall adhere to equal employment opportunity practices to assure that applicants, employees and recipients of service are treated equally and are not discriminated against because of their age not discriminated against because of their race, religion, religious belief, color, national origin, citizenship, ancestry, disability, sex, age, medical condition, pregnancy, sexual orientation or marital status.Contractor certifies that it will not maintain any segregated facilities. Contractor shall comply with all applicable Federal and California laws including, but not limited to, the California Fair Employment and Housing Act (California Government Code Section 12900, et seq.), California Labor Code Section 1735, and The Americans with Disabilities Act of 1990 (42 U.S.C. 12101 et seq.). Contractor shall require like compliance by all Subcontractors employed on the Page 24 of 25 Work. 26.BID PROTEST PROCEDURES A. Any Bidder submitting a Bid directly to the City and eligible for award of the Contract may file a protest if the Bidder complies with all of the following requirements and conditions: 1. The Bid protest is in writing; 2. A protest based upon alleged defects or improprieties in the Contract Documents is filed with the City prior to the Bid Deadline; 3. All other protests are to be filed and received by the City no more than five (5) calendar days following the City’s notice of intent to award the Contract; and 4. The written Bid protest sets forth, in detail, all grounds for the Bid protest, including without limitation: all facts, supporting documentation, legal authorities, and argument in support of the grounds for the Bid protest. All factual contentions must be supported by competent, admissible, and credible evidence. B. Any matters not set forth in the written Bid protest will be deemed waived. Any Bid protest not conforming to the foregoing requirements and conditions will be rejected by the City as invalid. C. Bid Dispute Indemnification. In the event of a Bid dispute based upon the Bidder’s submission of this Bid and the City acceptance of same, the Bidder shall indemnify, defend (with counsel acceptable to City), and hold harmless the City, its City Council members, employees, and agents from liability, claims, demands, damages, and costs arising therefrom if such dispute or action arises solely upon the award of a Contract in compliance with federal, state, and local laws. [END OF DOCUMENT] BID FORMS DESIGNATION OF SUBCONTRACTORS ! "!#$ $ % ! ! & ' ' () * +(*, )" "!(*- ./0/! 1'! '&' )) &'&2 $ ) #$ ' #) 3$ 4/50060 ! ' 7054/8$86' ) 2 $ % ! ! ' ! ) " ' ! #$ "! ) 0$0$//$'!9 +9,2 $ ! : ' ! ;;& 76<0$0/ "! #$ 1 = >'' ) ' ' !' ) ) - +-,' ! '' +%?,/;$ >3) /8/ 3$/;5/ ) ! +,"!+' , @@+,' !A' ! - +-,$B !! A ! " "! ) ) $!! ! ' ) " #$ +,$ ' !A !> 3$-/686"!! '7054/8$86' ) ' ! C - +C-,-$ ! ! ) ' ' " ) 9 % A )+9%,' !C- $C! ' ! )! "!!!'D & ) $C! '!9%+ , &$E! ' !C-" $ C! 9% ! ! ! ! ! A ) ! ! ' ' ! A' $C! ' ) !; !$ ! "!! =" !! !!!! "!" ! "' ' ! !&A$ ) #) 3$ 4/50060 ' ! ) ' $ " ;A'' )' !'7054/8$86$ # '' )' ! !' 76<0$0/! !! '! ' ) ) ' ' ) '! ) ) ! >! ' /! ! 8$ #! '! '-9% " A $ ! ! & & ' '!9%= ! ) ' ! "! '' -! ! $ F " )"!' 1 ) &$ C! "!#)3$4/500607054/8$86 ' )!9B- > $C!' ! ! ' ) ) ! > 76<0$0/$''' ' ! ) )!9B - > 3$$6/6$0$ /$#$;#)3$4/50060 $#$; !> 3$-/686 Purchase Order Purchase Order #MGS21969 Colorado Energy - Malburg Generating Station Revision Number 1 Supplier ABB Inc. All previous revisions are no longer valid.Address P.O. Box 88868 Chicago, IL 60695-1868 Order Date May 11, 2021 P.O. Due Date May 11, 2021 Telephone Fax No. Delivery Address Colorado Energy Management, LLC Malburg Generating Station 4963 Soto Street Vernon, CA 90058 Invoice Address Colorado Energy Management, LLC Malburg Generating Station 4963 Soto Street Vernon, CA 90058 323-476-3620 Fax: E-Mail Address Line Part Number Qty (UOP)UOM Price Tax Line Total 10 N13156 | (3AXD50000432073) Description: ACS880R-307S6-2450A-7 2 EA 77,260.02 15,838.3 170,358.34 20 N13157 | (3AXD50000432073) Description: ACS880R-107F6-2300A-7 2 EA 77,260.02 15,838.3 170,358.34 30 N13158 | (3AXD50000318865) Description: Connection Unit Kit for Ethernet tool network 2 EA 969.98 198.85 2,138.81 Total 31,875.45 342,855.49 Line Qty (UOP)Price Line Total 40 ACS607 Retrofit Kit Proposal 3 Field Service Labor 1 70,087.00 70,087.00 Total 70,087.00 Purchase Order Terms Ship Via Payment Terms NET30 Net 30 Days Freight Terms PPA Prepaid and Add Freight FOB Point Grand Total $412,942.49 ABB Inc. Offer Number: CQ525816 A ACS607 Retrofit Kit Hardware and Installation ! " #$#$% &' $ ( ' ) ) * + $ ,-. #$#$ ) # /0 ) ' ! " ' 1 2$ )) ' ) ',." " $ ' ! " 3!"4 0 ) ' #$#$1' 50' 0 5' $ ' & 6 3!&64 ' ' 0 '0 0 ) ) 0 ' '0 0 ' 0 #$#$$2 )!&67 8 9) )) 0 '% &' ' !"'5 $ )8 ) ' " 8 ) 0 ' " 7 5 ) $ :' ' !&67 ' )) ' $ 9) 5) ' ' 5' ' 0 $ 0 8; 0 0 0 0 ! 0 5'0 ) ) $ 5' ' ' ) ' < 3<4 )) '" = 0 <$ ' !&6 )) 0 ) ) ) 0$ () 0 !" #$#$ % &' 5 ) 5 35 4 >( ) 5''8 ' ) 8 0 ) ; '' ) ' 0 '" 5' 0 ' 5 8 0 ) ' ) ' 9 $) )' ) ' ' ') 5''" " 5'# )'9 $? '" )& ' ' 0 ) 0 ' " ) /0 ' 6 %9 ' 5 ) ) 8 ' )'6 )' 9 $ ' % &' 5!&6 )) ' ) 0$ ' ) 5'' $ ,$* + $,-. ORDINANCE NO. 1279 AN ORDINANCE OF THE CITY COUNCIL OF THE CITY OF VERNON AMENDING SECTION 3.32.250 OF TITLE 3 REVENUE AND FINANCE OF THE VERNON MUNICIPAL CODE REGARDING EMERGENCY PURCHASES SECTION 1. Recitals. A. The City of Vernon (City) is a municipal corporation and a chartered city of the State of California organized and existing under its Charter and the Constitution of the State of California. B. On December 18, 2012, the City Council adopted Ordinance No. 1200, as amended by Ordinance No. 1221 on May 20, 2014, amending Article IV of Chapter 2 of the Vernon Municipal Code, to enact the “Competitive Bidding and Purchasing Ordinance”. C. The City Council desires to amend Section 3.32.250 of the Vernon Municipal Code regarding emergency purchases to enable the City Administrator to authorize emergency work to restore or prevent an imminent and unforeseen failure of utility service. THE CITY COUNCIL OF THE CITY OF VERNON HEREBY ORDAINS: SECTION 2. The City Council of the City of Vernon hereby finds and determines that the above recitals are true and correct and are a substantial part of this ordinance. SECTION 3. Section 3.32.250 of Title 3 of the Vernon Municipal Code is hereby amended to read as follows: “3.32.250 Emergency purchases. In case of an actual emergency which requires immediate purchase of supplies, equipment, or services to address an immediate and unforeseen risk to health, life, property or the environment, or for emergency work to restore or prevent an imminent and unforeseen failure of utility service, the City Administrator may secure, without competitive bidding, at the lowest obtainable price, any supplies, equipment, or services regardless of the amount of the expenditure. A full report of the circumstances of any such emergency purchase shall be filed with the City Council within 30 days of the expenditure.” SECTION 4. Any provision of the Vernon Municipal Code or appendices thereto inconsistent with the provisions of this Ordinance, to the extent of such inconsistencies and no further, is repealed or modified to that extent necessary to affect the provisions of this Ordinance. Ordinance No. 1279 Page 2 of 2 _______________________ SECTION 5. If any section, subsection, paragraph, sentence, clause, phrase, or portion thereof, of this Ordinance is declared by a court of competent jurisdiction to be unconstitutional or otherwise invalid, such decision shall not affect the validity of the remaining portions of this Ordinance. The City Council hereby declares that it would have adopted this Ordinance, and each section, subsection, paragraph, sentence, clause, phrase, or portion thereof, irrespective of the fact that any one or more sections, subsections, paragraphs, sentences, clauses, phrases, or portions thereof, be declared invalid or unconstitutional. To this end, the provisions of this Ordinance are declared to be severable. SECTION 6. The City Clerk shall certify the adoption and publish this ordinance as required by law. APPROVED AND ADOPTED this __ day of _____, 2022. _____________________________ MELISSA YBARRA, Mayor ATTEST: LISA POPE, City Clerk (seal) APPROVED AS TO FORM: ___________________________ ZAYNAH N. MOUSSA, Interim City Attorney