Loading...
The URL can be used to link to this page
Your browser does not support the video tag.
20240319 Regular City Council Meeting - Packet
Regular City Council Meeting Agenda March 19, 2024 Page 1 of 5 Agenda City of Vernon Regular City Council Meeting Tuesday, March 19, 2024, 9:00 AM City Hall, Council Chamber 4305 Santa Fe Avenue, Vernon, California Crystal Larios, Mayor Judith Merlo, Mayor Pro Tem Melissa Ybarra, Council Member Leticia Lopez, Council Member Jesus Rivera, Council Member The public is encouraged to view the agenda and meeting at CityofVernon.org/publicmeetings. You may address the Council in the Council Chambers, via mail or email to PublicComment@cityofvernon.org, include the meeting date and item number in the subject line (mail and/or email must be received at least two hours prior to the start of the meeting). CALL TO ORDER FLAG SALUTE ROLL CALL APPROVAL OF AGENDA PUBLIC COMMENT At this time the public is encouraged to address the City Council on any matter that is within the subject matter jurisdiction of the City Council. The public will also be given a chance to comment on matters which are on the posted agenda during City Council deliberation on those specific matters. PRESENTATIONS 1. Vernon CommUNITY Fund Grant Committee Awards and Direct Service Grantee Certificates for Fiscal Year (FY) 2023-24 Recommendation: A. Receive and file the report; and B. Present Certificates to FY 2023-24 Direct Service Grant Recipients. Regular City Council Meeting Agenda March 19, 2024 Page 2 of 5 2. Employee Service Pin Awards Recommendation: Recognize February 2024 Employee Service Pin Award Recipient. PUBLIC HEARINGS 3. Warehouse Development Agreement for 5764 Alcoa Avenue Recommendation: A. Find that the ordinance is not subject to CEQA as the adoption of the ordinance is not a “project” pursuant to CEQA Guidelines Section 15302, because the proposed development consists of the replacement and reconstruction of existing facilities where the new structure will be located on the same site as the structures being replaced and will have substantially the same size, purpose, and capacity as the structures being replaced; B. Introduce and conduct first reading of Ordinance No. 1299 approving Warehouse Development Agreement No.WH-001 for Assessor Parcel Numbers 6310-005-003, 6310- 005-004, 6310-005-009, and 6310-005-010 between the City of Vernon and; and GPT Vernon Owner, LP; and C. Direct staff to schedule second reading and adoption for the April 2, 2024 City Council meeting. CONSENT CALENDAR All matters listed on the Consent Calendar are to be approved with one motion. Items may be removed from the Consent Calendar for individual consideration. Removed items will be considered immediately following the Consent Calendar. 4. Meeting Minutes Recommendation: Approve the March 5, 2024 Regular City Council Meeting Minutes 5. Police Department Activity Report Recommendation: Receive and file the January 2024 Police Department Activity Report 6. Amendments No. 3 and No. 4 to the Services Agreement with Tyler Technologies Recommendation: A. Approve and authorize the City Administrator to execute Amendment No. 3 to the Services Agreement with Tyler Technologies, Inc., in substantially the same form as submitted, for Enterprise Resource Planning Software as a Service Hosting and Support for a total amount not-to-exceed $1,271,211.34, for a 3-year term; and B. Approve and authorize the City Administrator to execute Amendment No. 4 to the Services Agreement with Tyler Technologies, Inc., in substantially the same form as submitted, to reflect the addition and removal of various modules from the current Agreement, for a total amount not-to-exceed $568,770.22, for the 3-year term. 7. Fire Department Activity Report Recommendation: Receive and file the January 2024 Fire Department Activity Report. Regular City Council Meeting Agenda March 19, 2024 Page 3 of 5 8. Operating Account Warrant Register Recommendation: Approve Operating Account Warrant Register No. 126, for the period of February 4 through February 17, 2024, totaling $8,774,682.53 and consisting of ratification of electronic payments totaling $8,123,746.31 and ratification of the issuance of early checks totaling $650,936.22. 9. License Agreement with Southern California Edison Company Recommendation: A. Find that the proposed action is categorically exempt from California Environmental Quality Act (CEQA) review, in accordance with CEQA Guidelines Section 15301, because the proposed action involves the leasing of an existing public utility service facility and involves negligible or no expansion of an existing use; and B. Approve and authorize the City Administrator to execute a License Agreement with the Southern California Edison Company (SCE), in substantially the same form as submitted, for the use of land at the Laguna Bell Substation for a total amount not-to-exceed $2,208.21, for a five-year term. NEW BUSINESS 10. Contract with Western Allied Corporation for City Hall HVAC System Improvements - Contract No. 20240089 Recommendation: A. Find that the proposed action is categorically exempt from California Environmental Quality Act (CEQA) review, in accordance with CEQA Guidelines § 15301, because the project consists of the maintenance and minor alteration of the existing City Hall HVAC controls and system and involves negligible or no expansion of an existing use; B. Accept the bid proposal from Western Allied Corporation as the lowest responsive and responsible bidder and reject all other bids; C. Approve and authorize the City Administrator to execute a contract with Western Allied Corporation, in substantially the same form as submitted, for the City Hall HVAC System Improvements Project in an amount not-to-exceed $429,245; and D. Authorize a contingency amount of ten percent (10%) or $42,924.50 in the event of an unexpected changed condition in the project and grant authority to the City Administrator to issue change orders for an amount up to the contingency amount, if necessary. 11. City Council Appointments to Outside Agencies Recommendation: Appoint the City’s representative and alternate to the Gateway Cities Council of Governments. 12. Appointment of Deborah A. Harrington as Interim City Clerk Recommendation: Adopt Resolution No. 2024-03 appointing Deborah A. Harrington to serve as Interim City Clerk of the City of Vernon and approving and authorizing the execution of a related at-will employment agreement. Regular City Council Meeting Agenda March 19, 2024 Page 4 of 5 ORAL REPORTS 13. City Administrator Reports on Activities and Other Announcements 14. Council Reports on Activities (including AB 1234), Announcements, or Directives to Staff CLOSED SESSION 15. Conference with Legal Counsel – Existing Litigation Government Code Section 54956.9(d)(1) City of Whittier, et al. v. Los Angeles Superior Court, et al. Los Angeles Superior Court Case No. 23STCP03579 Orange County Superior Court Case No. 23STVP03579 ADJOURNMENT On March 14, 2024, the foregoing agenda was posted in accordance with the applicable legal requirements. Regular and Adjourned Regular meeting agendas may be amended up to 72 hours and Special meeting agendas may be amended up to 24 hours in advance of the meeting. Regular City Council Meeting Agenda March 19, 2024 Page 5 of 5 Guide to City Council Proceedings Meetings of the City Council are held the first and third Tuesday of each month at 9:00 a.m. and are conducted in accordance with Rosenberg's Rules of Order (Vernon Municipal Code Section 2.04.020). Copies of all agenda items and back-up materials are available for review in the City Clerk Department, Vernon City Hall, 4305 Santa Fe Avenue, Vernon, California, and are available for public inspection during regular business hours, Monday through Thursday, 7:00 a.m. to 5:30 p.m. Agenda reports may be reviewed on the City's website at www.cityofvernon.org or copies may be purchased for $0.10 per page. Disability-related services are available to enable persons with a disability to participate in this meeting, consistent with the Americans with Disabilities Act (ADA). In compliance with ADA, if you need special assistance, please contact the City Clerk department at CityClerk@cityofvernon.org or (323) 583-8811 at least 48 hours prior to the meeting to assure arrangements can be made. The Public Comment portion of the agenda is for members of the public to present items, which are not listed on the agenda but are within the subject matter jurisdiction of the City Council. The City Council cannot take action on any item that is not on the agenda but matters raised under Public Comment may be referred to staff or scheduled on a future agenda. Comments are limited to three minutes per speaker unless a different time limit is announced. Speaker slips are available at the entrance to the Council Chamber. Public Hearings are legally noticed hearings. For hearings involving zoning matters, the applicant and appellant will be given 15 minutes to present their position to the City Council. Time may be set aside for rebuttal. All other testimony shall follow the rules as set for under Public Comment. If you challenge any City action in court, you may be limited to raising only those issues you or someone else raised during the public hearing, or in written correspondence delivered to the City Clerk at or prior to the public hearing. Consent Calendar items may be approved by a single motion. If a Council Member or the public wishes to discuss an item, it may be removed from the calendar for individual consideration. Council Members may indicate a negative or abstaining vote on any individual item by so declaring prior to the vote on the motion to adopt the Consent Calendar. Items excluded from the Consent Calendar will be taken up following action on the Consent Calendar. Public speakers shall follow the guidelines as set forth under Public Comment. New Business items are matters appearing before the Council for the first time for formal action. Those wishing to address the Council on New Business items shall follow the guidelines for Public Comment. Closed Session allows the Council to discuss specific matters pursuant to the Brown Act, Government Code Section 54956.9. Based on the advice of the City Attorney, discussion of these matters in open session would prejudice the position of the City. Following Closed Session, the City Attorney will provide an oral report on any reportable matters discussed and actions taken. At the conclusion of Closed Session, the Council may continue any item listed on the Closed Session agenda to the Open Session agenda for discussion or to take formal action as it deems appropriate. City Council Agenda Report Meeting Date:March 19, 2024 From:Carlos Fandino, City Administrator Department:City Administration Submitted by:Diana Figueroa, Management Analyst Subject Vernon CommUNITY Fund Grant Committee Awards and Direct Service Grantee Certificates for Fiscal Year (FY) 2023-24 Recommendation A. Receive and file the report; and B. Present Certificates to FY 2023-24 Direct Service Grant Recipients. Background On February 21, 2024, the Vernon CommUNITY Fund (VCF) Grant Committee (Grant Committee) held its first grant award meeting for FY 2023-24. There were nine (9) Direct Service Grant applicants recommended (listed below) and all were awarded grants for a combined total of $142,000. 1) Chicxs Rockerxs - $20,000; 2) Dolores Mission School - $15,000; 3) Girl Scouts of Greater Los Angeles - $20,000; 4) Jovenes - $12,000; 5) Libros Schmibros - $15,000; 6) Neighborhood Music School - $15,000; 7) Proyecto Pastoral - $15,000; 8) PUENTE Learning Center - $15,000; and 9) YMCA Southeast Rio Vista - $15,000. Section 2.48.130 of the Vernon Municipal Code requires the Grant Committee Executive Director (City Administrator) provide the City Council a report of grant related actions taken by the Grant Committee. A representative from each of the organizations awarded grants has been invited to the March 19, 2024 Council meeting to be presented with a commemorative certificate. Fiscal Impact The fiscal impact is estimated at $142,000. Sufficient funds are available in the City’s General Fund, Community Promotion Department, Good Neighbor Program Account No. 011-010-140- 529715 for the current fiscal year. Attachments None. . . Item 1 Page 1 of 1 City Council Agenda Report Meeting Date:March 19, 2024 From:Michael Earl, Director of Human Resources Department:Human Resources Submitted by:Veronica Avendano, Human Resources Specialist Subject Employee Service Pin Awards Recommendation Recognize February 2024 Employee Service Pin Award Recipient. Background The following employee is eligible to receive their service pin based on the number of service years with the City of Vernon: FIVE YEARS OF SERVICE Veronica Petrosyan, Deputy Director of Health & Environmental Control, Hired February 2019 Fiscal Impact There is no fiscal impact associated with this report. Attachments None. . . Item 2 Page 1 of 1 City Council Agenda Report Meeting Date:March 19, 2024 From:Daniel S. Wall, P.E., Director of Public Works Department:Public Works Submitted by:Daniel S. Wall, P.E., Director of Public Works Subject Warehouse Development Agreement for 5764 Alcoa Avenue Recommendation A. Find that the ordinance is not subject to CEQA as the adoption of the ordinance is not a “project” pursuant to CEQA Guidelines Section 15302, because the proposed development consists of the replacement and reconstruction of existing facilities where the new structure will be located on the same site as the structures being replaced and will have substantially the same size, purpose, and capacity as the structures being replaced; B. Introduce and conduct first reading of Ordinance No. 1299 approving Warehouse Development Agreement No.WH-001 for Assessor Parcel Numbers 6310-005-003, 6310-005- 004, 6310-005-009, and 6310-005-010 between the City of Vernon and; and GPT Vernon Owner, LP; and C. Direct staff to schedule second reading and adoption for the April 2, 2024 City Council meeting. Background GPT Vernon Owner, LP (GPT) wishes to remove existing warehouse buildings and associated structures totaling 145,950 square feet on a 7.12-acre (310,147 square feet) lot, and replace them with a single 153,000 square foot warehouse building. Municipal Code Section 17.22.035 permits warehouses on lots encompassing 150,000 square feet or more in the General Industrial Zone and all overlay zones, with the exception of the Housing Overlay Zone, subject to the approval of a development agreement between the City and the applicant and complying with all conditions in Chapter 17.22 of the Municipal Code. Municipal Code Section 17.84.060 requires a public hearing and adoption of development agreements by ordinance. Ordinances adopting development agreements do not reflect the laws of the City and are there uncodified. GPT and City Staff have negotiated a development agreement allowing the development of a 153,000 square foot warehouse at 5764 Alcoa Avenue. This project will not significantly increase traffic as it will result in a less than 5% increase in warehouse space on the site. The Director of Public Works has reviewed the Development Agreement for conformity with Municipal Code Section 17.84.040 and finds that: A. The Development Agreement is consistent with the General Plan Objectives, policies, land uses, and implementation programs and any other adopted plans or policies applicable to the agreement as the property is in the Industrial Zone and warehouse uses are allowed in the Industrial Zone; B. The Development Agreement is compatible with the uses authorized in, and the regulations prescribed for, the land use district in which the real property is located, as the proposed warehouse use is replacing the existing warehouse use, and is allowed in the Industrial Zone via development agreement; C. The Development Agreement will promote the public convenience, health, interest, safety, and general welfare of the City and will not be detrimental to or cause adverse effects to adjacent property owners, residents or the general public as this development replaces older warehouse buildings with a new more aesthetically pleasing warehouse of similar size to the existing . . Item 3 Page 1 of 2 warehouse buildings and provides a source of funds to benefit the community; D. The Development Agreement is consistent with the provisions of California Government Code Section 65864 et seq. The Director of Public Works has reviewed the Development Agreement for conformity with Municipal Code Section 17.22.035 and finds that the proposed Development Agreement is: 1. Is consistent with the objectives, policies, general land uses and programs specified in the General Plan and any applicable specific plan as the property is in the Industrial Zone and warehouse uses are allowed in the Industrial Zone; 2. Is in conformity with and will promote public convenience, general welfare and good land use practice as the proposed development replaces older warehouse buildings with a new more aesthetically pleasing warehouse of similar size to the existing warehouse buildings and provides a source of funds in addition to warehouse parcel taxes. This project will pay to the city a community benefit fee of up to $1 million in four incremental payments to benefit the community; 3. Will not be detrimental to public health, safety or welfare as the proposed warehouse is similar in size to the existing warehouses on the site and will improve eliminate trucks backing into the property and blocking traffic through improved site design and building layout.; 4. Will not adversely affect the orderly development of property or the preservation of property values through the investment in a new building and landscaping; and 5. Will promote and encourage the development of the proposed project by providing a greater degree of requisite certainty by including a site (Exhibit B-1 to the Development Agreement), and landscape plan (Exhibit B-2 to the Development Agreement) and an elevations and materials board (Exhibit B-3). Fiscal Impact The construction of the new warehouse will result in General Fund net revenue of $250,000 as a condition to the issuance of a grading permit, followed by a second payment of up to $250,000 as a condition to the issuance of a certificate of occupancy for the completed building, followed by a third payment of up to $250,000 one year after the second payment, followed by a fourth payment of up to $250,000 one year after the third payment. Second, third and fourth payments may be reduced based on utility users tax payments generated by the warehouse in accordance with a formula contained in the development agreement. Attachments 1. CEQA Memo 2. Ordinance No. 1299 3. Notice of Public Hearing . . Item 3 Page 2 of 2 JN 1132-008 CATEGORICAL EXEMPTION MEMORANDUM TO: City of Vernon Public Works Department – Planning Division 4305 S. Santa Fe Avenue Vernon, CA 90058 FROM: Nicole Morse, Esq., Principal DATE: January 26, 2024 RE: CEQA Class 2 Exemption – 5764 Alcoa Avenue I. PROJECT UNDERSTANDING Link Logistics (“Project Applicant”) seeks to redevelop an approximately 7.12-acre property located at 5764 Alcoa Avenue in the City of Vernon (“City”), County of Los Angeles. The subject property’s Assessor’s Parcel Number (APN) is 6310-005-003, 6310-005-004, 6310-005-009, and 6310-005-010 (“Project site”). The Project site is currently developed with existing warehouse buildings and associated structures totaling approximately 145,950 square feet (sf). The Project Applicant proposes to demolish the existing warehouse buildings and associated structures and redevelop the Project site with a single new industrial concrete tilt-up dock high warehouse building (type III-B) totaling 153,000 sf, including 10,000 sf of office space (“Project”). The overall site plan is provided in Attachment A of this Memorandum. The building will be supported by a screened truck yard, vehicular parking areas, drive aisles, and landscaping. Onsite improvements will include storm drains, stormwater/water quality treatment facilities (including underground infiltration chambers), sewer, water, and dry utility systems. Additionally, gravity curbs and deepened building panels will be utilized. The existing onsite railroad tracks along the north property line and extending into the Project site would be removed as part of the Project. The Project is fully consistent with all applicable zoning regulations. The information presented in this memorandum is based on our review and analysis of the following documents and information: (a) materials provided by the Project Applicant regarding the proposed Project; (b) publicly available documents and information from the City of Vernon website, including but not limited to the City’s General Plan, Zoning and Land Use Code, and (c) information provided by the City of Vernon staff. . . Item 3 Page 1 of 85 CEQA Class 2 Exemption – 5764 Alcoa Avenue January 26, 2024 Page 2 of 9 II. EXISTING CONDITIONS A. Existing Land Use The Project site consists of four (4) square- to irregularly shaped parcels, totaling approximately 7.12 acres. The site is developed with three commercial/industrial-type buildings totaling approximately 145,950 sf and is almost completely paved, except for the northwest portion of the site which is dirt and gravel. One of the three buildings is unoccupied where the other two buildings are both used for shipping and receiving and warehouse/office uses. Specifically, two tenants currently lease the site: Odyssey logistics and The Starco Group. The building located at 5708 Alcoa Boulevard is vacant and there are no structures at the 5700 Alcoa Avenue address. Odyssey occupies the majority of this site, including the entire warehouse, the shipping and receiving portion of the 5764 Alcoa Avenue building. and the 3311 East Slauson Boulevard building for warehouse operations. The Starco Group has leased the office area of the 5764 Alcoa Avenue building from Odyssey since December 2020, exclusively for office operations. The 5708 Alcoa Avenue building is an approximately 16,000 sf vacant commercial building and the 5700 Alcoa Avenue parcel is undeveloped land. There is no designed landscaping onsite, however, there are weeds and brush in the dirt and gravel areas. There are two existing onsite private spur tracks onsite, one in the northwest portion of the site (detached from drill track) and one along the north property line (still connected to drill track). The site is secured by a combination of block walls and various fence types. B. Existing General Plan Designation The City of Vernon General Plan designates the Project site as “Industrial (I).” The industrial designation is purposefully structured to allow for a broad range of uses that support the City’s desire to maintain its status as a regional manufacturing and industrial center. The Industrial land use designation allows manufacturing, industrial uses, refrigerated and cold storage warehouses, data centers, general warehousing, industrial gas manufacturing, and any use or activity undertaken by the City. Refineries, energy generating facilities, hazardous waste facilities, trash to energy facilities, petroleum related uses, and other complementary uses may be permitted with special approval such as a Conditional Use Permit (CUP). Certain ancillary uses may be permitted in accordance with Zoning Ordinance requirements. The maximum permitted FAR is 2:1. The Project site is consistent with the City’s General Plan land use designation of Industrial (I). C. Existing Zoning The Project site is located within the “General Industry (I)” zoning district, which is intended to provide for the orderly development and operation of most types of industrial use and to promote the concentration of such uses in a manner that will foster mutually beneficial relationships with each other. Development standards for properties within the General Industry (I) Zone are provided for in Vernon Municipal Code (VMC) Chapter 17.22 General Industry (I) Zone. The Project site is consistent with the General Industry (I) zoning. The southern portion of the Project site has an overlay zone of Commercial-1 (C-1). The purpose of the Commercial-1 (C-1) Overlay Zone is to accommodate at limited and specific areas of the City those business uses that complement and do not detract from the purposely established industrial character of the City. The C-1 Overlay Zone is intended to provide areas for the development of mercantile facilities, including commercial . . Item 3 Page 2 of 85 CEQA Class 2 Exemption – 5764 Alcoa Avenue January 26, 2024 Page 3 of 9 uses, retail uses, offices, services, and business operations that would serve existing businesses and surrounding uses by improving access to a greater range of facilities and services. D. Surrounding Land Uses Surrounding land uses include primarily industrial uses within the City of Vernon limits with the nearest residential uses located approximately 1,200 feet to the east of the site. Surrounding land uses are zoned General Industry (I) with uses south, east, and west in the Commercial-1 (C-1) overlay zone. The Project is consistent with the General Plan and zoning and, therefore, would complement surrounding development. III. CEQA CATEGORICAL EXEMPTION The Project Applicant proposes to demolish the existing structures onsite and redevelop the Project site with a single new industrial concrete tilt-up dock high warehouse building (type III-B) totaling 155,420 sf, including 10,000 sf of office space on a property located in the General Industry (I) Zone. The Project is fully consistent with all applicable zoning regulations. A. Class 2 Exemption Guidelines Section 15302, Replacement or Reconstruction, states that a Class 2 exemption consists of replacement of reconstruction of existing structures and facilities where the new structure will be located on the same site as the structure replaced and will have substantially the same purpose and capacity as the structure replaced, including but not limited to: (a) Replacement or reconstruction of existing schools and hospitals to provide earthquake resistant structures which do not increase capacity more than 50 percent. (b) replacement of a commercial structure with a new structure of substantially the same size, purpose, and capacity. (c) Replacement or reconstruction of existing utility systems and/or facilities involving negligible or no expansion of capacity. (d) Conversion of overhead electric utility distribution system facilities to underground including connection to existing overhead electric utility distribution lines where the surface is restored to the condition existing prior to the undergrounding. The Project involves demolition of existing warehouse buildings and associated structures totaling approximately 145,950 sf and redevelopment of the site with a single new industrial concrete tilt-up dock high warehouse building (type III-B) totaling 153,000 sf. The Class 2 Categorical Exemption is allowed where the proposed Project would result in the redevelopment of the site with a building of substantial similar size, purpose, and capacity. The Project’s proposed warehouse building is substantially the same size as the existing uses, with 7,050 sf increase compared to the existing warehouse buildings onsite. The proposed Project would redevelop the site with substantially similar uses and purpose by replacing existing warehouse and office buildings with a new modern warehouse and office building. Additionally, the proposed uses are consistent with the underlying General Plan and zoning designations and, therefore, serve substantially the same purpose as planned for the site. . . Item 3 Page 3 of 85 CEQA Class 2 Exemption – 5764 Alcoa Avenue January 26, 2024 Page 4 of 9 The proposed Project would have substantially similar capacity as the existing uses. A trip generation assessment (Attachment B of this Memorandum) was prepared by Urban Crossroads to evaluate the potential change in capacity by comparing the trip generation of the existing operation with the proposed operation. To determine the existing trips associated with the existing use, traffic counts were collected at the driveways on October 10 through 12, 2023. The existing site currently generates an average of 232 two-way trips per day, with 23 trips during the AM peak hour and 17 trips during the PM peak hour. Trip generation for the proposed use was determined based on the Institute of Transportation Engineers (ITE), Trip Generation Manual, Eleventh Edition (2021), ITE land use code 150 (Warehousing). The proposed Project is anticipated to generate 264 two-way trips per day with 25 AM peak hour trips and 26 PM peak hour trips. As a result, the proposed Project would result in 32 additional two-way trips per day with an increase of 2 AM peak hour trips and 9 PM peak hour trips as compared to the existing uses. Furthermore, using the highest trip rate by vehicle type for the Project in an effort to provide a conservative calculation of Project trips, the Project would result in an increase of 80 passenger cars and 8 trucks (for a total of 88 two-way trips). Because the proposed Project would generate similar traffic conditions as the existing use, it would have substantially similar capacity as the existing uses. Furthermore, based on the County’s Transportation Impact Analysis Guidelines, dated July 23, 2020, a traffic report is not warranted because the Project would generate fewer than 110 net new two way trips per day and would contribute fewer than 50 net new peak hour trips to any off site study area intersection. B. Review Of Exceptions to The Categorical Exemption Furthermore, CEQA Guidelines include exceptions to all exemptions. As codified in Guidelines Section 15300.2, a project that would otherwise fit into an exemption must not be disqualified by the following sections: a) Location. Classes 3, 4, 5, 6, and 11 are qualified by consideration of where the project is to be located – a project that is ordinarily insignificant in its impact on the environment may in a particularly sensitive environment be significant. Therefore, these classes are considered to apply all instances, except where the project may impact on an environmental resource of hazardous or critical concern where designated, precisely mapped, and officially adopted pursuant to law by federal, state, or local agencies. b) Cumulative Impact. All exemptions for these classes are inapplicable when the cumulative impact of successive projects of the same type in the same place, over time is significant. c) Significant Effect. A categorical exemption shall not be used for an activity where there is a reasonable possibility that the activity will have a significant effect on the environment due to unusual circumstances. d) Scenic Highways. A categorical exemption shall not be used for a project which may result in damage to scenic resources, including but not limited to, trees, historic buildings, rock outcroppings, or similar resources, within a highway officially designated as a state scenic highway. This does not apply to improvements which are required as mitigation by an adopted negative declaration or certified EIR. e) Hazardous Waste Sites. A categorical exemption shall not be used for a project located on a site which is included on any list compiled pursuant to Section 65962.5 of the Government Code. f) Historical Resources. A categorical exemption shall not be used for a project which may cause a substantial adverse change in the significance of a historical resource. Condition a) would not apply under a Class 2 exemption as it only applies to Classes 3, 4, 5, 6, and 11. . . Item 3 Page 4 of 85 CEQA Class 2 Exemption – 5764 Alcoa Avenue January 26, 2024 Page 5 of 9 Condition b) and c) would not apply because replacing the existing structures with a modern industrial building consistent with the City’s General Plan and zoning is not an unusual circumstance and would not create a cumulative impact or significant effect. Condition d) requires consideration of the nearest officially designated state scenic highways. According to the California Department of Transportation (Caltrans) California Scenic Highway Mapping System, the nearest officially designated state scenic highways is a portion of California State Route 2 located approximately 16 miles to the north and is not visible from the Project site or surrounding areas.1 As such, the Project site would not result in damage to scenic resources within a highway officially designated as a state scenic highway, and this exception does not apply. Condition e) would not apply. Pursuant to Government Code Section 65962.5, the Hazardous Waste and Substances Sites (Cortese) List is a planning document used by the State and local agencies to comply with the California Environmental Quality Act requirements in providing information about the location of hazardous materials release sites. Below are the data resources that provide information regarding the facilities or sites identified as meeting the Cortese List requirements. x List of Hazardous Waste and Substances sites from Department of Toxic Substances Control (DTSC) EnviroStor database. x List of Leaking Underground Storage Tank Sites from the State Water Board’s GeoTracker database. x List of solid waste disposal sites identified by Water Board with waste constituents above hazardous waste levels outside the waste management unit. x List of “active” Cease and Desist Orders and Cleanup and Abatement Orders from Water Board. x List of hazardous waste facilities subject to corrective action pursuant to Section 25187.5 of the Health and Safety Code, identified by DTSC. Based on a review of the Cortese List maintained by the CalEPA, the Project site is not identified as a hazardous materials site pursuant to Government Code Section 65962.5. 2 As the Project site is not listed in any hazardous waste sites, this exception would not apply. Condition f) requires consideration of whether the Project may cause a substantial adverse change in the significance of a historical resource. The definition of "historical resources" is contained in CEQA Guidelines Section 15064.5. Buildings or structures that are 45 years or older meet the minimum age requirement for consideration as a potential historical resource under CEQA; historical resources are evaluated as defined in CEQA Guidelines Section 15064.5. Both warehouse/office buildings located at 5764 Alcoa Avenue and 3321 East Slauson Avenue were constructed after 1981 and are not of historic age. The oldest building at the site (5708 Alcoa Avenue commercial building) was constructed in approximately 1941.3 Additionally, the rail spurs on site were constructed 1 https://caltrans.maps.arcgis.com/apps/webappviewer/index.html?id=465dfd3d807c46cc8e8057116f1aacaa. 2 https://calepa.ca.gov/sitecleanup/corteselist/ 3 https://portal.assessor.lacounty.gov/parceldetail/6310005004 . . Item 3 Page 5 of 85 CEQA Class 2 Exemption – 5764 Alcoa Avenue January 26, 2024 Page 6 of 9 in the early 1940s. To determine whether the 5708 Alcoa Avenue building and rail spurs are considered historical resources Chronicle Heritage, LLC prepared a Cultural Resources Assessment on December 8, 2023 (see Attachment C of this Memorandum). The resources were documented and evaluated for significance; the evaluation found that neither resource meets the criteria for listing on the California Register of Historical Resources. Given the extent of existing disturbance, along with the lack of known archaeological sites in the Project vicinity, the property contains a relatively low sensitivity for in situ buried archaeological deposits. Based on these results, the proposed Project will have no impact on known historical or archaeological resources under CEQA. As such, the Project would not cause a substantial adverse change in the significance of a historical resource. C. Conclusion Based on the foregoing analysis, the Project meets the conditions of a Class 2 exemption and would not conflict with any of the exceptions as codified in CEQA Guidelines Section 15300. . . Item 3 Page 6 of 85 CEQA Class 2 Exemption – 5764 Alcoa Avenue Attachments Attachment A: Overall Site Plan . . Item 3 Page 7 of 85 . . Item 3 Page 8 of 85 CEQA Class 2 Exemption – 5764 Alcoa Avenue Attachments Attachment B: Trip Generation Assessment . . Item 3 Page 9 of 85 DATE: January 24, 2024 TO: Nicole Morse, T&B Planning, Inc. FROM: Charlene So, Urban Crossroads, Inc. JOB NO: 15661-03 TG Memo 5764 ALCOA TRIP GENERATION ASSESSMENT Urban Crossroads, Inc. is pleased to provide the following Trip Generation Assessment for the 5764 Alcoa development (Project), which is located in the City of Vernon (APN: 6310-005-003, -004, -009, and -010). This trip letter describes the proposed Project trip generation and determines whether any traffic operations analysis is required based on the County’s Transportation Impact Analysis Guidelines (County’s Guidelines) dated July 23, 2020, since the City does not have their own guidelines. PROPOSED PROJECT The Project will demolish the existing warehouse buildings and associated structures totaling approximately 145,877 square feet on the 7.12-acre property. The Project includes the development of a new 153,000 square foot warehouse building. There is one passenger car and truck driveway on Alcoa Avenue and two driveways on Slauson Avenue. The westerly driveway on Slauson Avenue will serve passenger cars only while the easterly driveway on Slauson Avenue will serve both passenger cars and trucks. A preliminary site plan for the proposed Project is shown on Exhibit 1. . . Item 3 Page 10 of 85 Nicole Morse, T&B Planning, Inc. January 24, 2024 Page 2 of 8 15661-03 TG Memo EXHIBIT 1: PRELIMINARY SITE PLAN . . Item 3 Page 11 of 85 Nicole Morse, T&B Planning, Inc. January 24, 2024 Page 3 of 8 15661-03 TG Memo TRIP GENERATION Trip generation represents the amount of traffic which is both attracted to and produced by a development. Determining traffic generation for a specific project is therefore based upon forecasting the amount of traffic that is expected to be both attracted to and produced by the specific land uses being proposed for a given development. EXISTING USE The site is currently occupied by existing warehouse buildings and associated structures totaling approximately 145,877 square feet on the 7.12-acre property. These structures will be demolished with the development of the proposed Project. In an effort to understand the existing traffic associated with the current use, traffic counts were collected at the driveways on October 10 through 12, 2023 (Tuesday through Thursday). A detailed summary of the count data collected at all driveway locations by day is shown in Attachment A. Table 1 below summarizes the average existing trip generation based on the count data collected over the three consecutive days. The existing site currently generates an average of 232 two-way trips per day, with 23 trips during the AM peak hour and 17 trips during the PM peak hour (in actual vehicles). TABLE 1: EXISTING TRIP GENERATION PROPOSED PROJECT: WAREHOUSE The Project includes the development of a new 153,000 square foot warehouse building. In order to develop the traffic characteristics of the proposed Project, trip-generation statistics published in the Institute of Transportation Engineers (ITE) Trip Generation Manual (11th Edition, 2021) were used. In an effort to conduct a conservative analysis, the Warehousing (ITE 150) land use category has been used for the proposed Project. Table 2 summarizes the trip generation rates. For purposes of this assessment, the following ITE land use code and vehicle mix has been utilized: • ITE land use code 150 (Warehousing) has been used to derive site specific trip generation estimates for up to 153,000 square feet. A warehouse is primarily devoted to the storage of materials but may also include office and maintenance areas. The vehicle mix has been obtained from the ITE’s Trip Generation Manual. The truck percentages were further broken Land Use In Out Total In Out Total Daily Existing Use Passenger Cars: 6 1 7 1 10 11 90 2-axle Trucks: 3 1 4 1 1 2 28 3-axle Trucks: 1 1 2 1 2 2 24 4+-axle Trucks: 6 4 10 1 1 2 90 Total Truck Trips (Actual Vehicles): 10 6 16 3 4 7 142 Total Trips (Actual Vehicles)1 16 7 23 4 13 17 232 1 Total Trips = Passenger Cars + Truck Trips. AM Peak Hour PM Peak Hour . . Item 3 Page 12 of 85 Nicole Morse, T&B Planning, Inc. January 24, 2024 Page 4 of 8 15661-03 TG Memo down by axle type per the following South Coast Air Quality Management District (SCAQMD) recommended truck mix: 2-Axle = 16.7%; 3-Axle = 20.7%; 4+-Axle = 62.6%. TABLE 2: TRIP GENERATION RATES The trip generation summary illustrating daily and peak hour trip generation estimates for the proposed Project are summarized on Table 3. The proposed Project is anticipated to generate 264 two-way trips per day with 25 AM peak hour trips and 26 PM peak hour trips (in actual vehicles). TABLE 3: PROJECT TRIP GENERATION SUMMARY Alternatively, Project trip generation has also been calculated based on trip generation rates derived from the existing uses and count data summarized in Table 1. Specifically, the trips presented in Table 1 have been divided by 145,877 square feet to develop a trip generation rate on a per thousand square foot basis. The trip generation rates based on the existing uses were then applied to the 153,000 square foot proposed Project. As shown on Table 4, the proposed Project is anticipated to generate 244 two-way trips per day with 24 AM peak hour trips and 18 PM peak hour trips (in actual vehicles). ITE LU Land Use Units2 Code In Out Total In Out Total Daily Trip Generation Rates:1 Warehousing3 TSF 150 0.131 0.039 0.170 0.050 0.130 0.180 1.710 Passenger Cars (AM=88.2%, PM=83.3%, Daily=64.9%) 0.120 0.030 0.150 0.034 0.116 0.150 1.110 2-Axle Trucks (AM=1.97%, PM=2.79%, Daily=5.86%) 0.002 0.001 0.003 0.003 0.002 0.005 0.100 3-Axle Trucks (AM=2.44%, PM=3.46%, Daily=7.27%) 0.002 0.002 0.004 0.003 0.003 0.006 0.124 4+-Axle Trucks (AM=7.39%, PM=10.45%, Daily=21.97%) 0.007 0.006 0.013 0.010 0.009 0.019 0.376 1 Trip Generation & Vehicle Mix Source: Institute of Transportation Engineers (ITE), Trip Generation Manual, Eleventh Edition (2021). 2 TSF = thousand square feet 3 Truck Mix: South Coast Air Quality Management District’s (SCAQMD) recommended truck mix, by axle type. Normalized % - Without Cold Storage: 16.7% 2-Axle trucks, 20.7% 3-Axle trucks, 62.6% 4-Axle trucks. AM Peak Hour PM Peak Hour Land Use Quantity Units1 In Out Total In Out Total Daily Project Trip Generation: Warehousing 153.000 TSF Passenger Cars: 18 5 23 5 18 23 170 2-axle Trucks: 00000016 3-axle Trucks: 00000020 4+-axle Trucks: 11221358 Total Trucks 11221394 Total Project Trips 19 6 25 7 19 26 264 1 TSF = thousand square feet AM Peak Hour PM Peak Hour . . Item 3 Page 13 of 85 Nicole Morse, T&B Planning, Inc. January 24, 2024 Page 5 of 8 15661-03 TG Memo TABLE 4: PROJECT TRIP GENERATION SUMMARY USING EXISTING RATES TRIP GENERATION COMPARISON Table 5 shows the trip generation comparison between the existing uses and proposed Project trip generation calculated using ITE and identifies the resulting net change in trips. As shown, there is an anticipated net reduction to truck trips with the development of the proposed Project but an increase to passenger car trips as compared to the existing uses. The net effect of the development of the proposed Project would result in 32 additional two-way trips per day with an increase of 2 AM peak hour trips and 9 PM peak hour trips as compared to the existing uses. Land Use Units2 In Out Total In Out Total Daily Trip Generation Rates:1 Warehousing TSF 0.107 0.039 0.170 0.050 0.130 0.180 1.710 Passenger Cars 0.041 0.007 0.048 0.007 0.066 0.073 0.617 2-Axle Trucks 0.018 0.009 0.027 0.007 0.007 0.014 0.192 3-Axle Trucks 0.005 0.007 0.011 0.005 0.011 0.016 0.165 4+-Axle Trucks 0.043 0.027 0.071 0.009 0.007 0.016 0.617 1 Trip Generation & Vehicle Mix Source: Table 1 trip generation divided by existing 145,877 square feet. 2 TSF = thousand square feet Land Use Quantity Units1 In Out Total In Out Total Daily Project Trip Generation: Warehousing 153.000 TSF Passenger Cars: 6171101194 2-axle Trucks: 31411230 3-axle Trucks: 11212326 4+-axle Trucks: 7 4 11 1 1 2 94 Total Trucks 11 6 17 3 4 7 150 Total Project Trips 17 7 24 4 14 18 244 1 TSF = thousand square feet AM Peak Hour PM Peak Hour AM Peak Hour PM Peak Hour . . Item 3 Page 14 of 85 Nicole Morse, T&B Planning, Inc. January 24, 2024 Page 6 of 8 15661-03 TG Memo TABLE 5: TRIP GENERATION COMPARISON (ITE RATES) Table 6 shows the trip generation comparison between the existing uses and proposed Project trip generation calculated using the empirical data (existing surveyed counts) and identifies the resulting net change in trips. As shown, there is nominal to no changes anticipated for the passenger cars and trucks during the peak hour with a net increase of 4 passenger cars and 8 truck two-way trips per day as compared to the existing uses. Land Use In Out Total In Out Total Daily Proposed Project (Table 3) Passenger Cars: 18 5 23 5 18 23 170 Total Truck Trips (Actual Vehicles): 1 1 2 2 1 3 94 Total Trips 19 6 25 7 19 26 264 Existing Uses Passenger Cars: 6 1 7 1 10 11 90 Total Truck Trips (Actual Vehicles): 10 6 16 3 4 7 142 Total Trips 16 7 23 4 13 17 232 Net Change Passenger Cars: 12 4 16 4 8 12 80 Total Truck Trips (Actual Vehicles): -9 -5 -14 -1 -3 -4 -48 Total Trips 3 -1 2 3 6 9 32 AM Peak Hour PM Peak Hour . . Item 3 Page 15 of 85 Nicole Morse, T&B Planning, Inc. January 24, 2024 Page 7 of 8 15661-03 TG Memo TABLE 6: TRIP GENERATION COMPARISON (EMPIRICAL RATES) FINDINGS The traffic impact study area is to be defined in conformance with the requirements of the County’s Guidelines, which state that a transportation impact analysis may be required if it does not meet one of the defined screening criteria. One of the screening criteria for non-retail projects identifies a project will meet the screening criteria if the development results in a net change in the trip generation of less than 110 daily vehicle trips. The County’s Guidelines identifies that an operations analysis is required if: x A project is required to submit a Transportation Impact Analysis; or x A development project involves discretionary action. The trip generation comparison of the proposed Project based on the ITE rates as shown on Table 5 has been utilized for the purposes of this assessment as the net change is a higher net increase than that summarized on Table 6, where the Project trip generation is based on empirical data. As shown on Table 5, the Project is anticipated to generate fewer than 110 net new two-way trips per day and would contribute fewer than 50 net new peak hour trips to any off-site study area intersection. As such, additional traffic analysis beyond this trip generation assessment is not necessary. Furthermore, using the highest trip rate by vehicle type for the Project in an effort to provide a conservative calculation of Project trips, would result in an increase of 80 passenger cars and 8 trucks (for a total of 88 two-way trips as shown on Table 7). Using the highest trip rate per vehicle Land Use In Out Total In Out Total Daily Proposed Project (Table 4) Passenger Cars: 6 1 7 1 10 11 94 Total Truck Trips (Actual Vehicles): 11 6 17 3 4 7 150 Total Trips 17 7 24 4 14 18 244 Existing Uses Passenger Cars: 6 1 7 1 10 11 90 Total Truck Trips (Actual Vehicles): 10 6 16 3 4 7 142 Total Trips 16 7 23 4 13 17 232 Net Change Passenger Cars: 0 0 0 0 0 0 4 Total Truck Trips (Actual Vehicles): 1 0 1 0 0 0 8 Total Trips 1 0 1 0 1 1 12 AM Peak Hour PM Peak Hour . . Item 3 Page 16 of 85 Nicole Morse, T&B Planning, Inc. January 24, 2024 Page 8 of 8 15661-03 TG Memo type for the proposed Project would also result in fewer than 110 net new two-way trips and 50 peak hour trips to any off-site study area intersection. TABLE 7: COMPARISON OF MAXIMUM TRIP RATE BY VEHICLE TYPE If you have any questions or comments, I can be reached at cso@urbanxroads.com. Land Use In Out Total In Out Total Daily Proposed Project1 Passenger Cars: 18 5 23 5 18 23 170 2-axle Trucks: 3 1 4 1 1 2 30 3-axle Trucks: 1 1 2 1 2 3 26 4+-axle Trucks: 7 4 11 2 1 3 94 Total Truck Trips (Actual Vehicles): 11 6 17 4 4 8 150 Total Trips 29 11 40 9 22 31 320 Existing Uses (Table 1) Passenger Cars: 6 1 7 1 10 11 90 2-axle Trucks: 3 1 4 1 1 2 28 3-axle Trucks: 1 1 2 1 2 2 24 4+-axle Trucks: 6 4 10 1 1 2 90 Total Truck Trips (Actual Vehicles): 10 6 16 3 4 7 142 Total Trips 16 7 23 4 13 17 232 Net Change Passenger Cars: +12 +4 +16 +4 +8 +12 +80 2-axle Trucks: 0 0 0 0 0 0 +2 3-axle Trucks: 0 0 0 0 0 +1 +2 4+-axle Trucks: +1 0 +1 +1 0 +1 +4 Total Truck Trips (Actual Vehicles): +1 0 +1 +1 0 +1 +8 Total Trips +13 +4 +17 +5 +9 +14 +88 1 Source: Maximum peak hour and daily trips from either Table 3 or Table 4 for each vehicle type. AM Peak Hour PM Peak Hour . . Item 3 Page 17 of 85 15661-03 TG Memo ATTACHMENT A: DRIVEWAY COUNTS . . Item 3 Page 18 of 85 15661-03 TG Memo TABLE A-1: SUMMARY OF EXISITNG DRIVEWAY COUNTS BY DAY Existing Surveyed Sites In Out Total In Out Total Daily Trip Generation Summary of Existing Uses:1 Tuesday, October 10, 2023 Passenger Cars: 6 0 6 1 13 14 103 2-axle Trucks: 2 3 5 2 1 3 49 3-axle Trucks: 2 1 3 0 0 0 27 4+-axle Trucks: 9 5 14 1 2 3 115 Total Trucks (Actual Vehicles) 13 9 22 3 3 6 191 Tuesday Total Trips (Actual Vehicles) 19 9 28 4 16 20 294 Wednesday, October 11, 2023 Passenger Cars: 4152111386 2-axle Trucks: 20212316 3-axle Trucks: 02214525 4+-axle Trucks: 52731491 Total Trucks (Actual Vehicles) 7 4 11 5 7 12 132 Wednesday Total Trips (Actual Vehicles) 11 5 16 7 18 25 218 Thursday, October 12, 2023 Passenger Cars: 8 2 10 0 5 5 82 2-axle Trucks: 41500020 3-axle Trucks: 00011221 4+-axle Trucks: 5 5 10 0 0 0 62 Total Trucks (Actual Vehicles) 9 6 15 1 1 2 103 Thursday Total Trips (Actual Vehicles) 17 8 25 1 6 7 185 1 Data presented based on sum of all driveways collected over 3 days. AM Peak Hour PM Peak Hour . . Item 3 Page 19 of 85 City: Location: Date: Count Type: Pass Veh Large 2 Axle 3 Axle 4+ Axle Total Pass Veh Large 2 Axle 3 Axle 4+ Axle Total 0:0000000 0:0000000 0:1500000 0:1500000 0:3000000 0:3000000 0:4500000 0:4500000 1:0000000 1:0000000 1:1500000 1:1500000 1:3000000 1:3000000 1:4500000 1:4500000 2:0000000 2:0000000 2:1500000 2:1500000 2:3000011 2:3000000 2:4500000 2:4500101 3:0000000 3:0001012 3:1500000 3:1500000 3:3000000 3:3000000 3:4510012 3:4500000 4:0000000 4:0000000 4:1500000 4:1500000 4:3010001 4:3000022 4:4500000 4:4500000 5:0010001 5:0000000 5:1500011 5:1500011 5:3000011 5:3000000 5:4520002 5:4500000 6:0020013 6:0000011 6:1500000 6:1500011 6:3010102 6:3010012 6:4510001 6:4500000 7:0010001 7:0000101 7:1520013 7:1500000 7:3000022 7:3000011 7:4521025 7:4501012 8:0030137 8:0001001 8:1511125 8:1501135 8:3010001 8:3000000 8:4520035 8:4501113 9:0000011 9:0010023 9:1520147 9:1502068 9:3001023 9:3010113 9:4510001 9:4510012 10:0012014 10:0012036 10:1500011 10:1501012 10:3002002 10:3012003 10:4510012 10:4500011 11:0010023 11:0001001 11:1500011 11:1511002 11:3011103 11:3010023 11:4510012 11:4511024 Exiting Vernon TOTALS Tuesday, October 10, 2023 Driveway Classification Entering Counts Unlimited, Inc. PO Box 1178 Corona, CA 92878 (951) 268-6268 . . Item 3 Page 20 of 85 City: Location: Date: Count Type: Pass Veh Large 2 Axle 3 Axle 4+ Axle Total Pass Veh Large 2 Axle 3 Axle 4+ Axle Total Exiting Vernon TOTALS Tuesday, October 10, 2023 Driveway Classification Entering 12:0022037 12:0012014 12:1521025 12:1530014 12:3020103 12:3000123 12:4510102 12:4520013 13:0020002 13:0011024 13:1500224 13:1500022 13:3002024 13:3001012 13:4501023 13:4523106 14:0021014 14:0021104 14:1511024 14:1520035 14:3000101 14:3000011 14:4530014 14:4510023 15:0000022 15:0010012 15:1520013 15:1530025 15:3000011 15:3021014 15:4510001 15:4511002 16:0010012 16:0011013 16:1510001 16:1540004 16:3002013 16:3030003 16:4500000 16:4521014 17:0000000 17:0040015 17:1501001 17:1511002 17:3001001 17:3001001 17:4510001 17:4520002 18:0000000 18:0000000 18:1500000 18:1500000 18:3000000 18:3000000 18:4510001 18:4510001 19:0010102 19:0000101 19:1500101 19:1500011 19:3000000 19:3000011 19:4500000 19:4500000 20:0000000 20:0010001 20:1500000 20:1500000 20:3000000 20:3000000 20:4500000 20:4500000 21:0000000 21:0000000 21:1500123 21:1500202 21:3000011 21:3000011 21:4500000 21:4500101 22:0010102 22:0010001 22:1500000 22:1500000 22:3000000 22:3000000 22:4500000 22:4500000 23:0000000 23:0000000 23:1500000 23:1500000 23:3000101 23:3000000 23:4500000 23:4500011 TOTAL 53 20 15 56 144 50 29 12 59 150 Counts Unlimited, Inc. PO Box 1178 Corona, CA 92878 (951) 268-6268 . . Item 3 Page 21 of 85 City: Location: Date: Count Type: Pass Veh Large 2 Axle 3 Axle 4+ Axle Total Pass Veh Large 2 Axle 3 Axle 4+ Axle Total 0:0000000 0:0000000 0:1500000 0:1500000 0:3000000 0:3000000 0:4500000 0:4500000 1:0000000 1:0000000 1:1500000 1:1500000 1:3000000 1:3000000 1:4500000 1:4500000 2:0000000 2:0000000 2:1500000 2:1500000 2:3000000 2:3000000 2:4500000 2:4500000 3:0000000 3:0000000 3:1500000 3:1500000 3:3000000 3:3000000 3:4510001 3:4500000 4:0010001 4:0000000 4:1500000 4:1500011 4:3000011 4:3000000 4:4500033 4:4500000 5:0000011 5:0000000 5:1500022 5:1500011 5:3000000 5:3000011 5:4540004 5:4510012 6:0001001 6:0000022 6:1500000 6:1500011 6:3010001 6:3000022 6:4530003 6:4500000 7:0010012 7:0000101 7:1500011 7:1511002 7:3010001 7:3000000 7:4510012 7:4500011 8:0011024 8:0000011 8:1510012 8:1500112 8:3011002 8:3000101 8:4510023 8:4510001 9:0010012 9:0010012 9:1520024 9:1510012 9:3000123 9:3000224 9:4520013 9:4520024 10:0000011 10:0000000 10:1520024 10:1500011 10:3010034 10:3010023 10:4510113 10:4520103 11:0030014 11:0020035 11:1501001 11:1500101 11:3000000 11:3000000 11:4500011 11:4531004 Exiting Vernon TOTALS Wednesday, October 11, 2023 Driveway Classification Entering Counts Unlimited, Inc. PO Box 1178 Corona, CA 92878 (951) 268-6268 . . Item 3 Page 22 of 85 City: Location: Date: Count Type: Pass Veh Large 2 Axle 3 Axle 4+ Axle Total Pass Veh Large 2 Axle 3 Axle 4+ Axle Total Exiting Vernon TOTALS Wednesday, October 11, 2023 Driveway Classification Entering 12:0001113 12:0001135 12:1500000 12:1510001 12:3030014 12:3010001 12:4520002 12:4501001 13:0020024 13:0000022 13:1500112 13:1500134 13:3000011 13:3020013 13:4500011 13:4500011 14:0010001 14:0010012 14:1501001 14:1500000 14:3000000 14:3000000 14:4510012 14:4520013 15:0010012 15:0000000 15:1501001 15:1510001 15:3001045 15:3000134 15:4501102 15:4510012 16:0021003 16:0002002 16:1500000 16:1550117 16:3000022 16:3020002 16:4500112 16:4540307 17:0000000 17:0010001 17:1500011 17:1510001 17:3000000 17:3000101 17:4520002 17:4510001 18:0000000 18:0000011 18:1500000 18:1510001 18:3000000 18:3020002 18:4500202 18:4500112 19:0000000 19:0010001 19:1500000 19:1510001 19:3000000 19:3000000 19:4500000 19:4500000 20:0000000 20:0000000 20:1500000 20:1500000 20:3000000 20:3000000 20:4500000 20:4500000 21:0000011 21:0000000 21:1500000 21:1500101 21:3000000 21:3000000 21:4500000 21:4500000 22:0000000 22:0000000 22:1500000 22:1500000 22:3000000 22:3000000 22:4500000 22:4500000 23:0000000 23:0000000 23:1500000 23:1500000 23:3000000 23:3000000 23:4500000 23:4500000 TOTAL 43 10 8 48 109 43 6 17 43 109 Counts Unlimited, Inc. PO Box 1178 Corona, CA 92878 (951) 268-6268 . . Item 3 Page 23 of 85 City: Location: Date: Count Type: Pass Veh Large 2 Axle 3 Axle 4+ Axle Total Pass Veh Large 2 Axle 3 Axle 4+ Axle Total 0:0000000 0:0000000 0:1500000 0:1500000 0:3000000 0:3000000 0:4500101 0:4500011 1:0000000 1:0000000 1:1500000 1:1500000 1:3000000 1:3000000 1:4500000 1:4500000 2:0000000 2:0000000 2:1500000 2:1500000 2:3000000 2:3000000 2:4500000 2:4500000 3:0000000 3:0000000 3:1500000 3:1500000 3:3000000 3:3000000 3:4510012 3:4500000 4:0000000 4:0000000 4:1500000 4:1500000 4:3010001 4:3000011 4:4500011 4:4500011 5:0000011 5:0000000 5:1500000 5:1500000 5:3000011 5:3000022 5:4510001 5:4500000 6:0020114 6:0000011 6:1500011 6:1500000 6:3000112 6:3000000 6:4500101 6:4500011 7:0032027 7:0000000 7:1520002 7:1510023 7:3010023 7:3010034 7:4522015 7:4501001 8:0000000 8:0000000 8:1510023 8:1500000 8:3010001 8:3000000 8:4510034 8:4500011 9:0020013 9:0010034 9:1521014 9:1511103 9:3010001 9:3010034 9:4500000 9:4500000 10:0000000 10:0000000 10:1500011 10:1500022 10:3001001 10:3000000 10:4500112 10:4501001 11:0020002 11:0030003 11:1501001 11:1510012 11:3000033 11:3020002 11:4511002 11:4502002 Exiting Vernon TOTALS Thursday, October 12, 2023 Driveway Classification Entering Counts Unlimited, Inc. PO Box 1178 Corona, CA 92878 (951) 268-6268 . . Item 3 Page 24 of 85 City: Location: Date: Count Type: Pass Veh Large 2 Axle 3 Axle 4+ Axle Total Pass Veh Large 2 Axle 3 Axle 4+ Axle Total Exiting Vernon TOTALS Thursday, October 12, 2023 Driveway Classification Entering 12:0021025 12:0032128 12:1530104 12:1520002 12:3010012 12:3000112 12:4500000 12:4500011 13:0010001 13:0020002 13:1520002 13:1521003 13:3000000 13:3000000 13:4500011 13:4530014 14:0000000 14:0000011 14:1500000 14:1510001 14:3030014 14:3030014 14:4510203 14:4500101 15:0001001 15:0001113 15:1510102 15:1500000 15:3000101 15:3020103 15:4500000 15:4500000 16:0000101 16:0010001 16:1500000 16:1500000 16:3000000 16:3030104 16:4500000 16:4510001 17:0000000 17:0020002 17:1500000 17:1500000 17:3010001 17:3000000 17:4500000 17:4530003 18:0000000 18:0010001 18:1500000 18:1500000 18:3000101 18:3000000 18:4500000 18:4500011 19:0000000 19:0000000 19:1500000 19:1510001 19:3010001 19:3011002 19:4500000 19:4500000 20:0000000 20:0000000 20:1500000 20:1500000 20:3000101 20:3000011 20:4500000 20:4500000 21:0000000 21:0000000 21:1500000 21:1500000 21:3000000 21:3000000 21:4500000 21:4500000 22:0000000 22:0000000 22:1500101 22:1500000 22:3000000 22:3000011 22:4500000 22:4500000 23:0000000 23:0000000 23:1500000 23:1500000 23:3000000 23:3000000 23:4500000 23:4500000 TOTAL4010142993 4210 7 3392 Counts Unlimited, Inc. PO Box 1178 Corona, CA 92878 (951) 268-6268 . . Item 3 Page 25 of 85 CEQA Class 2 Exemption – 5764 Alcoa Avenue Attachments Attachment C: Cultural Resources Assessment . . Item 3 Page 26 of 85 Cultural Resources Assessment for the 5764 Alcoa Avenue Project, City of Vernon, Los AngelesCounty, California . . Item 3 Page 27 of 85 Cultural Resources Assessment for the 5764 Alcoa Avenue Project, City of Vernon, Los Angeles County, California Prepared by: Chronicle Heritage Tiffany Clark, Ph.D., RPA Scott Torres, M.A. Prepared for: T&B Planning, Inc. 3200 El Camino Real, Suite 100 Irvine, CA 92602 Chronicle Heritage, LLC 55 East Huntington Drive Arcadia, California, 91006 December 8, 2023 . . Item 3 Page 28 of 85 Cultural Resources Assessment for the 5764 Alcoa Avenue Project i Management Summary The proposed 5764 Alcoa Avenue Project (Project) involves the development of a warehouse facility on approximately 7.12 acres of land (Assessor Parcel Numbers 6310-005-003, 6310-005- 004, 6310-005-009, and 6310-005-010) along Alcoa Avenue immediately north of East Slauson Avenue in the city of Vernon, Los Angeles County, California. The proposed Project would include the demolition of the existing warehouse buildings and associated structures and construction of an approximate 155,420 square foot warehouse building. PaleoWest LLC (dba Chronicle Heritage) was contracted to conduct a cultural resource assessment of the Project area in compliance with the California Environmental Quality Act (CEQA). The City of Vernon is the Lead Agency for CEQA compliance. This report summarizes the methods and results of the cultural resource assessment for the Project. The investigation included a record search, archival research, a site visit, and resource documentation and evaluation. The purpose of the investigation was to determine if the proposed Project will qualify for a Class 2 categorical exemption under CEQA. This report summarizes the methods and results of the cultural resource assessment for the Project. The investigation included a record search, archival research, a site visit, and resource documentation and evaluation. The purpose of the investigation was to determine if the proposed Project will qualify for a Class 2 categorical exemption under CEQA. As part of the background research, Chronicle Heritage conducted a records search at the South Central Coastal Information System to identify previously recorded cultural resources and studies located within 0.5-mile radius of the Project area. The records search indicated that no fewer than seven previous studies have been conducted within the record search area. Twenty-seven cultural resources have been documented within 0.5 mile of the Project area, all of which date to the historic period. No previously recorded cultural resources are mapped within the Project area. Chronicle Heritage conducted a survey of the proposed Project area on November 7, 2023. The results of the field work effort indicate that the property is fully developed with surficial deposits across the property disturbed by the construction of existing buildings and associated structures. No exposed native sediments were observed in the Project area. Archival research indicates that a railroad spur and a building were both constructed in the Project area by the early 1940s . Because the two resources are more than 45 years old, they meet the minimum age requirements for consideration as potential historical resources under CEQA. The resources were documented and evaluated for significance; the evaluation found that neither resource meets the criteria for listing on the California Register of Historical Resources. Given the extent of existing disturbance, along with the lack of known archaeological sites in the Project vicinity, the property contains a relatively low sensitivity for in situ buried archaeological deposits. Based on these results, Chronicle Heritage finds that the proposed Project will have no impact on known historical or archaeological resources under CEQA. No additional cultural resource management is recommended for the proposed Project. . . Item 3 Page 29 of 85 Cultural Resources Assessment for the 5764 Alcoa Avenue Project ii This page intentionally left blank. . . Item 3 Page 30 of 85 Cultural Resources Assessment for the 5764 Alcoa Avenue Project iii Contents 1 INTRODUCTION ........................................................................................................................... 1 1.1 PROJECT LOCATION AND DESCRIPTION .............................................................. 1 1.2 PROJECT PERSONNEL ........................................................................................ 1 1.3 REPORT ORGANIZATION ...................................................................................... 1 2 REGULATORY CONTEXT ............................................................................................................ 4 2.1 CALIFORNIA ENVIRONMENTAL QUALITY ACT ....................................................... 4 2.2 LOCAL ................................................................................................................ 5 3 NATURAL AND CULTURAL SETTING .......................................................................................... 6 3.1 NATURAL SETTING ............................................................................................. 6 3.2 CULTURAL SETTING ........................................................................................... 6 3.2.1 Prehistory................................................................................................ 6 3.2.2 Ethnography ............................................................................................ 8 3.2.3 History .................................................................................................... 9 4 CULTURAL RESOURCE INVENTORY ......................................................................................... 12 4.1 PREVIOUS CULTURAL RESOURCE INVESTIGATIONS .......................................... 12 4.2 PREVIOUSLY RECORDED CULTURAL RESOURCES ............................................. 12 4.3 HISTORIC MAPS AND AERIAL PHOTOGRAPHS ..................................................... 14 4.4 REVIEW OF PERMIT AND BUILDING RECORDS .................................................... 14 5 RESOURCE INVENTORY ............................................................................................................ 15 5.1 METHODS .......................................................................................................... 15 5.2 RESULTS ........................................................................................................... 15 5.2.1 Railroad Spur .......................................................................................... 15 5.2.2 5708 Alcoa Avenue ..................................................................................19 6 SUMMARY ................................................................................................................................ 23 7 REFERENCES CITED ................................................................................................................ 24 Appendices Appendix A. Records Search Results (Confidential) Appendix B. DPR Resource Forms Figures Figure 1-1. Project vicinity map. .................................................................................................... 2 Figure 1-2. Project area map. ........................................................................................................ 3 Figure 5-1. Overview of Project area from Alcoa Avenue showing modern building, facing northeast. .............................................................................................................. 16 Figure 5-2. Overview of graveled area in northwest corner of Project area, facing south. .............. 16 Figure 5-3. Resource location map. ............................................................................................. 17 Figure 5-4. View of in-use railroad spur (left) and abandoned railroad spur (far right) in northern Project areas, facing east. ......................................................................................18 Figure 5-5. East Façade of building at 5708 Alcoa Avenue, facing southeast. ............................... 20 Figure 5-6. East Façade showing addition on building at 5708 Alcoa Avenue, facing east. ............. 20 . . Item 3 Page 31 of 85 Cultural Resources Assessment for the 5764 Alcoa Avenue Project iv Tables Table 4-1. Previous Cultural Resource Studies within 0.5-Mile of the Project Area ........................ 12 Table 4-2. Previously Documented Cultural Resource Studies in 0.5 Mile of the Project Area ......... 13 Table 4-3. 5708 Alcoa Avenue Building Permit History ................................................................. 14 . . Item 3 Page 32 of 85 Cultural Resources Assessment for the 5764 Alcoa Avenue Project 1 1 Introduction PaleoWest, LLC (dba Chronicle Heritage) was retained by T&B Planning, Inc. to conduct a cultural resource assessment for the proposed 5764 Alcoa Avenue Project (Project) in the city of Vernon, Los Angeles County, California. The proposed Project involves the redevelopment of a 7.12-acre parcel in the southern extent of the city. The Project requires compliance with the California Environmental Quality Act (CEQA) with the City of Vernon (City) acting as the CEQA lead agency. The purpose of the cultural resource assessment is to provide information that will be used to determine if the proposed Project will qualify for a Class 2 categorical exemption under CEQA. This report summarizes the methods and results of the cultural resource investigations conducted for the proposed Project. 1.1 Project Location and Description The proposed Project lies along Alcoa Avenue immediately north of East Slauson Avenue in the city of Vernon (Figures 1-1 and 1-2). The Project area consists of four contiguous parcels (Assessor Parcel Numbers [APNs] 6310-005-003, 6310-005-004, 6310-005-009, and 6310-005-010) that total approximately 7.12 acres (Figure 1-2). More specifically, the Project area is in an unsectioned portion of Township 1 South, Range 13 West, San Bernardino Baseline and Meridian, as depicted on the South Gate, CA 7.5' U.S. Geological Survey (USGS) topographic quadrangle (Figure 1-2). The elevation of the Project area is approximately 170 feet above mean sea level. The Project proposes to construct an approximate 155,420 square foot (sf) warehouse building including 10,000 sf of office space on the approximate property. The warehouse building would provide 153 stalls for automobile parking, 7 stalls for truck trailer parking, 14 dock doors, and approximately 30,592 sf of landscaping. The Project would include demolition of the existing warehouse buildings and associated structures on the property that total approximately 145,877 sf. 1.2 Project Personnel Tiffany Clark, Ph.D., Register of Professional Archaeologists (RPA), Regional Principal Investigator at Chronicle Heritage, served as Principal Investigator and provided senior oversight, technical expertise, and was co-authored of the report. Scott Torres, M.A., Architectural Historian at Chronicle Heritage was responsible for conducting the historic built-environment survey and was the primary author of the report. Carrie Chasteen, M.S., Senior Architectural Historian, completed the record search of the South Central Coastal Information Center (SCCIC) and conducted senior technical review of the report. Brian Spelts served as the GIS analyst. 1.3 Report Organization This report documents the results of the cultural resource assessment conducted for the proposed Project. Chapter 1 has introduced the Project location and description. Chapter 2 states the regulatory context for the Project. Chapter 3 synthesizes the natural and cultural setting of the Project area and surrounding region. The results of the previous cultural investigations are presented in Chapter 4. The field methods employed during this investigation and the findings are presented in Chapter 5. Management recommendations are provided in Chapter 6. These are followed by bibliographic references and appendices. . . Item 3 Page 33 of 85 Cultural Resources Assessment for the 5764 Alcoa Avenue Project 2 Figure 1-1. Project vicinity map. . . Item 3 Page 34 of 85 Cultural Resources Assessment for the 5764 Alcoa Avenue Project 3 Figure 1-2. Project area map. . . Item 3 Page 35 of 85 Cultural Resources Assessment for the 5764 Alcoa Avenue Project 4 2 Regulatory Context This section includes a discussion of the applicable laws, ordinances, regulations, and standards governing cultural resources that may pertain to the proposed Project. 2.1 California Environmental Quality Act The proposed Project is subject to compliance with CEQA, as amended. Compliance with CEQA statutes and guidelines requires both public and private projects with financing or approval from a public agency to assess the project’s impact on cultural resources (Public Resources Code Section 21082, 21083.2 and 21084 and California Code of Regulations 10564.5). The first step in the process is to identify cultural resources that may be impacted by the project and then determine whether the resources are “historically significant” resources. CEQA defines historically significant resources as “resources listed or eligible for listing in the California Register of Historical Resources (CRHR)” (Public Resources Code Section 5024.1). A cultural resource may be considered historically significant if the resource is 45 years old or older and possesses integrity of location, design, setting, materials, workmanship, feeling, and association.1 In addition, it must meet any of the following criteria for listing on the CRHR: 1. Is associated with events that have made a significant contribution to the broad patterns of California’s history and cultural heritage; 2. Is associated with the lives of persons important in our past; 3. Embodies the distinctive characteristics of a type, period, region, or method of construction, or represents the work of an important creative individual, or possesses high artistic values; or, 4. Has yielded, or may be likely to yield, information important in prehistory or history (Public Resources Code Section 5024.1). Cultural resources are buildings, sites, humanly modified landscapes, traditional cultural properties, structures, or objects that may have historical, architectural, cultural, or scientific importance. A resource can also be determined historically significant under CEQA by virtue of being included in a local register of historical resources regardless of CRHR eligibility (see Title 14 CCR §15064.5(a)(2)). CEQA states that if a project will have a significant impact on important cultural resources, deemed “historically significant,” then project alternatives and mitigation measures must be considered. Additionally, the Office of Historic Preservation (OHP) may choose to comment on the CEQA compliance process for specific local government projects in an informal capacity but does not seek to review all projects that may affect historically significant cultural resources under CEQA provisions. 1 The Office of Historic Preservation (OHP) guidelines recognize a 45-year-old criteria threshold for documenting and evaluating cultural resources (assumes a 5-year lag between resource identification and the date that planning decisions are made) (OHP 1995:2). The age threshold is an operational guideline and not specific to CEQA statutory or regulatory codes. . . Item 3 Page 36 of 85 Cultural Resources Assessment for the 5764 Alcoa Avenue Project 5 2.2 Local The City has goals and policies related to historic preservation in the Resource Element of their General Plan (City of Vernon 2015). The following presents the goals and policies related to cultural resources. GOAL R-4 Recognize and preserve Vernon’s contributions to the industrial and architectural history of Los Angeles. POLICY R-4.1: Expand available cultural resource information by establishing a City- maintained database of historic sites and facilities. POLICY R-4.2: Support the efforts of interested agencies or private organizations to undertake surveys or other research efforts to document buildings and places in Vernon of historic and/or architectural significance. POLICY R-4.3: Ensure compliance with CEQA provisions regarding cultural resources at the time buildings or places of identified or potential historic or architectural merit are proposed for demolition. POLICY R-4.4: Establish local programs and practices that recognize places of local or other historic significance. . . Item 3 Page 37 of 85 Cultural Resources Assessment for the 5764 Alcoa Avenue Project 6 3 Natural and Cultural Setting 3.1 Natural Setting The Project area is in the Los Angeles Basin, a sedimentary depression currently composed of coastal lowlands areas. The Los Angeles Basin can be further divided into four structural blocks: the northeastern block, the northwestern block, the central block, and the southwestern block. The Project area is on the northern edge of the southwestern block of the Los Angeles Basin, which is bounded on the north by the Santa Monica system and on the east by the Newport- Inglewood fault system. The southwestern block is underlain by late Jurassic to late Cretaceous basement rocks that form anticlinal ridges on top of which thick, mostly marine younger geologic units have been deposited since the Oligocene (33.9 to 23 million years ago) (Norris and Webb 1990). Prior to the development of the area, the dominant plant community consist of coastal sage scrub, freshwater and salt marshes, and riparian woodlands. Common flora found within a coastal sage scrub community consist of California sagebrush (Artemisia californica), black sage (Salvia mellifera), white sage (Salvia apiana), California buckwheat (Eriogonum fasciculatum), coast brittle- bush (Encelia californica), golden yarrow (Eriophyllum confertifolium), and lemonade berry (Rhus integrifolia). 3.2 Cultural Setting 3.2.1 Prehistory The most widely used chronological sequence in the Project vicinity distinguishes Early, Middle, and Late periods. It was initially outlined by King (1981) and later revised to include additional radiocarbon dates (King 1990) and to incorporate refinements in our understanding of cultural developments (Arnold 1992). Early Holocene Archaeological data compiled over the last two decades indicate that initial settlement along the coast of Southern California began at least 12,000 years before present (B.P.). Some of the earliest evidence of human occupation specifically derives from Daisy Cave (CA-SMI-261) on San Miguel Island where radiocarbon samples date the oldest cultural layer at the site between 11,550–10,950 cal B.P. (Erlandson et al. 1996). In the Southern California coastal region, the discovery of fluted projectile points indicates human use of the area possibly as early as possibly 13,000 B.P. (Erlandson et al. 1996; Stickel 2010), while sites on San Miguel and Santa Rosa islands have yielded radiocarbon dates older than 10,000 B.P. (Erlandson 1991; Johnson et al. 2001). However, few known sites date to this earliest period (i.e., pre-10,000 B.P.) and relatively few sites have been identified specifically within the Los Angeles Basin that date to the early Holocene. The earliest evidence of human occupation in the Los Angeles region is represented by a set of female human remains that were discovered in association with a handstone in the tar pits of Rancho La Brea in 1914 (Merriam 1914). Possible low population densities may explain the scarcity of sites dating to the early Holocene in the region, but the few known sites do suggest that they tend to be on elevated landforms, and their presence on the Northern Channel Islands indicates early knowledge and use of marine resources. Diagnostic tools associated with this period for coastal California have not been identified and . . Item 3 Page 38 of 85 Cultural Resources Assessment for the 5764 Alcoa Avenue Project 7 cultural assemblages dating to this period have fewer of the grinding implements common to subsequent periods. Research suggests that inhabitants of this period lived in small groups that had a relatively egalitarian social organization and a forager-type land-use strategy (Erlandson 1994; Glassow 1996; Greenwood 1972; Moratto 1984). Middle Holocene Shortly after 9,000 B.P., sites in the coastal region begin to be characterized by an abundance in milling tools, and the broader subsistence regime, including use of plants and seeds, terrestrial animals, and shellfish (Glassow 1996; Glassow et al. 1988; Sutton and Gardner 2010). Increasing populations composed of small, dispersed groups with more generalized tool kits, and a mixed subsistence regime indicating a heavier reliance on shellfish than on fish and terrestrial food sources are also identifiers of the period (Erlandson 1991, 1994, 1997). Population densities appear to have decreased substantially between 6500–5000 B.P. throughout the region, and little is known about this period. It has been suggested that the arid conditions associated with the Altithermal (a mid-Holocene period of predominantly warm/dry climate) damaged the environment to the point that only low population densities were sustainable (Glassow 1996; Glassow and Wilcoxon 1988). After 5000 B.P., population densities increased significantly as conditions became cooler and moister. Between 5000–3000 B.P., mortars and pestles became increasingly common throughout the region, suggesting intensified use of acorns (Basgall 1987) and possibly the pulpy roots or tubers (Glassow 1997). Large side-notched and stemmed projectile points became more prevalent, presumably reflecting increased hunting. 1996). Coastal and inland sites of this period exhibit shallow midden accumulations, suggesting seasonal camping. Based on the distribution of sites assigned to this period, larger groups likely occupied a base camp during a portion of the year, while smaller groups of people used satellite camps to exploit seasonally available floral resources such as grass seeds, berries, tubers, and nuts (cf. Binford 1980; Warren 1968). Site assemblages in coastal Southern California dating to this time contain numerous manos and metates, charmstones, cogged stones, discoidals, and some stone balls. A significant technological change in ground stone is seen at this time with the appearance of mortars and pestles which suggests the adoption of acorn, nut, and seed processing by coastal groups (Sutton and Gardner 2010). The quantity of projectile points also increases during this time, indicating a subsistence shift toward greater reliance on large game. Burial practices also suggest that society was primarily egalitarian (Glassow 1996). Secondary burials among coastal communities continue to be the dominant mortuary regime with a smaller number of flexed inhumations during the Middle Holocene. Late Holocene Cultural complexity appears to have increased around 3000–2500 B.P. Mortuary data research suggests a substantial change in social organization and political complexity during this period (King 1990). According to King, high-status positions became hereditary and individuals began to accumulate wealth and control exchange systems. Arnold (1991, 1992) proposes that this evolutionary step in socioeconomic complexity occurred around 700–800 B.P. Technological innovation as well as a continued increase in cultural complexity marks the period between 2,500 and 800 B.P. Fishing and sea mammal hunting became increasingly important. This corresponds to the development of the tomol (plank canoe), single-piece shell fishhooks, and harpoons (Glassow 1996; King 1990). In addition, the bow and arrow were introduced during this period. Use of imported obsidian continued to increase during this period as well (Jones et al. 2007). . . Item 3 Page 39 of 85 Cultural Resources Assessment for the 5764 Alcoa Avenue Project 8 A number of these new cultural traits have been thought to be attributable to the arrival of Takic speaking people from the southern San Joaquin Valley in the coastal California region (Sutton 2009). Biological, archaeological, and linguistic data indicate that the Takic groups who settled in the Los Angeles Basin were ethnically distinct from the indigenous Hokan-speaking Topanga populations. These Takic speakers are believed to be ancestral to the ethnographic Gabrielino groups (Sutton 2009). Due to the archaeological evidence gathered it is suggested that Hokan-speaking groups were largely replaced or subsumed by the Gabrielino and Chumash by 2000 B.P. (Sutton and Gardner 2010). Several new types of material cultural appear in the archaeological record during 700 B.C.– A.D. 1800, including the presence of Cottonwood series points, birdstone and “spike” effigies, Olivella cupped beads, and Mytilus shell disk beads. Additionally, the presence of Southwestern pottery, Patayan ceramic figurines, and Hohokam shell bracelets at some of these later sites suggests interaction between populations in Southern California and the Southwest. Additionally, potential changes in trade networks at this time may be evidenced by an increase in the number and size of steatite artifacts, including large vessels, elaborate effigies, and comals in the archaeological record. 3.2.2 Ethnography The prehistory of California’s coast spans the entire Holocene and may extend back to late Pleistocene times. At the time of contact however, the ethnographic record indicates that the Gabrielino populations inhabited what is now known as the Los Angeles Basin and the Project region. Traditionally, the Gabrielino occupied a large territory, including the entire Los Angeles Basin, the coast from Malibu to Aliso Creek, parts of the Santa Monica Mountains, the San Fernando Valley, the San Gabriel Valley, the San Bernardino Valley, the northern part of the Santa Ana Mountains, and much of the middle and lower Santa Ana River reaches. In addition, the Gabrielino also inhabited the islands of Santa Catalina, San Clemente, and San Nicolas. The Gabrielino language was a Cupan language which is part of the Takic language family and part of a larger language group called Uto-Aztecan (Harrington 1981, Kroeber 1925). It is believed that more than 50 communities with populations that ranged from 50–150 individuals inhabited the traditional territory of the Gabrielino pre-contact. Each autonomous community or village consisted of one or more patrilineages that maintained permanent placement and the maintenance of surrounding hunting and gathering areas, and ceremonial sites as well. The chief, his family, and elite members were typically the epicenter of the village sites. The village members would encompass and surround the homes of the chief and elite with smaller houses/structures. Other common structures found in Gabrielino villages included sweathouses, clearings for ceremonies and playing fields, as well as cemeteries or burial grounds (McCawley 1996:32–33). Management of food and resources was implemented by the chief and food stores were also kept for each family when supply was low. The material culture of the Gabrielino is elaborate and has been compared to that of the Chumash. Sources including Padre Geronimo Boscana’s accounts (Boscana 1846), Hugo Reid’s 1852 letters to the Los Angeles Star (Reid and Heizer 1968), and Harrington’s (Harrington 1981) early twentieth century interviews describe the common use of shell ornaments and beads, baskets, bone tools, flint weapons and drills, fishhooks, mortars and pestles, wooden bowls and paddles, shell spoons, wooden war clubs, and a variety of steatite items (cooking vessels, comals, ornaments) as many of artifact types common in descriptions of Gabrielino culture (Blackburn 1963). Additionally, artesian development has been observed in the artifact assemblage with the implementation of inlaid with shell (using asphalt) and in the steatite items from production centers on Catalina Island. . . Item 3 Page 40 of 85 Cultural Resources Assessment for the 5764 Alcoa Avenue Project 9 Trade was an important element of the Gabrielino economy. Although the principal Gabrielino- produced commodity—steatite vessels from centers on Catalina Island—originated well outside the defined study region, trade in steatite items was conducted throughout local territory and involved external relations with desert, Southwestern, mountain, and coastal groups beyond Gabrielino borders (Kroeber 1925). Subsistence resources were also supplemented by additional supplies of deer skins, seeds, and acorns from interior groups such as the Serrano (Kroeber 1925:629). Additionally, Olivella shell callus beads, manufactured on the northern Channel Islands by the Chumash and their predecessors, were reportedly used quite frequently as a currency or as a status symbol by the Gabrielino and other Southern California groups. As described in ethnographic sources, the subsistence resource base for the Gabrielino people included native grass seeds, six or more types of acorns, pinyon pine nuts, seeds and berries from various shrubs, fresh greens and shoots, mule deer, pronghorn, mountain sheep, rabbits and rodents, quail and waterfowl, snakes, lizards, insects, and freshwater fish, plus a wide variety of marine fish, shellfish, and sea mammals in coastal zones. Resource exploitation techniques were also described in ethnographic accounts and include rabbit drives in conjunction with seasonal controlled burning of chaparral, and the use of throwing sticks or nets in the capture of waterfowl in the low-lying marshlands. Reed rafts may have been employed for marshland hunting (Priestley 1937). The first contact between the Europeans and the Gabrielino is thought to have occurred in 1542 when Juan Rodriguez Cabrillo’s small fleet arrived at Santa Catalina Island when the Spanish exploration of North America began in the early 1500s, and Juan Rodriguez Cabrillo began exploring the Alta California coastline in 1542. Additionally, contact with the Gabrieleno by the Spanish likely occurred again in 1602 with the Sebastían Vizcaíno expedition (McCawley 1996:207) and in 1769 with the Gaspar de Portolá expedition. Mission San Gabriel was founded on September 8, 1771, but moved to its present location around 1774, due to the second location consisting of more suitable land for agriculture. A second mission, San Fernando, was established within Gabrielino territory in 1797. The assimilation of the Gabrielino people into the mission system had gross negative affect on the traditional Gabrielino communities as they were depopulated, had become estranged from many of their traditional cultural practices, their lands, political autonomy, and had even become enslaved and even killed, and suffered from epidemics caused by the introduction of European diseases further reduced the indigenous population. Between 1832 and 1834, as the primary result of secularization of the former mission lands, which was theoretically designed to turn over ownership of some of the lands back to the Native peoples of California, consequently increased the displacement of the Gabrielino (McCawley 1996:208). The establishment of California as a state in 1850 brought further hardships to the Gabrielino, forcing many to eventually settle into smaller groups of Native American and Mexican settlements in places like the Eagle Rock and Highland Park districts of Los Angeles as well as in Pauma, Pala, Temecula, Pechanga, and San Jacinto. 3.2.3 History Spanish exploration of North America in the early 1500s marked some of the first European contact with the indigenous peoples in the Los Angeles area. The mission system was established by the Catholic Church and the Spaniards to settle, colonize the Native Americans to utilize their labor to develop the lands, and spread Catholicism from Baja California to what is known today as northern California. The first mission was established in 1769 in present-day San Diego. The mission system’s goal was for each mission to be self-sustaining. This required the conversion of indigenous peoples to claim lands in the name of Spain and required the Native American . . Item 3 Page 41 of 85 Cultural Resources Assessment for the 5764 Alcoa Avenue Project 10 population to grow crops, raise livestock, and sustain the mission settlement and provide commodities for trade. The Mission San Gabriel Archangel was the fourth mission established in Alta California in 1771. The Native Americans that traditionally inhabited the region of the Project were assimilated into the Mission San Gabriel. In addition to establishing the mission system in 1779, Spanish settlement of Alta California also included the establishment of pueblos and presidios. These settlements were used as bases from which to colonize the rest of California. The Spanish also laid out pueblos, or towns along the coast. Providing supplies, animals, and colonists to the Spanish missions and presidios by way of ship was difficult, time-consuming, expensive, and dangerous. Thus, an overland route was necessary to initiate a strong colonizing effort in Alta California. The city of Los Angeles was initially established by a mixed group of settlers, known as the Pobladores, as a pueblo in 1781 (Starr 2005:37). The original site of the plaza was constructed within the Los Angeles River floodplain but was moved to its current location after flooding a quickly became a center for economic, political, and social/cultural activities. Although much of the land in California was under the supervision of the Spanish missions, the Spanish government also granted lands to individuals who had served the government (Beedle et al. 2008). Portions of present-day city of Vernon were part of a 29,513-acre land grant, known as Rancho San Antonio, which was given to Corporal Antonio Maria Lugo in 1810 (Avina 1932; Barrows 1896). Mexico achieved independence from Spain in 1821. In 1838, the Mexican Governor Juan B. Alvarado confirmed the land grant to Antonio Maria Lugo. The Mexican–American War, also known as the Mexican War, took place between 1846 and 1848. One key battle in the war – the Battle of La Mesa –was fought in the Project vicinity on January 9, 1847. During the battle, the U.S. General Stephen W. Kearny defeated the Mexican General José María Flores, who later fled southeast to Sonora. With the signing of the Treaty of Guadalupe- Hidalgo on February 2, 1848, California formally became an American territory, and two years later, on September 9, 1850, California became the thirty-first state in the Union. Prior to becoming a state, California was divided into 27 counties, and Los Angeles was one of them. In those two years (1848–1850) there was an influx of Americans to California seeking their fortunes, triggered by James Marshall’s 1848 discovery of gold at Sutter’s Mill. However, statehood and an extensive drought in the 1860s eventually ended the prosperity of the ranchos (Beedle et al. 2008). Development boom also occurred with the establishment of rail lines in California that made stagecoach companies obsolete. The establishment of a Southern Pacific Railroad and its completed Los Angeles route in 1880 and the Santa Fe Railway in 1886. Banning also successfully lobbied for a branch of the Southern Pacific Railroad to connect the port to Los Angeles. The establishment of these rail lines further boosted Los Angeles’ role in the economic development of Southern California and the United States (Starr 2005:114–118). The city of Vernon was founded in 1905 by ranchers James J. and Thomas J. Furlong and John B. Leonis, a merchant (City of Vernon 2023). Recognizing the importance of the three major railroads running through the area, Leonis persuaded railroad executives to run a network of spur tracks off the main rail lines in the area southeast of downtown Los Angeles. Known as the first "exclusively industrial" city in the southwestern United States, Leonis named the new city after a dirt road, Vernon Avenue, which crossed its center. As industry slowly developed in the area, the founders of the city decided to market Vernon as a "Sporting Town." In 1907, on land leased from Leonis, an entrepreneur named Jack Doyle opened the Vernon Avenue Arena where 20-round world championship fights were held starting in 1908 . . Item 3 Page 42 of 85 Cultural Resources Assessment for the 5764 Alcoa Avenue Project 11 (City of Vernon 2023). Soon after, the Pacific Coast League built a ballpark for baseball. The Vernon Tigers won three Consecutive league pennants. After 1919, Vernon returned to being exclusively industrial (City of Vernon 2023). With the opening of two giant stockyards, meat packing quickly became the City’s signature industry. In the 1920s and 30s, heavy industries such as steel (U.S. and Bethlehem), aluminum (Alcoa), glass (Owens), can- making (American Can) and automobile production (Studebaker) grew in the city. The 1940s and 1950s added aerospace contractors (Norris Industries), box and paper manufacturers, drug companies (Brunswig), and food processors (General Mills, Kal Kan) (Los Angeles Daily News 1943). Giant meat packers (Farmer John and Swift) continued to grow. Throughout the twentieth century, Vernon’s industries have changed ðĊīÐĮĨďĊĮÐĴď broader economic changes in Southern California. However, the ity has maintained its focus on providing a favorable environment for business and remains an ideal location for industry (City of Vernon 2023). Today, Vernon houses more than 1,800 businesses that employ approximately 50,000 people, serving as a vital economic engine in the region (City of Vernon 2023). . . Item 3 Page 43 of 85 Cultural Resources Assessment for the 5764 Alcoa Avenue Project 12 4 Cultural Resource Inventory Chronicle Heritage conducted an in-person records search at the SCCIC, housed at California State University, Fullerton on November 6, 2023. This inventory effort included the Project area along with a corresponding 0.5-mile buffer, collectively termed the records search area. The objective of the SCCIC records search was to identify cultural resources that have been previously recorded within the records search area during prior investigations. As part of the cultural resources inventory, Chronicle Heritage staff also conducted archival research to characterize the developmental history of the Project area, A summary of the results of the record search and background research is provided below. 4.1 Previous Cultural Resource Investigations The data review indicates that no fewer than seven previous investigations have been conducted within 0.5 mile of the Project area since 1994 (Table 4-1). None of the prior cultural resource studies included the Project area. A map showing the location of the prior cultural studies is provided in Appendix A. Table 4-1. Previous Cultural Resource Studies within 0.5-Mile of the Project Area Report Number Author Year Title LA-3408 Stickel, E. Gary 1994 A Cultural Resource Literature Search for the Rio Hondo Water Reclamation Program LA-04834 Jones & Stokes Associates, Inc. 1999 Cultural Resources Inventory Report for Williams Communications, Inc. Proposed Fiber Optic Cable System Installation Project, Los Angeles to Anaheim, Los Angeles and Orange Counties, California LA-06357 Christy, Juliet L. 2001 Malburg Generating Station Project, Vernon, California LA-09638 Wlodarski, Robert 2009 Proposed Bechtel Wireless Telecommunications Site EL 0324 (Leonis Substation) LA-10539 Parsons 2003 Malburg Generating Station Cultural Resources Inventory and Evaluation Report LA-10962 Bonner, Wayne 2011 Cultural Resources Records Search and Site Visit Results for AT7T Mobility, LLC Facility EL 0324-02, USID 103391 LA-12987 Brunzell, David 2014 Cultural Resources Assessment of the Compton College Project, Long Beach, Los Angeles County, California (BCR Consulting Project No. TRF1415) 4.2 Previously Recorded Cultural Resources The review of the record search data indicate that 27 cultural resources have been previously documented within 0.5 mile of the Project area (Table 4-2). All these resources date to the historic period and include 25 buildings, 1 structure, and 1 district. No prehistoric archaeological resources were identified within the record search area. None of the documented historic-era resources are in the proposed Project area. A map showing the locations of the resources are provided in Appendix A. . . Item 3 Page 44 of 85 Cultural Resources Assessment for the 5764 Alcoa Avenue Project 13 Table 4-2. Previously Documented Cultural Resource Studies in 0.5 Mile of the Project Area Primary No. Resource Type Resource Description P-19-186110 Structure Union Pacific Railroad P-19-188181 Building Huntington Park High School Pool Building P-19-188728 District Vernon Historic District P-19-188736 Building Commercial building at 3089 East Slauson Avenue P-19-188737 Building Commercial building at 5800 South Boyle Avenue P-19-188738 Building Commercial building at 6001 State Street P-19-188739 Building Single-family residence at 6009 State Street P-19-188740 Building Commercial building at 6013 State Street P-19-188741 Building Multi-family residence at 6023 State Street P-19-188742 Building Multi-family residence at 3081 East 60th Place P-19-188743 Building Commercial building at 6069 State Street P-19-188744 Building Commercial building at 5008 South Boyle Avenue P-19-188745 Building Multi-family residence at 3210 Randolph Street P-19-188746 Building Multi-family residence at 6003 Hood Avenue P-19-188747 Building Multi-family residence at 6204 Hood Avenue P-19-188748 Building Multi-family residence at 3264 Randolph Street P-19-188749 Building Commercial building at 5503 South Boyle Avenue P-19-188750 Building Commercial building at 5511 South Boyle Avenue P-19-188751 Building Commercial building at 5601 South Boyle Avenue P-19-188752 Building Commercial building at 5215 South Boyle Avenue P-19-188753 Building Industrial building at 3200 Fruitland Avenue P-19-188754 Building Commercial building at 5401 South Boyle Avenue P-19-188755 Building Commercial building at 5100 South Boyle Avenue P-19-188756 Building Commercial building at 3063 Fruitland Avenue P-19-188758 Building Commercial building at 5875 South Boyle Avenue P-19-188759 Building Multi-family residence at 6203 Newell Street P-19-188760 Building Commercial building at 6061 State Street . . Item 3 Page 45 of 85 Cultural Resources Assessment for the 5764 Alcoa Avenue Project 14 4.3 Historic Maps and Aerial Photographs Historical topographic maps and aerial photographs were reviewed as part of the background research. Historic maps that were consulted include the Downey, CA (1896, 1902, 1942) 15-minute, Southern California Sheet 1, CA (1901, 1904) 1 degree x 2 degrees, Watts, CA (1923, 1924, 1937) 7.5- minute, Fruitland, CA (1943) 30-minute, and South Gate, CA (1949, 1952, 1964, 2012) 7.5-minute USGS topographic quadrangles. Aerial photographs available at NETROnline (2023) dated 1948, 1952, 1963, 1972, 1980, 1987, 1988, 1991, 1992, 1993, 1994, 1995, 1996, 1997, 1998, 1999, 2000, 2003, 2004, 2005, 2009, 2010, 2012, 2014, 2016, 2018, and 2020 were also reviewed. In the late 1900s, the Los Angeles Terminal Line of the Union Pacific Railroad had been constructed east of the Project. Although no development is present in the Project area, scattered buildings and roadways are shown in the vicinity, including the community of Fruitland to the north (USGS 1896). By the early 1920s, a series of railroad spurs had been constructed that ran west from the Union Pacific Railroad north of Slauson Avenue; sections of two of these spurs lie in the Project area. A 1924 map depicts two buildings in the Project area (USGS 1924). By 1937, the Project area contained seven buildings with a transmission line running along its eastern boundary (USGS 1937). The earliest aerial photograph of the Project area dates to 1948 and shows the property as fully developed with a complex of industrial buildings and the railroad spur (NETROnline 2023). Additional buildings were constructed in the 1950s and 1960s. Most of these buildings were demolished between 1993 and 1994 with only three buildings remaining in the northwestern extent of the Project area (5700, 5704, and 5708 Alcoa Avenue) (NETROnline 2023). New industrial buildings appear in the northeast and southern portions of the Project area in the late 1990s. Although the original buildings at 5700 Alcoa Avenue and 5704 Alcoa Avenue were demolished after 2020, the building at 5708 Alcoa Avenue is still standing. 4.4 Review of Permit and Building Records The Los Angeles County Assessor records revealed that the extant building at 5708 Alcoa Avenue was constructed in 1941. Because the original building permit from the City could not be located, the architect associated with the building design and the contractor associated with construction are not known. A newspaper article indicates the building sustained substantial fire damage in 1945 and may have been re-constructed (Pasadena Star News 1945). No building permits were found that identified re-construction or repairs associated with fire damage. The permit record includes alterations that took place between 1976 and 2016 (Table 4-3). City building permit records indicate a second fire took place sometime between 2015 and 2016. No information regarding the fire was found in local newspaper publications. Table 4-3. 5708 Alcoa Avenue Building Permit History Permit No. Year Work Completed 31365 1976 Permit issued to complete a roof repair. N/A 1977 Permit issued for inspection to determine compliance with City ordinance. 43428 1977 Permit issued to foundation support repair. 52057 1985 Permit issued to add a T-bar to office ceiling. B-2016-1520 2016 Permit issued to replace charred rafters and roofing material due to fire damage. B-2016-1645 2016 Permit issued to complete a roofing repair associated with fire damage. . . Item 3 Page 46 of 85 Cultural Resources Assessment for the 5764 Alcoa Avenue Project 15 5 Resource Inventory 5.1 Methods Mr. Torres conducted a site visit of the Project area on November 7, 2023. As part of this field work effort, the current site conditions were assessed, including the extent of exposed ground surface across the subject parcel. Notes and photographs of the standing buildings, as well as overviews of the Project site, were taken during the visit. 5.2 Results Results of the field visit indicate that the Project area is fully developed. No areas of undisturbed native ground surface were present in the Project area. Much of the ground surface is obscured by extant buildings, pavement, and gravel (Figure 5-1 and 5-2). Based on these findings, Chronicle Heritage concluded that an archaeological survey of the Project area was not warranted. Chronicle Heritage documented two historic-era resources in the Project area – the Union Pacific Railroad spur and the commercial building at 5708 Alcoa Avenue (Figure 5-3). Archival information indicates that the railroad spur was in use by the early 1920s (USGS 1923) with the building constructed in 1941 (Los Angeles County Assessors 2023). Because the spur and building are more than 45 years of age, they meet the minimum age guidelines to be considered a historic property under the CRHR. A description and significance evaluation of the two historic-era resources are provided below. Department of Parks and Recreation 523 forms are included in Appendix B. 5.2.1 Railroad Spur This resource consists of portions of an intact and aban doned railroad spur track located north of East Slauson Avenue and south of Fruitland Avenue (Figure 5-3). Based on historic topographic maps, the structure was constructed by 1923 and was one of a series of railroad spurs in this area that ran west from the Union Pacific Railroad to access industrial and commercial businesses. The intact spur track measures approximately 320 feet in length and consists of a single standard gauge set of tracks with wooden ties; the spur runs in a northwest-southeast direction with the track terminating at the edge of a transmission line easement (Figure 5-3). A hand switch just east of Alcoa Avenue appears to have been used to direct rail cars off the main spur into an adjacent oil and lubricant manufacturing facility (Figure 5-4). A second set of tracks branches off from the main spur immediately east of Alcoa Avenue and runs in an arc for a distance of 380 feet. The tracks have been partially paved over with only the rails visible from the ground surface. The railroad spurs are associated are part of the Union Pacific and San Pedro, Los Angeles, & Salt Lake Railroad. The San Pedro, Los Angeles & Salt Lake Railroad Company, incorporated in Utah on March 20, 1901. The railroad operated between Los Angeles and Salt Lake City via Las Vegas. It originated as a small line, the Los Angeles Terminal Railway, which was incorporated in 1890. The San Pedro, Los Angeles & Salt Lake Railroad was owned by the U.S. Senator from Montana, William Andrews Clark. Competition between the San Pedro, Los Angeles & Salt Lake Railroad and the Union Pacific Railroad to build a route between Southern California and Salt Lake through Las Vegas ended in 1903 when Senator Clark sold Union Pacific Railroad a half interest in the San Pedro, Los Angeles & Salt Lake and its subsidiaries. The two companies agreed to proceed jointly in the construction of the line. In May 1905, construction of the main line was completed between Los Angeles and Las Vegas and from Salt Lake City to Las Vegas. A joint trackage agreement . . Item 3 Page 47 of 85 Cultural Resources Assessment for the 5764 Alcoa Avenue Project 16 Figure 5-1. Overview of Project area from Alcoa Avenue showing modern building, facing northeast. Figure 5-2. Overview of graveled area in northwest corner of Project area, facing south. . . Item 3 Page 48 of 85 Cultural Resources Assessment for the 5764 Alcoa Avenue Project 17 Figure 5-3. Resource location map. . . Item 3 Page 49 of 85 Cultural Resources Assessment for the 5764 Alcoa Avenue Project 18 Figure 5-4. View of in-use railroad spur (left) and abandoned railroad spur (far right) in northern Project areas, facing east. allowed the railroad to use Atchison, Topeka & Santa Fe Railway tracks over the Cajon Pass. San Pedro was dropped from the corporate name effective August 25, 1916. On April 27, 1921, Union Pacific purchased the remaining half of Senator Clark's holdings in the railroad. The Los Angeles and Salt Lake remained the official name of the "Salt Lake Route," until it was formally merged into the Union Pacific (effective January 1, 1988). CRHR Evaluation A previous evaluation of the Union Pacific railroad system was completed by Jones and Stokes (Ashkar 1999). The evaluation concluded that the entire railroad system in the Los Angeles area was eligible for listing in the National Register of Historic Places (NRHP) under criteria A and B. As the railroad was determined eligible for listing on the NRHP, it is automatically eligible for listing on the California Register of Historic Places (CRHR) under criterion 1 and 2. However, the portions of the rail line in the Project area does not appear to be significant. The following presents a CRHR evaluation of the switch track and spur lines in which the potential of the features to contribute to the overall eligibility of the railroad property is assessed. Criterion 1 A review of historic aerial images and topographic maps indicates that the spur lines were constructed by the early 1920s to service the industrial businesses along Alcoa Avenue. The spur no longer appears to be operational and at least one segment has been partially paved over. Aside from the rails, ties, and manual switch, no other railroad-related features are associated with the resource. No information was found to indicate that this minor section of railroad and spur line was historically significant in local, statewide, or national contexts. Because the spur was built . . Item 3 Page 50 of 85 Cultural Resources Assessment for the 5764 Alcoa Avenue Project 19 after the construction of the Union Pacific Railroad, it cannot be associated with any events that have made a significant contribution to the broad patterns of local or regional history. Therefore, the railroad spur does not appear to contribute to the overall eligibility of the Union Pacific Railroad under CRHR Criterion 1. Criterion 2 Although the Union Pacific Railroad is eligible under Criterion 2 for its association with the lives of persons who are important in our past, the individuals who built the spur or sponsored its construction are not known. Because no known individuals significant to the past are associated with the construction or operation of the railroad spur, the resource does not appear to contribute to the overall eligibility of the Union Pacific Railroad under CRHR Criterion 2. Criterion 3 The spur is no longer in use with portions of the tracks having been paved over. No evidence was found in the archival records to suggest that the spur was designed by a master engineer. Additionally, no evidence was found to suggest that the builders employed unusual or unique construction techniques. All indications are that the techniques and materials used were typical of railroad spurs of the time. The railroad spur does not embody the distinctive characteristics of a type, period or method of construction, or represent the work of a master, or possess high artistic values, or possess any significant distinguishable components. Therefore, the railroad spur does not appear to contribute to the overall eligibility of the Union Pacific Railroad under Criterion 3. Criterion 4 The railroad spur does not have potential to yield information important in prehistory or history. Archival research potential for the railroad spur has been exhausted, and the path of the spur is fairly well documented in the archival record. The railroad spur cannot provide additional historically important information, and there is no potential for it to provide additional information that is not already represented in the archival record. Therefore, the railroad spur does not appear to contribute to the overall eligibility of the Union Pacific Railroad under Criterion 4. 5.2.2 5708 Alcoa Avenue The commercial concrete block and brick building at 5708 Alcoa Avenue is a rather modest example of an industrial Streamline Moderne style building (Figure 5-5). It is partially clad in stucco and features a flat roof. The building has an asymmetrical footprint and is 15,952 sf in size (Los Angeles County Assessor 2023). Notable style elements include radiused corners on the entryway of the building, radiused ribbon of windows, and a vertical blade sign (Figure 5-5). Building records revealed that the industrial building was constructed in 1941 (Los Angeles County Assessor 2023). The original building permit from the City was not available for review and archival research found no information on the architect associated with the building design or the contractor associated with its construction. A newspaper article indicates that the building sustained substantial fire damage in 1945 and may have been re-constructed (Pasadena Star News 1945); no building permits associated with the re-construction or repairs associated with fire damage were located during the archival review. An addition was constructed onto the southern side of building in 1951 (Figure 5-6) (Los Angeles County Assessor 2023). The permit record includes several additional alterations were completed to the property between 1975 and 2016 (Los Angeles County Assessor 2023). Based on a review of the City building permit records, a fire took place at the building sometime between 2015 and 2016. . . Item 3 Page 51 of 85 Cultural Resources Assessment for the 5764 Alcoa Avenue Project 20 Figure 5-5. East Façade of building at 5708 Alcoa Avenue, facing southeast. Figure 5-6. East Façade showing addition on building at 5708 Alcoa Avenue, facing east. . . Item 3 Page 52 of 85 Cultural Resources Assessment for the 5764 Alcoa Avenue Project 21 Although the original use of the building is not known, a newspaper article indicates it housed the “Modern Foundry and Pattern Making Company”, which served as a “war plant” in 1945 (Pasadena Star News 1945). Additional employment advertisements for the property were found dating between 1941 and 1960; these advertisements were for tool and pattern making trades but no company name or ownership information was provided. The oldest building permit available indicate that the building was occupied by Westco Forest Products between 1975 and 1977. The building permits from this time period also identified Seymour Lehrer as the owner of business. No additional information was found regarding the life of Seymour Lehrer. A building permit revealed that the building was occupied in 1985 by “Baskets Unlimited” and the listed owner of the business was W.M. Zimmer. The permit also revealed the building was used for storage. Building permits show that in 2016, the property was occupied by Royal Roofing and the business was owned by Tom Beattie. No additional information regarding the current tenants and building ownership was available for review. CRHR Evaluation Criterion 1 The subject property does not appear to be a significant building in the city of Vernon or Los Angeles County. Archival research did not provide any information to indicate that the commercial/industrial building was associated with an event or pattern of events pertinent to industrial development in the city. Industrial development in the area began shortly after the city was incorporated in 1905 and was well established by the early 1940s. The building was constructed in 1941 and does not appear to be associated with significant industrial commerce. A newspaper article claimed the building served as a “war plant” in 1945 but no information was found regarding what specific products that were manufactured at the facility. It appears that the subject property may have manufactured products in to support the Military Industrial Complex for the duration of World War II. However, industrial manufacturing in support of the war was not a unique occurrence within a larger national and statewide context. Furthermore, no additional records were found to indicate that the building was a major industrial contributor to the war effort between 1941 and 1945. Therefore, it does not appear to be eligible for listing in the CRHR under Criterion 1. Criterion 2 Research does not indicate the subject property is associated with a person or persons of historic significance at the local, state, or national level. Therefore, the buildings are not eligible for listing in the CRHR under Criterion 2. Criterion 3 The subject property is a modest example of a Streamline Moderne building. Archival research found no information on the architect or builder associated with the design and construction. Based on the modest design elements and common building materials used, the building does not reflect the work of a master architect and builder. The building sustained substantial fire damage in 1945 and may have been re-constructed; no building permits were found that identified re- construction or repairs associated with fire damage. The building does not appear to be an excellent example of a Streamline Moderne style and does not appear to be a significant building project in the city. Therefore, the building is not eligible for listing in the CRHR under Criterion 3. . . Item 3 Page 53 of 85 Cultural Resources Assessment for the 5764 Alcoa Avenue Project 22 Criterion 4 The additional study of the historic building at 5708 Alcoa Avenue is unlikely yield significant information that broadens our understanding of the building’s uses or the history of the city of Vernon. As a result, the property is not significant for listing in the CRHR under Criterion 4. . . Item 3 Page 54 of 85 Cultural Resources Assessment for the 5764 Alcoa Avenue Project 23 6Summary This cultural resource assessment included a SCCIC records search, archival research, and a field survey of the Project Area. A historic railroad spur and building were identified in the Project area because of these efforts. An evaluation of significance concluded that neither resource meets the eligibility criteria for listing on the CRHR. Results of the field visit indicate that surficial deposits across the Project area have been extensively disturbed by the construction of existing buildings and structures. Based on the extent of existing disturbance, along with the lack of known archaeological sites in the Project vicinity, the property contains a relatively low sensitivity for in situ buried archaeological deposits. Based on these results, Chronicle Heritage finds that the proposed Project will have no impact on known historical or archaeological resources under CEQA. No additional cultural resource management is recommended for the proposed Project. . . Item 3 Page 55 of 85 Cultural Resources Assessment for the 5764 Alcoa Avenue Project 24 7 References Cited Ashkar, S. 1999 C-Los Angeles-A-1/South Pacific Railroad/Union Pacific Railroad. Department of Parks and Recreation 523 Form. On file at the South Central Coastal Information Center, California State University, Fullerton. Arnold, Jeanne 1991 Transformation of a Regional Economy: Sociopolitical Evolution and the Production of Valuables in Southern California. American Antiquity 56:953–962. 1992 Complex Hunter-Gatherer-Fishers of Prehistoric California: Chiefs, Specialists, and Maritime Adaptations of the Channel Islands. American Antiquity 57:60–84. Avina, Rose H. 1932 Spanish and Mexican Land Grants in California. Unpublished Master’s Thesis, Department of History, University of California, Berkeley. Basgall, Mark E. 1987 Resource Intensification among Hunter-Gatherers: Acorn Economies in Prehistoric California. Research in Economic Anthropology 9:21–52. Barrows, H.D. 1896 “Don Antonio Maria Lugo: A Picturesque Character in California” Annual Publication of the Historical Society of Southern California, Los Angeles 3:4, 28-34 Beedle, Peggy, Keith Warren, and David Earle 2008 Phase I Cultural Resources Survey Simi Valley Landfill and Recycling Center Expansion, Simi Valley, California. Applied EarthWorks, Inc. Blackburn, Thomas 1963 Ethnohistoric Descriptions of Gabrielino Material Culture. UCLA Archaeological Survey Annual Reports 5:1–50. Binford, L.R. 1980 Willow Smoke and Dogs’ Tails: Hunter Gatherer Settlement Systems and Archaeological Site Formation. American Antiquity 45:4–20. Boscana, Gerónimo 1846 "Chinigchinich; a Historical Account of the Origin, Customs, and Traditions of the Indians at the Missionary Establishment of St. Juan Capistrano, Alta California Called The Acagchemem Nation." In Life in California by Alred Robinson. Pp. 227–341. New York, Wiley & Putnam. City of Vernon 2015 General Plan. Accessed on November 28, 2023 at https://www.cityofvernon.org/home/showpublisheddocument/1306/6376358808505 70000 . . Item 3 Page 56 of 85 Cultural Resources Assessment for the 5764 Alcoa Avenue Project 25 City of Vernon (continued) 2023 About Vernon . Accessed on November 28, 2023 at https://web.archive.org/web/20120830015520/http://www.cityofvernon.org//about_ vernon/history.htm Erlandson, Jon M. 1991 Early Maritime Adaptations on the Northern Channel Islands. In Hunters and Gatherers of Early Holocene Coastal California, edited by Jon M. Erlandson and Roger H. Colten, pp. 101–111. Perspectives in California Archaeology, vol. 1. Institute of Archaeology, University of California, Los Angeles. 1994 Early Hunter-Gatherers of the California Coast. Plenum, New York. 1997 The Middle Holocene along the California Coast. In Archaeology of the California Coast during the Middle Holocene, edited by Jon M. Erlandson and Michael A. Glassow, pp. 1– 10. Perspectives in California Archaeology, vol. 4. Institute of Archaeology, University of California, Los Angeles. Erlandson, Jon M., Douglas J. Kennett, B. Lynn Ingram, Daniel A. Guthrie, Don P. Morris, Mark A. Tveskov, G. James West, and Phillip L. Walker 1996 An Archaeological and Paleontological Chronology for Daisy Cave (CA-SMI-261), San Miguel Island, California. Radiocarbon 38(2):355–373. Glassow, Michael A. 1996 Purisimeño Chumash Prehistory: Maritime Adaptations along the Southern California Coast. Case Studies in Archaeology. Jeffrey Quilter, series editor. Harcourt Brace College Publishers, San Diego, California. 1997 Middle Holocene Cultural Development in the Central Santa Barbara Channel Region. In Archaeology of the California Coast during the Middle Holocene, edited by Jon M. Erlandson and Michael A. Glassow, pp. 73–90. Perspectives in California Archaeology, vol. 4. Institute of Archaeology, University of California, Los Angeles. Glassow, Michael, and Larry Wilcoxon 1988 Coastal Adaptations near Point Conception, California, with Particular Regard to Shellfish Exploitation. American Antiquity 53(1):36–51. Glassow, Michael A., Larry R. Wilcoxon, and Jon Erlandson 1988 Cultural and Environmental Change during the Early Period of Santa Barbara Channel Prehistory. In The Archaeology of Prehistoric Coastlines, edited by Geoff N. Bailey and John E. Parkington, pp. 64–77. Cambridge University Press. Greenwood, Roberta 1972 Obispeño and Purisimeño Chumash. In California, edited by Robert F. Heizer, pp. 520– 523. Handbook of North American Indians, vol. 8, William C. Sturtevant, general editor. Smithsonian Institution, Washington, D.C. Harrington, John Peabody 1981 The Papers of John Peabody Harrington in the Smithsonian Institution 1907–1957. Edited by Elaine L. Mills and Ann J. Brickfield, Vol. 3. Kraus International Publications, White Plains, New York. . . Item 3 Page 57 of 85 Cultural Resources Assessment for the 5764 Alcoa Avenue Project 26 Johnson, John R., Thomas W. Stafford, Jr., Henry O. Ajie, and Don P. Morris 2001 Arlington Springs Revisited. In Proceedings of the Fifth California Islands Symposium, edited by D.R. Brown, K.C. Mitchell, and H.W. Chaney, pp. 541–545. Santa Barbara Museum of Natural History, Santa Barbara, California. Jones, Terry L., Nathan E. Stevens, Deborah A. Jones, Richard T. Fitzgerald, and Mark G. Hylkema 2007 The Central Coast: A Midlatitude Milieu. In California Prehistory: Colonization, Culture, and Complexity, edited by Terry L. Jones and Kathryn A. Klar, pp. 125–146. AltaMira Press, Lanham, Maryland. King, Chester D. 1981 The Evolution of Chumash Society: A Comparative Study of Artifacts Used in Social System Maintenance in the Santa Barbara Channel Region before A.D. 1804. Ph.D. dissertation, Department of Anthropology, University of California, Davis, California. 1990 Evolution of Chumash Society: A Comparative Study of Artifacts Used for Social System Maintenance in the Santa Barbara Channel Region before A.D. 1804. The Evolution of North American Indians, edited by David Hurst Thomas. Garland, New York. Kroeber, Albert L. 1925 Handbook of the Indians of California. Bureau of American Ethnology Bulletin 78. Washington, D.C. Los Angeles County Assessor 2023 5708 Alcoa Avenue, Vernon, CA, 90038. Accessed on November 14, 2023, https://portal.assessor.lacounty.gov/parceldetail/6310005004 Los Angeles Daily News 1943 “Vernon’s Royal Family Due For Court Appearance Today.” September 27, 1943, Page 3. McCawley, William 1996 The First Angelinos: The Gabrielino Indians of Los Angeles. 2nd printing. Malki Museum Press/Ballena Press Cooperative Publication, Banning or Novato, California. Merriam, J.C. 1914 Preliminary Report on the Discovery of Human Remains in an Asphalt Deposit at Rancho La Brea, Science 40:197–203. Moratto, Michael J. 1984 California Archaeology. Academic Press, New York. Norris, Robert M., and Robert W. Webb 1990 Geology of California. John Wiley & Sons, New York. NETROnline 2023 Aerial images of Project area and Vicinity. Accessed November 28, 2023 at https://www.historicaerials.com/viewer. . . Item 3 Page 58 of 85 Cultural Resources Assessment for the 5764 Alcoa Avenue Project 27 Office of Historic Preservation (OHP) 1995 Instructions for Recording Historical Resources. Office of Historic Preservation, Sacramento. Accessed on December 18, 2020 at https://scic.sdsu.edu/_resources/docs/manual95.pdf. Pasadena Star News 1945 “Us Probes $250,000 War Plant Blaze,” April 30, 1945, Page 12. Priestley, H.J. 1937 A Historical, Political, and Natural Description of California by Pedro Fages, Soldier of Spain. University of California Press, Berkeley. Reid, Hugo, and Robert F. Heizer 1968 The Indians of Los Angeles County: Hugo Reid’s Letters of 1852. Southwest Museum Papers, No. 21. Southwest Museum, Los Angeles. Starr, Kevin 2005 California: A History. Modern Library, New York. Stickel, E. Gary 2010 Ice Age Man in Malibu: The Clovis Culture Discovery at the Farpoint Site. Presentation to the Pacific Coast Archaeological Society, March 11, Irvine, California. Sutton, Mark Q. 2009 People and Language: Defining the Takic Expansion in Southern California. Pacific Coast Archaeological Society Quarterly 41(2–3):31–93. Sutton, Mark Q., and Jill K. Gardner 2010 Reconceptualizing the Encinitas Tradition of Southern California. Pacific Coast Archaeological Society Quarterly 42(4):1–64. U.S. Geological Survey, Washington, D.C. (USGS) 1896 Downey, CA (1:62,500) topographic quadrangle. 1901 Southern California Sheet 1, CA (1: 250,000) topographic quadrangle. 1902 Downey, CA (1:62,500) topographic quadrangle. 1904 Southern California Sheet 1, CA (1: 250,000) topographic quadrangle. 1923 Watts, CA (1:24,000) topographic quadrangle. 1924 Watts, CA (1:24,000) topographic quadrangle. 1942 Downey, CA (1:62,500) topographic quadrangle. 1943 Fruitland, CA (1:125,000) topographic quadrangle. 1949 South Gate, CA (1:24,000) topographic quadrangle. 1952 South Gate, CA (1:24,000) topographic quadrangle. 1964 South Gate, CA (1:24,000) topographic quadrangle. 2012 South Gate, CA (1:24,000) topographic quadrangle. . . Item 3 Page 59 of 85 Cultural Resources Assessment for the 5764 Alcoa Avenue Project 28 Warren, Claude N. 1968 Cultural Tradition and Ecological Adaptation on the Southern California Coast. Eastern New Mexico University Contributions in Archaeology 1(3):1–15. . . Item 3 Page 60 of 85 Cultural Resources Assessment for the 5764 Alcoa Avenue Project 29 This page intentionally left blank. . . Item 3 Page 61 of 85 Appendix A. Records Search Results (Confidential) . . Item 3 Page 62 of 85 $0/'*%&/5*"- . . Item 3 Page 63 of 85 $0/'*%&/5*"- . . Item 3 Page 64 of 85 $0/'*%&/5*"- . . Item 3 Page 65 of 85 $0/'*%&/5*"- . . Item 3 Page 66 of 85 $0/'*%&/5*"- . . Item 3 Page 67 of 85 $0/'*%&/5*"- . . Item 3 Page 68 of 85 Appendix B. DPR Resource Forms . . Item 3 Page 69 of 85 State of California The Resources Agency Primary # DEPARTMENT OF PARKS AND RECREATION HRI # PRIMARY RECORD Trinomial NRHP Status Code: Other Listings Review Code Reviewer Date *Resource Name or #:5708 Alcoa Avenue DPR 523A (9/2013)*Required information Page 1 of P1. Other Identifier:5708 Alcoa Avenue *P2. Location: տ Not for Publication ց Unrestricted *a. County:Los Angeles and (P2b and P2c or P2d. Attach a Location Map as necessary.) *b. USGS 7.5' Quad:Southgate Date:1981 T2S;R13W;Sec ;S.B.B.M. c. Address: 5708 Alcoa Avenue City:Vernon Zip: 90058 d. UTM (Give more than one for large and/or linear resources)Zone: 637460 mE/ 3618410 mN. Other Locational Data:(e.g., parcel directions to resource, elevation, etc., as appropriate):APN 6310-005-004 *P3a. Description (Describe resource and its major elements. Include design, materials, condition, alterations, size, setting, and boundaries): The commercial concrete block and brick building was constructed in 1941 and faces west onto Alcoa Avenue. The building is a rather modest example of an industrial Streamline Moderne style building in the City. The building is partially clad in stucco and features a flat roof. The building has an asymmetrical footprint and is 15,952 square feet (Los Angeles County Assessor 2023). A review of the Los Angeles County Assessor’s Portal revealed the building was added onto in 1951 (Los Angeles County Assessor 2023). Notable style elements include radiused corners on the entryway of the building, radiused ribbon of windows, and a vertical blade sign. The boundary is limited to the legal parcel boundary. (See Continuation Sheet page 4) *P3b. Resource Attributes (List attributes and codes):HP8. Industrial Building *P4. Resources Present: ց Building տStructure տObject տSite տDistrict տElement of District տOther (Isolates, etc.) P5b. Description of Photo (view, date, accession #): Primary façade of building at 5708 Alcoa Avenue, November 7, 2023 *P6. Date Constructed/Age and Source: ցHistoric տPrehistoric տBoth 1941 (Los Angeles County Assessor records) *P7. Owner and Address: N/A *P8. Recorded by (Name, affiliation, and address): Scott Torres Chronicle Heritage 55 Huntington Drive Arcadia, CA 91106 *P9. Date Recorded:November 7, 2023 *P10. Survey Type (Describe):Intensive *P11. Report Citation (Cite survey report and other sources, or enter “none”):Clark, Tiffany, and Scott Torres (2023) Cultural Resource Assessment for the 5764 Alcoa Avenue Project, Los Angeles County, California. Report prepared by Chronicle Heritage, Arcadia, California. Attachments:܆ NONE ܈ Location Map ܈ Sketch Map ܈ Continuation Sheet ܈ Building, Structure, and Object Record ܆ Archaeological Record ܆ District Record ܆ Linear Feature Record ܆ Milling Station Record ܆ Rock Art Record ܆ Artifact Record ܆ Photograph Record ܆ Other (List): P5a. Photo or Drawing (Photo required for buildings, structures, and objects.) . . Item 3 Page 70 of 85 State of California The Resources Agency Primary # DEPARTMENT OF PARKS AND RECREATION HRI # BUILDING, STRUCTURE, AND OBJECT RECORD *Resource Name or #:5708 Alcoa Avenue DPR 523B (9/2013)*Required information Page 2 of B1. Historic Name:5708 Alcoa Avenue B2. Common Name:5708 Alcoa Avenue B3. Original Use:Commercial Industrial B4. Present Use:Commercial Industrial *B5. Architectural Style:N/A *B6. Construction History: (Construction date, alterations, and date of alterations) The Los Angeles County Assessor records revealed that the industrial building was constructed in 1941. The original building permit from the City of Vernon was not available for review. Archival research found no information on the architect associated with the building design or the contractor associated with its construction. Based on the building design, it does not appear to be the work of a master architect and builder. The building does not appear to be an excellent example of a Streamline Moderne style and does not appear to be a significant building. A newspaper article indicates that the building sustained substantial fire damage in 1945 and may have been re- constructed. A building permit that identified re-construction or repairs associated with fire damage was not available for the review. The permit record includes alterations that took place between 1975 and 2016 (see continuation form for detailed permit history). Based on a review of the City building permit records, a fire took place at the building sometime between 2015 and 2016. *B7. Moved?ց No տ Yes տ Unknown Date: Original Location:N/A *B8. Related Features:N/A B9a. Architect:Unknown b. Builder:Uknown *B10. Significance: Theme:Streamline Moderne Area:Vernon Period of Significance:1941 Property Type:Commercial Industrial Applicable Criteria:N/A (Discuss importance in terms of historical or architectural context as defined by theme, period, and geographic scope. Also address integrity.) The building is a modest reflection of the Streamline Moderne style. Streamline Moderne building designs became a popular design concept that followed the Art Deco period of the 1920s. The period of significance associated with Streamline Moderne buildings was 1935-1945(SurveyLA 2021). See Continuation Sheet page 7) B11. Additional Resource Attributes (List attributes and codes): None. *B12. References:See Continuation Sheet. *B13. Remarks:None. *B14. Evaluator: Scott Torres Chronicle Heritage 55 Huntington Drive Arcadia, CA 91106 *Date of Evaluation:November 7, 2023 (This space reserved for official comments.) (Sketch Map with north arrow required.) . . Item 3 Page 71 of 85 Service Layer Credits: USA_Topo_Maps: Copyright:© 2013 National Geographic Society, i-cubed State of California The Resources Agency DEPARTMENT OF PARKS AND RECREATION LOCATION MAP SASASASASASASASAAAAAAASASSAAAASAAAAASAA_TT_T_T_TTT_TTTTT_TTTTTTTTTTTT_T_T_TTT_TTT_TT_oopopopopopopopooopopoopoooopopooopopopoppppopopopopopopopppppppppppppppppppppo_oooo_oo_ooooooooooooooooo_oo_o____________MaMaMaMaMaMaMMMaMaMaMaMMMMaMMMMMMaMMaMaMaMaMMaMaMaMaMaMMaMaMMMMMaaMMMMMMMMMMMaaMaMMaapspspspspspspspspspsppspsspspsppspspspspsspsspsspsspssp:::::::::::::::::CCCCCCoCoCoCoCoCooCCCCCCoCoCoCoCCoCCCCCoCCCCCCCCoooCooCCCpypyppypypypypypypypyppppypypypypypypypypypypppypyppypririririririririiiiirriiiiiririrrirrirrrririirirriiiiriiiiriirghghghgghhhhhghhhhgghghghghhghghghghhghghghghgghghghghgghghghghghghhghhghhghghghggghghhhghhhhhhhhhhghhhhggggggggtt:t:tt::t:tt::ttt:t:t:tt:tt:ttt:t::tttt:ttt:t::ttt::t:t::ttttttttt:©©©©©©©©©©©©©©©©©©©©©©©©©©©©©©©©©©©©©©©©©©©©©©©©©©©©© cccccccccccccccc SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSocococococococcocococcocooococccococcieiiiiieiieiiieiiiiieieeeiieieieieiieiiiieieieeiieeieieeeieiieieeietyttttyttytytytyttttttytytytytttyyyyytttyytttytytytyttyttyyytyytytyttyyyytytytytytyty,,,,,ii-iiiii-i-i--i--iiii-ii-ii-iiiiiiiiiiii--i-i-i-iiii cuccucucucucucucuccucucucucuccucuccucucuuccccuccucucucucuucccuccbbebbbebebebebebbebebebebebebebebebbebebebebebeebebbbebbebebbbbbebebbdddddddddddddddddddddddddddddddyyyyyyyyyyyyyyyyy SeSeSSSeSSeSeSeSSeSSSeSeSeeSeSeSeeeSSSeeSSeeervrvrvrvrvvvrrvrvrvrvrvrvvvrvrvvrvrvvrvrvrvrviciciciicccciciiciccciciccciciiciccciiccceeeeeeeeeeeee ee ee eeee LaLaLaLaaLaaLaLaLLLLLLLLLLLLLLLaLaLaaaLLaLaaaaLaayeyyeyeyeyeyeyeyeyeyeyyyeeyeyeyyeyeyyyeyeyeyeyeeyeyyyyyyyyrr rr rr rr CrCrCrCCrCrCrCCrCCCCedededddddedededeeditiittititiitittitititttitittttttttttttitttiiitttttttttts:sssssss:s:::ssssss:ss:s::sss:ss:s:s:ss:ss:::s::s:ss:s:s:ss:sss UUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUSSSSSSSSSSSSSSSSSS 202000000002002020222020202020220202020220202020202020020020202022000222131113111311133311313131333333333313331131311113131333111333 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN tattatttatattataatatatatatattaattaatatatattataatataaaattttaattaaataaaaaataaaatatattataaataioioioioiiooioioiooiioioioioiiooiiiiiooooiiiooiiiioiooiiiiiioiiiiiiiiioiiiiiiioonanananannnannaaanananaannannll l l lllll GeGeGeGeeGeGeGeeeeeeeeogogogoggogoogogogoooggoggogggooooooggoggggggggggggggrararararararararararaaararrraraarararararrrraaarraarrarrraaaarararraaararrraaaaaaaarararrrraaa hphphphphphphhphphphhppphphhhphpphpppphphpphhphppphphphhppphpphphphphppppphphphphphphhphhhphphhppphppphphhpphphppphhphpppphppppiiiiiiiiiiciciiciciic 5708 ALCOA AVE • Scale: 1:24,000Resource Name or #: 5708 $OFRD$YHQXH Primary HRI Trinomial Page of Map Name:South Gate, CA (1982) 7.5' USGS Quad.Date: 2023 00.5Miles 02,000Feet 01Kilometers . . Item 3 Page 72 of 85 State of California Natural Resources Agency Primary # DEPARTMENT OF PARKS AND RECREATION HRI # CONTINUATION SHEET Trinomial *Resource Name or #:5708 Alcoa Avenue DPR 523L (9/2013)*Required information Page 4 of *P3a. Description:(Continued from Primary Record page 1) Primary Façade (Western Façade) The primary façade of the building is directly visible from the west side of Alcoa Avenue. The façade reveals stucco cladding and painted concrete block in addition to a flat roof. The roof parapet features rectangular drainage holes located on each corner. The entry way is recessed, and the corners of the entry way are radiused. The façade exhibits four windows. The primary picture window is a rectangular metal, three paneled window that features a radiused end. The remaining three windows are metal divided light units with a two-over-two hopper window in the center. The building also features a combination of two single panel entry doors that are devoid of any glazing, and two metal tilt-up bay doors. multiple features that stand out as a reflection of the Streamline Moderne style are the radiused window, entry way corners, and finally a horizontal awning the extends from the entryway to the edge of the building. The awning is sheathed in composition shingles and features a vertical blade sign the curves in to the awning. Additional features include a low concrete block wall, low columns also of concrete, and a small rectangular planter bed filled with pebbles. Primary (Western Façade) View East Primary Façade View Southeast . . Item 3 Page 73 of 85 State of California Natural Resources Agency Primary # DEPARTMENT OF PARKS AND RECREATION HRI # CONTINUATION SHEET Trinomial Page of *Resource Name or #:5708 Alcoa Avenue DPR 523L (9/2013)*Required information Primary Façade View Southeast Southern Façade The southern façade is abutted to the property line of the adjacent parcel and remains devoid of any architectural ornamentation. The painted concrete block is exposed to the elements. Southern Façade View northeast . . Item 3 Page 74 of 85 State of California Natural Resources Agency Primary # DEPARTMENT OF PARKS AND RECREATION HRI # CONTINUATION SHEET Trinomial Page of *Resource Name or #:5708 Alcoa Avenue DPR 523L (9/2013)*Required information Northern Façade The northern façade faces into the adjacent parcel. The façade is concrete block and devoid of any architectural ornamentation. Northern Façade View Southeast The view of the eastern façade was not accessible due to the chain linked perimeter fencing along the eastern side of the lot. . . Item 3 Page 75 of 85 State of California Natural Resources Agency Primary # DEPARTMENT OF PARKS AND RECREATION HRI # CONTINUATION SHEET Trinomial Page of *Resource Name or #:5708 Alcoa Avenue DPR 523L (9/2013)*Required information *B10. Significance: (Continued from Building, Structure, Object Report page 2) The City of Vernon is an industrial city of 5.2 square miles located several miles to the southeast of Downtown Los Angeles in Southern California. Founded in 1905 as the first exclusively industrial city in the Southwestern United States, Vernon currently houses more than 1,800 businesses that employ approximately 50,000 people, serving as a vital economic engine in the region (CityofVernon.org 2023). Historical newspaper articles reveal that in a period of 38- years (1905-1943) since the incorporation of the City, industrial factories had taken over most of the tract space in the City. A review of the City building permit records found no information on the architect or builder of the commercial building. The building appears to be a modest example of an industrial/commercial Streamline Moderne style building. Alterations made to the building over the course of time (1975- 2016) include: various roofing repairs, interior structural repairs, compliance with City ordinance, and fire damage repair to roof rafters (Table 1). Table 1. 5708 Alcoa Avenue Building Permit History Permit Number Year Work Completed N/A 1975 Permit issued for inspection to determine compliance with City of Vernon ordinance. 31365 1976 Permit issued to complete a roof repair. 43428 1977 Permit issued to foundation support repair. 52057 1985 Permit issued to add a T-bar to office ceiling. B-2016-1520 2016 Permit issued to replace charred rafters and roofing material due to fire damage. B-2016-1645 2016 Permit issued to complete a roofing repair associated with fire damage. City building permit records and historical newspaper articles indicate the subject property has operated as various industrial service businesses between 1941 to the present. An article in the Pasadena Star News indicated that the Modern Foundry and Pattern Co. operated as a war plant out of the building in 1945 (Pasadena Star News 1945). Additional employment advertisements for the property were found dating between 1941 and 1960; these advertisements were for tool and pattern making trades but no company name or ownership information was provided. The oldest building permit available indicated that the building was occupied by Westco Forest Products between 1975 and 1977. The building permits between 1975 and 1977 also identified Seymour Lehrer as the owner of business. No additional information was found regarding the life of Seymour Lehrer. A building permit that was issued in 1985 revealed the building was occupied by “Baskets Unlimited” and the listed owner of the business was W.M. Zimmer. The permit also revealed the building was used for storage. Building permits issued in 2016 indicate that the building at that time was occupied by Royal Roofing and the business was owned by Tom Beattie. No additional information regarding the current tenants and building ownership was available for review. CRHR Evaluation Criterion 1 The subject property does not appear to be a significant building in the City or Los Angeles County. A desktop review of historical issues of the Los Angeles Daily News and the Pasadena Star News did not provide any information to indicate that the commercial/industrial building was associated with an event or pattern of events pertinent to industrial development in the City of Vernon. Based on a review of the City of Vernon’s website and newspaper articles, it appears that industrial development in the area began shortly after the City incorporated in 1905 and was well established by the early 1940s. The building was constructed in 1941 and based on newspaper articles that were reviewed, it does not appear to be associated with significant industrial commerce. A newspaper article in 1945 claimed the building served as a “war plant”. In 1945, the building housed the “Modern Foundry and Pattern Making Company”; no information was found regarding what specific products that were manufactured at the facility. It appears that the subject property may have . . Item 3 Page 76 of 85 State of California Natural Resources Agency Primary # DEPARTMENT OF PARKS AND RECREATION HRI # CONTINUATION SHEET Trinomial DPR 523L (9/2013)*Required information Page of *Resource Name or #:5708 Alcoa Avenue manufactured products in to support the Military Industrial Complex for the duration of WorlG War II.However, industrial manufacturing in support of the war was not a unique occurrence within a larger national and statewide context. Furthermore, no additional articles ZHUHfound to indicate that the building was a major industrial contributor to the war effort between 1941 and 1945. Therefore, the building does not appear to be individually eligible for listing in the California Register of Historical Resources (CRHR) pursuant to Criterion 1. Criterion 2 Research does not indicate the subject property is associated with a person or persons of historic significance at the state level; therefore, the buildings are not eligible for listing in the CRHR under Criterion 2. Criterion 3 The subject property is a modest example of a Streamline Moderne building. An original building permit was not available for review. Archival research found no information on the architect and builder associated with the design and construction. Based on the modest design elements and common building materials used, the building does not reflect the work of a master architect and builder. The modest building features include a ribbon of windows with a rounded end and a blade sign. The building does not feature additional elements of style beyond the ribbon of windows and blade sign. Based on a newspaper article that was published in 1945, the building sustained substantial fire damage and may have been re-constructed. No building permits were found that identified re- construction or repairs associated with fire damage. The building does not appear to be an excellent example of a Streamline Moderne style and does not appear to be a significant building project in the City. Therefore, the building is not eligible for listing in the CRHR under Criterion 3. Criterion 4 The additional study of the historic building at 5708 Alcoa Avenue is unlikely WRyield significant information that broadens our understanding of the building’s uses or the history of the city of Vernon. As a result, the property is not significant for listing in the CRHR under Criterion 4. *B12. References: (Continued from Building, Structure, Object Report page 2) “5708 Alcoa Avenue, Vernon CA, 90038,”Los Angeles County Assessor, accessed November 14, 2023, https://portal.assessor.lacounty.gov/parceldetail/6310005004 “Us Probes $250,000 War Plant Blaze,” Pasadena Star News, April 30, 1945. 12. . . Item 3 Page 77 of 85 State of California The Resources Agency Primary # DEPARTMENT OF PARKS AND RECREATION HRI # PRIMARY RECORD Trinomial NRHP Status Code: 6Z Other Listings Review Code Reviewer Date Page 1 of 7 *Resource Name or #:Spur track and switch DPR 523A (9/2013)*Required information P1. Other Identifier:Southern Pacific Railroad, San Pedro, Los Angeles & Salt Lake Railroad/ Los Angeles Terminal Railroad *P2. Location: տ Not for Publication ց Unrestricted *a. County:Los Angeles and (P2b and P2c or P2d. Attach a Location Map as necessary.) *b. USGS 7.5' Quad:Southgate Date:1981 T2S;R13W;Sec ;S.B.B.M. c. Address: 5700-5764 Alcoa Avenue City:Vernon Zip: 90058 d. UTM Zone: 637460 mE/3618410 mN. Other Locational Data:(e.g., parcel directions to resource, elevation, etc., as appropriate): *P3a. Description (Describe resource and its major elements. Include design, materials, condition, alterations, size, setting, and boundaries): Resource consists of portions of an intact and abandoned railroad and spur track located north of East Slauson Avenue and south of Fruitland Avenue. Based on historic topographic maps, the structure was constructed by 1923 and was one of a series of railroad spurs in this area that ran west from the Union Pacific Railroad to access industrial and commercial businesses. The intact spur track measures approximately 320 feet in length DQGFRQVLVWVRIDVLQJOHVWDQGDUGJDXJHVHWRIWUDFNVZLWK ZRRGHQWLHV7KHVSXU runs in a northwest-southeast direction ZLWK the track terminatLQJ at the edge of a transmission line easement. A hand switch lies just east of Alcoa Avenue which appears to direct rail cars off the main spur into an adjacent oil and lubricant manufacturing facility. An abandoned set of tracks branches off from the main spur immediately east of Alcoa Avenue and runs in an arc for a distance of 380 feet. The abandoned set of tracks appears to have been partially paved over with only the rails visible from the ground surface. (See Continuation Sheet) *P3b. Resource Attributes (List attributes and codes):HP39. Other *P4. Resources Present: ց Building տStructure տObject տSite տDistrict տElement of District տOther (Isolates, etc.) P5b. Description of Photo (view, date, accession #): View of Spur track and hand switch, facing east November 7, 2023 *P6. Date Constructed/Age and Source: ցHistoric տPrehistoric տBoth Constructed by 1923 based on Watts, CA topographic map (USGS 1923) *P7. Owner and Address: N/A *P8. Recorded by (Name, affiliation, and address): Scott Torres Chronicle Heritage 55 Huntington Drive Arcadia, CA 91106 *P9. Date Recorded:November 7, 2023 *P10. Survey Type (Describe):Intensive *P11. Report Citation (Cite survey report and other sources, or enter “none”):Clark, Tiffany, and Scott Torres (2023) Cultural Resource Assessment for the 5764 Alcoa Avenue Project, Los Angeles County, California. Report prepared by Chronicle Heritage, Arcadia, California. Attachments:܆ NONE ܈ Location Map ܈ Sketch Map ܈ Continuation Sheet ܈ Building, Structure, and Object Record ܆ Archaeological Record ܆ District Record ܆ Linear Feature Record ܆ Milling Station Record ܆ Rock Art Record ܆ Artifact Record ܆ Photograph Record ܆ Other (List): P5a. Photo or Drawing (Photo required for buildings, structures, and objects.) . . Item 3 Page 78 of 85 State of California The Resources Agency Primary # DEPARTMENT OF PARKS AND RECREATION HRI # BUILDING, STRUCTURE, AND OBJECT RECORD Page 2 of 7 *Resource Name or #:Spur track and switch DPR 523B (9/2013)*Required information B1. Historic Name:Southern Pacific, San Pedro, Los Angeles & Salt Lake Railroad/ Los Angeles Terminal Railroad B2. Common Name:Union Pacific Railroad B3. Original Use: Railroad B4. Present Use:Not in Service *B5. Architectural Style:N/A *B6. Construction History: (Construction date, alterations, and date of alterations) Based on a review of topographic maps of the area, the section of rail line was constructed some time before or in 1923 (USGS 1923). Ongoing maintenance and reconfiguration of the tracks has occurred over the course of time. *B7. Moved?ց No տ Yes տ Unknown Date: Original Location:N/A *B8. Related Features:N/A B9a. Architect:Unknown b. Builder:Uknown *B10. Significance: Theme:Rail transportation Area:Vernon Period of Significance:ca. 1923 Property Type:Rail spur and switch Applicable Criteria:N/A (Discuss importance in terms of historical or architectural context as defined by theme, period, and geographic scope. Also address integrity.)This section of railroad track, spur, and switch appear to be part of the Union Pacific and San Pedro, Los Angeles, & Salt Lake Railroad. The San Pedro, Los Angeles & Salt Lake Railroad Company, incorporated in Utah on March 20, 1901. The railroad operated between Los Angeles and Salt Lake City via Las Vegas. It originated as a small line, the Los Angeles Terminal Railway, which was incorporated in 1890. The San Pedro, Los Angeles & Salt Lake Railroad was owned by the U.S. Senator from Montana, William Andrews Clark. Competition between the San Pedro, Los Angeles & Salt Lake Railroad and the Union Pacific Railroad to build a route between Southern California and Salt Lake through Las Vegas ended in 1903 when Senator Clark sold Union Pacific Railroad a half interest in the San Pedro, Los Angeles & Salt Lake and its subsidiaries. The two companies agreed to proceed jointly in the construction of the line. In May 1905, construction of the main line was completed between Los Angeles and Las Vegas (334 miles) and from Salt Lake City to Las Vegas. A joint trackage agreement allowed the railroad to use Atchison, Topeka & Santa Fe Railway tracks over the Cajon Pass. San Pedro was dropped from the corporate name effective August 25, 1916. On April 27, 1921, Union Pacific purchased the remaining half of Senator Clark's holdings in the railroad. The Los Angeles and Salt Lake remained the official name of the "Salt Lake Route," until it was formally merged into the UP (effective January 1, 1988)(OnlineArchiveofCalifornia 2023). See Continuation Sheet B11. Additional Resource Attributes (List attributes and codes): None. *B12. References:See Continuation Sheet. *B13. Remarks:None. *B14. Evaluator: Scott Torres Chronicle Heritage 55 Huntington Drive Arcadia, CA 91106 *Date of Evaluation:November 7, 2023 (This space reserved for official comments.) (Sketch Map with north arrow required.) See attached sketch map . . Item 3 Page 79 of 85 State of California Natural Resources Agency Primary # DEPARTMENT OF PARKS AND RECREATION HRI # CONTINUATION SHEET Trinomial Page of 7 *Resource Name or #:6SXUWUDFNDQGVZLWFK DPR 523L (9/2013)*Required information Remnants of the Spur View West Railroad Line Crossing Alcoa Avenue View West . . Item 3 Page 80 of 85 State of California Natural Resources Agency Primary # DEPARTMENT OF PARKS AND RECREATION HRI # CONTINUATION SHEET Trinomial Page 4 of 7 *Resource Name or #:6SXUWUDFNDQGVZLWFK DPR 523L (9/2013)*Required information Railroad Switch and Spur line. Remaining views of the spur line (identified by red arrow) were not accessible from public righ-of-way, view east *B10. Significance: (Continued) A previous evaluation of the Union Pacific railroad system was completed in 1999 by Jones and Stokes(Ashkar 1999). The evaluation concluded that the entire railroad system in the Los Angeles area was eligible for listing in the National Register of Historic Places (NRHP) under criteria A and B. As the railroad was determined eligible for listing on the NRHP, it is automatically eligible for listing on the California Register of Historic Places (CRHR). However, portion of the rail line that includes a switch track and spur lines does not appear to be significant and does not contribute to the overall eligibility of the railroad. A review of historic aerial images and topographic maps indicates that the spur lines were used to service the industrial businesses along Alcoa Avenue. The spur no longer appears to be operational and at least one segment has been partially paved over. Aside from the rails, ties, and manual switch, no other railroad-related features are associated with the resource. No information was found to indicate that this minor section of railroad and spur line was historically significant in local, statewide, or national contexts. As such, the railroad spur is not recommended eligible under Criterion 1. No known individuals significant to the past are recorded as being associated with the construction or operation of the railroad spur. As no individual of historical importance is associated with the railroad spur, it is therefore evaluated as not eligible for the CRHR under Criterion 2. The spur is no longer in use with portions of the tracks having been paved over. No evidence was found in the archival records to suggest that the spur was designed by a master engineer. Additionally, no evidence was found to suggest that the builders employed unusual or unique construction techniques. All indications are that the techniques and materials used were typical of railroad spurs of the time. The railroad spur does not embody the distinctive characteristics of a type, period or method of construction, or represent the work of a master, or possess high artistic values, or possess any significant distinguishable components. Therefore, the railroad spur is evaluated as not eligible for the CRHR under Criterion 3. The railroad spur does not have potential to yield information important in prehistory or history. Archival research potential for the railroad spur has been exhausted, and the path of the spur is fairly well documented in the archival record. The railroad spur cannot provide additional historically important information, and there is no potential for the railroad spur to provide additional information that is not already represented in the archival record. As a result, the railroad spur is evaluated as not eligible for the CRHR under Criterion 4. . . Item 3 Page 81 of 85 State of California Natural Resources Agency Primary # DEPARTMENT OF PARKS AND RECREATION HRI # CONTINUATION SHEET Trinomial Page of 7 *Resource Name or #:6SXUWUDFNDQGVZLWFK DPR 523L (9/2013)*Required information *B12. References: (Continued) Jones & Stokes (Ashkar, S.) 1999 C-Los Angeles-A-1/Southern Pacific Railroad/Union Pacific Railroad. California Department of Parks and Recreation Primary Record, Building, Structure, and Object Report. HistoricAerials.com 2023 “5700 Alcoa Avenue, Vernon CA, 90038,”https://www.historicaerials.com/viewer accessed December 6, 2023. “California State Railroad Museum and Archives: Los Angeles & Salt Lake Railroad dockets”. 2023 Online Archive of California, https://oac.cdlib.org/findaid/ark:/13030/c84j0kjg/ accessed December 6, 2023, U.S. Geological Survey, Washington, D.C. (USGS) 1923 Watts, CA (1:24,000) topographic quadrangle. . . Item 3 Page 82 of 85 6HUYLFH/D\HU&UHGLWV 86$B7RSRB0DSV &RS\ULJKW 1DWLRQDO*HRJUDSKLF6RFLHW\LFXEHG 6WDWHRI&DOLIRUQLD7KH5HVRXUFHV$JHQF\ '(3$570(172)3$5.6$1'5(&5($7,21 /2&$7,210$3 6$6$6$$6$6$6$6$$$6$7B7B7B7B7B7B7B77B77777777B77B77777777777777BBBBRSRSRSRRRRRRSRSRRSRSRSRRRRSSSRBRBRRBRBRRRRRRR0D00D0D0D00D00D0D0D000D00000000000D0D0D0D00D00D0D0D0D0D0000DDD000000000000000000DDSVSSVSVVVSVSVVSVSVSVSVSVSVSVSVSVSVSVVSVSVS &R&R&R&R&R&R&R&R&R&R&&R&R&&&&R&R&R&RR&R&&R&R&R&RRRR&RR&RR&&&&&&S\S\SS\SSS\S\S\S\S\\\\\\\S\\\\\\\S\S\\\\\S\S\\S\SS\SS\\S\S\S UULULULULULULULULLLUULULULULUULULULUUULUULLUULULUUULUUUUULLUUUUULJKJKJKJKJKJKJKKJKJKKJJKKKKKJKJKKKKJKKKJJKJKKJKJKKJKKKJKKKJKJJJJJJJJJJJJJJJJJJJW W WW W W WW W W W W WW W W WWWWWW WW W W W WW W W W FFFFFF 66666666666666RFRFRFRFRFRFRFRFRFRFRFRRRRRRRRFRFRRFRRFFRFFRRFRFRFRFRRRRFRFFFRFRRRFFFRRFRFFFFFFFRFRFFFLLLLLHLHLLLHLHLHLHLLHLLHLHHHLLHLHLHHHHLHLHLLHLHLHHLHLHLHLHHHLHLHLHHHHLHHLLHHHLHHHWWWWWWWWWWWWWW\W\W\W\W\\W\W\\WW\W\W\W\W\W\\W\W\WWW\W\\WW\W\W\W\W\W\W\WWW\W\\W\\\\\\\\\\\\\\\\\\\\\\LLLLLLLLLLLLLLLLLLLLLLLLLLL FXFXFXFFXFXXFFFFFXXXXXXXXFXFXXFFXFFFFXXFXFXFXFFFEHEEEHEHEHHEEHEHEHEHEEEEHEHEHEHEHEHEHEHEEHEHEEHEEEHEHEEEHEHHHEHEHHEEHHEHHEHHHEEGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG\\\\\\\\\\\\\\\\\\\\\\\ 6H66H6H6H666H66H6H66H66H66H666H6HHH6HHHH66H6HH6H6H6HHHUYYUYUYUUYUYUYYYYUYUUYUYUUYUYUYUYUUYUULFFLFLFLFLFLFLFLFLLFLFLFLFLFLFLLFFFLLLFFLLLFFFHHHHHHHHHHHHHHHHHHHHHHH ///D/D/D//D/D//D/D/D/D/DD/D//D/D/D/DD/D/D////D/D/DDD/DD//DD/D/D/D/DDDD\H\\\H\H\H\\H\H\\\\H\H\\\H\H\HH\\\\\H\H\H\H\H\H\H\HH\\\UUUUUUUUUUUUUUUUUUUUUU &&U&U&U&&U&U&U&U&U&&U&U&U&U&U&U&U&U&U&&U&U&U&U&U&U&&&U&U&U&U&U&&U&U&U&&&U&&&U&UU&&U&&&UU&&&&U&U&U&&UU&&HGHGHGHGHGGGHGHGGHGHGHGHHHGGHGHGHGHHHHGGHGHGHGGHGHGHGHGHGHGHLLWLLLWLWWWWLLWLLWLWLWWLLWWWLLWLWWWLWLWWLWWLWLWWLWWWWLWLWWLLWWLLWWWWLWWWWLWWWWWLWLLLWVVVVVVV VVVVVVVV V VVVVVV VVVVVV VVVVVVVV V V VVV V 88888888888888888888888888888888888888888888888888888888888888666666666666 1111111111111111111111111111111111111DWDWDWDWDWDDDDDWDDDDWDDDDDWDWWDWDWDDWWDDWWDWWWDDWDWDDLRLRLRLRLRRLRLRLRLRLRLLRLRLRLRRLRLLRLRRLRLRLLRLRLRLLLRLRRRRQQDQQDQDQDQDQDQQQQDDQDQDQQQDQDDDQDQDQDQDDDQDQQDDDOOOOOOOOOOOOOOOOOOO *H**H*H*H*H******H*H*H**H*H*H*H*H**HH*H*HH*H****H*H*HHRJRJRJRJRJRJJRJRJJRJRJRJJJJJJRJRJJRJRJJRJRJJJRJRJRJRJJRJRJJRJRJJJJJJRJRRJJJJRRRRJJJJJJJJJJJJJJJUDUDUDUUDUDDDUDUDUDDUDUUDDDDUUDUDUUDUDDUUDDUDUUUDDDDDUDUDUDUDDDUUDUDDDDUUDUUDUDUUUUDDUUUDDDUUDDDUUUDDDSKSKSKSSSKKKKKSKKSKSKSKSKSKKSKSKSKKKSKSKSKSSKSKKKKKSKKSKKSKKSSSKSSSKKKSKKKSSKKSSSKKKKSKSKSKKSKKSKSKSKSKSKSKSKSKSSKSSSSSSSSSSLLLLFLLFLLFLF 5DLOURDG6SXU 6FDOH 5HVRXUFH1DPHRU 6SXUWUDFNDQGVZLWFK 3ULPDU\ +5, 7ULQRPLDO 3DJH RI 0DS1DPH 6RXWK*DWH&$ 86*64XDG'DWH 0LOHV )HHW .LORPHWHUV . . Item 3 Page 83 of 85 6WDWHRI&DOLIRUQLD7KH5HVRXUFHV$JHQF\ '(3$570(172)3$5.6$1'5(&5($7,21 6.(7&+0$3 '35. 5HTXLUHGLQIRUPDWLRQ 'DWHRIPDS 'HFHPEHU 3ULPDU\ +5, 7ULQRPLDO 3DJHRI 'UDZQE\ %6SHOWV 66 /////// &&&& ********** 0000 6666666666 LFLLFLLFFFHHHHHHHHH /D/D/D/D/D/DD//D/D/D/DD/D/D//DD/D//D/D/D/DD\\H\\H\H\H\H\H\H\H\HH\HHH\H\\H\H\\H\H\H\H\H\\\HH\HH\\UUUUUUUUUUUUU &UU&U&&UUU&U&U&&U&U&U&U&U&&UU&U&&HGHGHGGHGHGHGHGGGGHGHGHGHGGGGHHHLLWLWWWLLWLWLWWWV V V VV V V ++++++++++++++++++++++++\EE\EE\E\E\E\E\E\E\\E\EE\E\\\E\E\E\E\\E\E\E\\\E\E\\ULULLULUULUULULULULULULUULULULLGGGGGGGGGGGGGGGGGGGGGGGGGG 5H5H5H5H5H5H5H5H5H5H5H555H5H55HH5HH55HIIIHIHIIHIHHHIHIHIHHIIHIHIHIHIHIHHHHHHHHHHHIIHHIIHIIHIIHIHUHUHUHUHUHUHHHUHHUHHUHUUHUHUHHUHUHUHHUHQFQFQFQFQQQFQQFQFFQFQFFFQFQQQQFQFFQFQFQHHHHHHHHHHHHHHHHHH /////D/D/D/DD//DD/D/D\\\H\H\HHHHHHHHH\HHH\H\HH\H\H\U UU UU U UU U U UUU UU U U U UU U ((((((((((((((((VUVUUVUVVUVVVVV PPPPPPPPXQXQXXXQXQQQQQQQXQQQQQQLWWLWWLWLWLWLWLWLWLWLLWLLWLWLLWLWLWWWWW\\\\\\\\\\\\\\\\\\\\\\\\\000D0D0D0D0D0D0D0D0D0DDD0000D0000000DDDSVSVVSVSSVSVSVVSVSVSVSVSVSVSVS &&&&&&&&&&&&&&&&&&&RQRQRQRRQRQRQQQRRRRWWWWUWWUWUWUWUUULELEEELEELELELEELELEEEEEEXXWXXWXWXWXWWXXWXWWXXWXXWXRURURRURURURUURRRVVVVVVVVV &R&R&R&RRXQXQXQXQQQW\W\W\W\\\\\RRRRRRIIIIIII/R//R/R/R/RR/RVVVVVV $$$Q$$Q$Q$$Q$Q$$Q$$Q$Q$Q$Q$QQ$$Q$Q$Q$QQQQ$$$$QQ$Q$QQ$QQQQ$QJJHJHJHJJHJJJHJJJJJJHHHJHJHHHHJHHJJJHJJ HHHOHOHOHHHOHHHHOHHHOHOVVVVVVVVVVII UQQLQLLLLQLQLLLLDDDDDDDDDDDDDDDD 6W6W6W6W6WW6W6WW6W6W6WW6W6W6W666W6W6DDWDWDDWDWDWDWDWDWDDWDWDWDWDDHHHHHHHHHHH 3D3DD3DD3D33D33333DUNNNNNUNUNUNUNUNNUNUNVVVVVVV 2S2S2S2S2S2222S2SSSHQHQHQHQ6W6WW6W6WUHUUHUHHWHWHW0D0D00SSS0000000000LFLFLFFLFFFFFLLFURURURURRURRRURURRRVRRVRVRVRVRVVVRIIIWIIIWIWIIIWIIWWIWIIWIIWIWWIWIIWIWWWIWIWWW((VV(VV(V((VV((VV((((((((((((((((V((((V((VULULULLLULULULULULULULULULULLLL+(+(+(+++(+(((((++((((((+((((+(((5(5(5(5(5(5(5((((((5(((55(5 ****D*D*DD****D****D********UUUUPPPPPPPPPUPPPPPPPPUUPPPPPUUUPPPPUPPUPPPUUPUPUPPUPUPPLLLLLLQLQLQLQLQLQLQ66D66D6DD6D6DD6D6666666IIHIHIHIHIHIHIHH*****U*U*U*U*U*UU*UDDSDSDSSSDDDDDSDKKKKKKKKK ********HRHRHRHRHRH7777777777777777HFHFHFHFHFHFHFHFKKKQKKQKQKQQQQQKKKKQQQQKQQQKQQQQKQQQQQQRORRROROORORORRRRORRORORRRRRRRJRJRJJJRJJRJRRJJRJJRJJRJJRJRJRJLLHLLHLHLHHHHLHLHLHLHHLHHLHHHHHVVVVVVVVVVVVV ,,,,,,,,,,,,,,,QFQFQFFFQFQQFQQQQQFQFQQQFQQF777777777777777777 0000000(((0((((((000000000000((0 77777777777,77777777777777777 1111$6$$$$$$6$$6$6$6$6$6$6$$$$6$$$66$$$$888886*66**6666 %%%XUXXXHDHDHDDDDDDHHDHHXXXX RRIIRIRIRIRIRIIRIIIRIRIRIIRIIRRR ////////DDDDDDQDDDQQQQQQDQDDDDDQQQDDQDQGGGGGGGGGGGGGGGGG 6H6H6H6H6H6666HUYUYUYUYYYYUYUYYUYYYYYYYLFLLFFLLFLFLLFLLFLFFFFFFFFFFFFFFFFFFFFFFFFFFFFFLFFFFFFHHHHHHHH/D/D//D/D//\\\\\ (((((((((((VUUUUVUUUUUVUUVUUUUVVUUVUVUULLLLLLLLLLLLLLLL &R&R&R&R&&R&&R&R&RR&RR&R&&PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP QXQXQXXQXXQXQXQXQXXQXQXXQXQXXQXQ WLWL\\\\\\\\\\\\\\\\\\\\ HJHJHJHJHHHHHHHHOHOHOHOHOHHOHOHHHOOHOHHOHHHHVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVV&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&ODODODODODODODODODODDOODDODODDODODODDODDDDODODODDOOODODODOO ILIILILILILILILILILILILIILILILIILILIILIIILIIRRRURURRURRURRURURRURURURRURURURURUURRURURRRRRURUURRURUR LQLQLQQQQQQLQQQQQQQQQQQQQQDDDDDD ((((V(V((VVVV(VV(((((VV(((V(((V(V(V(((((VV((((((((((((((VV SVSSVSSVV0D00D UUUUU GHGHHHHH WWWVUU&&&&&HGHGHGHHGHHGHG WWWWWWWVV V +++\\\\\\&&& SVSVSVV \\\\ 0 UUHGHGHG WWWWV V V&&&& VVVV &&&&&&&&&RRQRRQRQR HHHHH 3D3D3D3D333D NUNUNUNNNUUVV &&&RQRQRRQRQQRQRWUWUUU ELELLELEEE 3D3333DDUNUUNUUUUVV VVVV &&&&&&&RQRQRQRQRRQRWUWUL 3D3D3D3DDUNUNUNUNVVVVV \HHHHHHH &&&&&&&&&&&&&&&&&U&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&U&&&&&&&&&&&&&&&&GGGGGGLWLWLWWLLWWWLGGGLLLWLWLLLLWLLLGGGGLWLWLWLWLLLLLLLLLWLGGGLLLLLWLWLWLWLLL ++++++++++++++++++++++++++ DDDDDDSSSSSSSSSSSDDSSSSSSSSSSSS 6RXWKHU Q 3 D FLILF 5 5 $OFRD $YH$OFRD $YH &&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&&WUWWUWUWUUWWWUWWUWWWWWWWWWWWWUWWWWWWWWWWWW XWXXWW WDWWDWDWWDWDWHHHHHWWWWWWWWWWWWWWWWWWWWWW 3DDD3D3D3D333D33DDDD33D33D3DDDDD3D3D3D3DD3D3DDDDD3DD3DDD3D VVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVV 5DLOURDG6SXU 6SXU 3DUWLDOO\ 3DYHG2YHU 5DLOURDG6SXU 5HVRXUFH1DPHRU 6SXUWUDFNDQGVZLWFK T N 6FDOH 0HWHUV )HHW 7H[W . . Item 3 Page 84 of 85 For General Inquiries: T: 886.563.2536 T: 602.254.6280 info@paleowest.com . . Item 3 Page 85 of 85 ORDINANCE NO. 1299 AN ORDINANCE OF THE CITY COUNCIL OF THE CITY OF VERNON APPROVING WAREHOUSE DEVELOPMENT AGREEMENT NO. WH-001 FOR ASSESSOR PARCEL NUMBERS 6310-005-003, 6310-005-004, 6310-005-009, AND 6310-005-010 BETWEEN THE CITY OF VERNON AND GPT VERNON OWNER, LP SECTION 1. Recitals. A.GPT Vernon Owner, LP (Developer) currently has an ownership interest in that portion of real property within the City of Vernon (City), located at 5764 Alcoa Avenue, and wishes to remove existing warehouse buildings and associated structures totaling 145,950 square feet on a 7.12 acre (310,147 square feet) lot, and replace them with a single 153,000 square foot warehouse building. B.The City and Developer have negotiated and prepared Warehouse Development Agreement No. WH-001 (Development Agreement) the purpose of which is to memorialize, among other things, the respective duties of the parties with respect to the development, as well as the benefits that will inure to each of the parties during the term of the Development Agreement. C.Pursuant to Vernon Municipal Code Chapter 17.84 and Section 17.22.035, the City Council of the City of Vernon desires to approve the Development Agreement and make the findings set forth herein. THE CITY COUNCIL OF THE CITY OF VERNON HEREBY ORDAINS: SECTION 2. The City Council of the City of Vernon finds and determines that the above recitals are true and correct and are a substantial part of this ordinance. SECTION 3. This ordinance was assessed in accordance with the authority and criteria contained in the California Environmental Quality Act (CEQA), the State CEQA Guidelines, and the environmental regulations of the City. The City Council finds that this ordinance is not subject to CEQA because the adoption of this ordinance is not a “project” pursuant to CEQA Guidelines Section 15302, because the proposed development consists of the replacement and reconstruction of existing facilities where the new structure will be located on the same site as the structures being replaced and will have substantially the same size, purpose, and capacity as the structures being replaced. SECTION 4. Purpose and Authority. The purpose of this ordinance is to approve Warehouse Development Agreement No. WH-001 with GPT Vernon Owner, LP allowing the development of a 153,000 square foot warehouse at 5764 Alcoa Avenue. This ordinance is authorized pursuant to Vernon Municipal Code Chapter 17.84 and Section 17.22.035, and Government Code Sections 65864 through 65860.5. . . Item 3 Page 1 of 31 Ordinance No. 1299 Page 2 of 31 _______________________ SECTION 5. Findings. In adopting this ordinance, the City Council makes the following findings: A.The proposed Development Agreement is consistent with the objectives, policies, and general land uses and programs of the City of Vernon General Plan. B.The proposed Development Agreement is compatible with the uses authorized in, and the regulations prescribed for, the land use district in which the real property is located. C.The proposed Development Agreement will not be detrimental to the health, safety, and general welfare of persons residing in the immediate area, or detrimental to the general welfare of residents of the City as a whole. D.The City Council approves and adopts the recommendations presented by the Director of Public Works pursuant to Vernon Municipal Code Section 17.22.035(B), as set forth in the agenda item report and during the public hearing on the proposed Development Agreement. E.The proposed Development Agreement is consistent with the provisions of Government Code Sections 65864 through 65869.5. F.The City Council has held a duly public noticed public hearing on the proposed Development Agreement and has considered the testimony presented at such public hearing. SECTION 6. Action. The City Council hereby approves Warehouse Development Agreement No. WH-001, in substantially the form presented to the City Council, and attached to this ordinance as Exhibit A. The Mayor is authorized and directed to execute the Development Agreement for and on behalf of, the City of Vernon, and the City Clerk or Deputy City Clerk shall attest thereto. SECTION 7. If any section, subsection, paragraph, sentence, clause, phrase, or portion thereof, of this ordinance is declared by a court of competent jurisdiction to be unconstitutional or otherwise invalid, such decision shall not affect the validity of the remaining portions of this ordinance. The City Council declares that it would have adopted this ordinance, and each section, subsection, paragraph, sentence, clause, phrase, or portion thereof, irrespective of the fact that any one or more sections, subsections, paragraphs, sentences, clauses, phrases, or portions thereof, be declared invalid or unconstitutional. To this end, the provisions of this ordinance are declared to be severable. SECTION 8. The City Clerk or Deputy City Clerk shall certify the adoption and publish this ordinance as required by law. . . Item 3 Page 2 of 31 Ordinance No. 1299 Page 3 of 31 _______________________ SECTION 9. This ordinance shall become effective after the thirtieth day following its adoption. APPROVED AND ADOPTED _____, 2024. _______________________ CRYSTAL LARIOS, Mayor ATTEST: YONNIE PARKER, Deputy City Clerk (seal) APPROVED AS TO FORM: ZAYNAH N. MOUSSA, City Attorney . . Item 3 Page 3 of 31 RECORDING REQUESTED BY AND WHEN RECORDED MAIL TO: City of Vernon 4305 S. Santa Fe Avenue Vernon, CA 90058 Attn: City Clerk Exempt from Recording Fees Pursuant to Government Code Sections 6103 ______________________________________________________________________________ APNs: (Space Above This Line Reserved for Recorder’s Use Only) WAREHOUSE DEVELOPMENT AGREEMENT NO. WH-001 BY AND BETWEEN THE CITY OF VERNON AND GPT VERNON OWNER LP Exhibit A Ordinance No. 1299 Page 4 of 31 ___________________ . . Item 3 Page 4 of 31 DEVELOPMENT AGREEMENT This DEVELOPMENT AGREEMENT (“Development Agreement” or “Agreement”) is entered into as of the Effective Date, by and between the CITY OF VERNON, a California municipal corporation and California charter City (“City”), and GPT VERNON OWNER LP, a Delaware limited partnership (“Developer”). City and Developer may herein be referred to individually as a “Party,” and collectively as the “Parties.” RECITALS This Agreement is entered upon the basis of the following facts, understandings and intentions of City and Developer. A.Purpose. To strengthen the public planning process, encourage private participation in comprehensive planning and reduce the economic risk of development, the Legislature of the State of California adopted Government Code sections 65864 et seq. (the “Development Agreement Statute”), which authorizes cities to enter into agreements for the development of real property with any person having a legal or equitable interest in such property in order to establish certain development rights in such property. In accordance with the Development Agreement Statute, City has enacted Chapter 17.84 of the Vernon City Code to implement procedures for the processing and approval of development agreements (“Chapter 17.84”). The provisions of the Development Agreement Statute and City’s development agreement policies Chapter 17.84 are herein referred to collectively as the “Development Agreement Law.” This Agreement has been drafted and processed pursuant to the Development Agreement Law. B.The Property. Developer has an equitable interest in or is the fee owner of approximately 7.12 acres of real property located in Vernon, California, comprised of Alameda County Assessor’s Parcel Numbers which property is legally described in Exhibit A-1 (“Legal Description”) and shown on the map attached hereto as Exhibit A-2 (“Depiction”). The Legal Description and Depiction comprise the real property that will be subject to this Agreement as provided in Section 1.2. (“Property”). C.The Project. Consistent with City’s land use planning objectives, Developer has proposed a project that is depicted in the Site Plan Review attached hereto as Exhibit B-1, depicted on the Landscape Plan attached hereto as Exhibit B-2, and depicted on the Elevations and Materials Board attached hereto as Exhibit B-3(collectively “Project”), which generally consists of the demolition of existing buildings and surface parking lots, and the development. The Site Plan Review, Landscape Plan, and Elevations and Materials Board were approved by the City on January 26, 2024. D.Developer’s Assurance. The complexity, magnitude and long-range nature of the Project would be difficult for Developer to undertake if City had not determined, through this Development Agreement, to provide a sufficient degree of certainty in the land use regulatory process to justify the substantial financial investment associated with development of the Project. As a result of the execution of this Development Agreement, both Parties can be assured that the Project can proceed without disruption caused by a change in City planning and development policies and requirements, which assurance will thereby reduce the actual or perceived risk of planning, financing and proceeding with construction of the Project. Ordinance No. 1299 Page 5 of 31 ___________________ . . Item 3 Page 5 of 31 E. City Benefits. City has determined that by entering into this Development Agreement: (1) City will ensure the productive use of property and foster orderly growth and quality development in City; (2) development will proceed in accordance with the goals and policies set forth in City’s General Plan; (3) and City will receive increased property tax revenues and Community Benefit Fees (as described hereinbelow). F. Consistency with General Plan. As required by Government Code section 65867.5, City has found that the provisions and purposes of this Development Agreement are consistent with the goals, policies, standards and land use designations specified in City’s General Plan. G. Substantial Benefits. For the reasons recited herein, City and Developer have determined that the Project is a development for which a Development Agreement is appropriate. This Development Agreement will reduce the uncertainty regarding the Project, thereby encouraging planning for investment in and commitment to use and develop the Property in a manner beneficial to City residents and surrounding properties. Use and development of the Property will provide employment and additional revenue to the City and contribute to the provision of needed infrastructure enhancements and public benefits, thereby achieving the goals and purposes for which the Development Agreement Law was enacted. NOW, THEREFORE, in consideration of the mutual covenants and promises set forth herein and other valuable consideration, City and Developer agree as follows: ADMINISTRATION 1.1 Definitions. This Development Agreement includes defined terms as provided throughout the Agreement, including the following definitions: 1.1.1 “Applicable Law” shall mean any ordinances, resolutions, orders, rules, official policies, standards, specifications, guidelines, or other regulations, which are promulgated or adopted by City (including but not limited to any City agency, body, department, officer, or employee) applicable to the development of the Property, in force and effect on the Effective Date. 1.1.2 “Applicable New City Laws” shall mean New City Laws that are enacted by City after the Effective Date and are specifically required to be applied by County, State or Federal laws or regulations. 1.1.3 “Excused Delay” shall mean delay due to the following, provided that Developer can reasonably document that such disruptions prevent, limit, retard or hinder the ability to complete the Project: (1) war, insurrection, terrorism, strikes, lockouts, riots, floods, earthquakes, fires, casualties, acts of God, pandemics, epidemics, quarantine restrictions, or freight embargoes; (2) unusually severe weather; (3) initiatives, referenda, or litigation challenging the Existing Approvals or Subsequent Approvals; or (4) failure to act by a governmental agency (except that the failure to act by City shall not excuse performance by City). 1.1.4 “Existing Approvals” shall mean the permits and approvals granted to Developer by City for the Project. Ordinance No. 1299 Page 6 of 31 ___________________ . . Item 3 Page 6 of 31 1.1.5 “New City Laws” shall mean any ordinances, resolutions, orders, rules, official policies, standards, specifications, guidelines or other regulations, which are promulgated or adopted by City (including but not limited to any City agency, body, department, officer or employee) after the Effective Date. New City Laws include amendments to Applicable Law. 1.1.6 “Subsequent Approvals” shall mean the permits and approvals granted to Developer by City for the Project after the Effective Date, as described in Section 4.5. 1.2 Effective Date. The Effective Date of this Agreement shall be May 2, , 2024, which date is thirty (30) calendar days after the Ordinance approving this Agreement is adopted by second reading, provided that this Agreement is fully executed by the Parties. 1.3 Term. 1.3.1 Initial Term. The term of this Agreement shall commence on the Effective Date and shall continue for a period of six (6) years after the Effective Date, unless this Agreement is otherwise terminated or extended in accordance with the provisions of this Agreement (the “Term”). The Term has been established by the Parties as a reasonable estimate of the time required to carry out the Project, develop the Project and obtain the public benefits of the Project. 1.3.2 Extensions of Term. The Term may be extended as provided herein. a. If Developer is deprived of the benefits of this Agreement as a result of an Excused Delay, then the Term of this Agreement shall be extended for the period of such Excused Delay; provided, however, that in no event shall the total period of all Excused Delays exceed two (2) years. If the conditions warranting any Excused Delay extend beyond two (2) years, amendment of this Agreement shall be required in order to further extend the Term. Developer shall notify City of its intent to claim an Excused Delay within thirty (30) days of the commencement of the cause of such delay, the specific grounds for same, and the anticipated period of the Excused Delay, if known (“Notice of Excused Delay”). After City’s receipt of such notice, City may reasonably object in writing to Developer’s Notice of Excused Delay by delivering written notice to Developer setting forth the reasons for City’s objections. If City does not object in writing to Developer’s Notice of Excused Delay within thirty (30) days after receipt of such notice, then the Term of this Agreement shall be modified in accordance with the Notice of Excused Delay, subject to the limitations herein. If City timely objects in writing to Developer’s Notice of Excused Delay, City and Developer shall meet and confer regarding the grounds of the Excused Delay. Developer acknowledges that changes in economic conditions, market conditions or demand, or the inability to obtain financing or other lack of funding to complete the Project shall not constitute grounds for any Excused Delay. b. Notwithstanding Section 1.3.2(a), so long as Developer is not in default under this Agreement, Developer shall have one (1) option to extend the Term for an additional period of nine (9) years (the “Extension”). To exercise the Extension to extend the Term pursuant to this subsection, Developer shall provide written notice of intention to exercise the Extension and pay an extension fee of Five Hundred Thousand Dollars ($500,000). Within five (5) business days after Developer has given the notice of intention and delivered the extension fee, City shall confirm in writing that the Extension is in effect. Ordinance No. 1299 Page 7 of 31 ___________________ . . Item 3 Page 7 of 31 1.3.3 Memorandum of Extension. Upon City and Developer’s concurrence regarding the existence and duration of any Excused Delay, City and Developer shall execute and record, within ten (10) days after written request of any Party, a memorandum evidencing any approved extension of the Term pursuant to Section 1.3.1. However, recordation of a memorandum shall not be a condition of an approved extension of the Term. 1.4 Developer Representations and Warranties. Developer represents and warrants to City that, as of the Effective Date: 1.4.1 Developer is duly organized and validly existing under the laws of the State of its incorporation or formation, and is in good standing and has all necessary powers under the laws of the State of California to own property interests and in all other respects to enter into and perform its respective undertakings and obligations under this Agreement. 1.4.2 The execution and delivery of this Agreement and the performance of the obligations of Developer hereunder have been duly authorized by all necessary corporate, partnership or company action and all necessary shareholder, partner or member approvals have been obtained. 1.4.3 This Agreement is a valid obligation of Developer and is enforceable in accordance with its terms, and Developer has acquired the necessary legal or equitable interest in the Property as required by the Development Agreement Law. DEVELOPMENT AND USE OF THE PROPERTY 2.1 Vested Development Standards. City hereby grants to Developer the vested right to develop, construct and use the Property for uses authorized by the Applicable Law and this Agreement, provided that the provisions of this Agreement and the obligations required by the Existing Approvals are fulfilled. To the extent permitted by law, and except as otherwise provided herein, no future modification of the Applicable Law, including but not limited to, City’s General Plan, Municipal Code, ordinances, policies or regulations shall apply to the Property that purport to (i) limit the use of the Property, the density and intensity of use (including but not limited to maximum size and floor area ratios of commercial/retail buildings), the maximum height and size of proposed buildings; (ii) impose exactions, requirements for reservation or dedication of land for public purposes, the subdivision of land, or requirements for infrastructure, public improvements, or public utilities, other than as provided in this Agreement or pursuant to the Existing Approvals; (iii) impose conditions upon the development of the Property other than as permitted by the Applicable Law, the Existing Approvals and this Agreement; or (iv) limit the rate or timing of development of the Property. 2.1.1 Permitted Uses. Without limiting anything in the Existing Approvals, the permitted uses shall include approximately 153,000 square feet of industrial space, as is generally depicted in the Site Plan (collectively, the “Permitted Uses”). 2.1.2 Density and Design Standards. Without limiting the effect of Section 2.1, Developer shall have the vested right to develop the Property in conformance with and up to the maximum density indicated in the Site Plan, Permitted Density and Intensity of Use, in conformance with the existing General Plan designation. Minimum and maximum lot size, maximum gross lot Ordinance No. 1299 Page 8 of 31 ___________________ . . Item 3 Page 8 of 31 coverage, maximum floor area, setbacks and other development standards shall be as specified in the Existing Approvals. 2.2 Impact Fees, Exactions, Processing Fees and Taxes. Except as otherwise provided herein, Developer agrees to pay when due any required fees, taxes, assessments, impact fees and other monetary and non-monetary exactions as required by this Agreement. 2.2.1 Federal/State Compliance Fees. City may charge and Developer agrees to pay any new, increased or modified taxes, assessments, impact fees or other monetary or nonmonetary exactions, whether imposed as a condition of or in connection with any Existing Approvals, Subsequent Approvals or otherwise, which are uniformly imposed and required by any Federal or State statute or regulation that is enacted or adopted after the Effective Date of this Agreement. 2.2.2 City Processing Fees. City may charge and Developer agrees to pay all regular processing fees, including application, permit processing, plan check (time and materials) and inspection and monitoring fees (“Processing Fees”), for land use approvals, grading and building permits, and other permits and entitlements in connection with any Subsequent Existing Approval or otherwise, which are in force and effect on a City-wide basis at the time those permits, approvals or entitlements are applied for, and which are intended to cover the actual costs of processing the foregoing. 2.3 Timing of Commencement of Construction and Completion. Developer shall have the vested right to develop the Project in such order, at such rate and at such times as Developer deems appropriate in the exercise of its business judgment, and in accordance with the phasing requirements set forth herein and in the Existing Approvals. In particular, the Parties hereto seek to avoid the result applied by the California Supreme Court in Pardee Construction Co. v. City of Camarillo (1984) 37 Cal.3d 465, that the failure of parties therein to consider, and expressly provide for, the timing of development resulted in a later adopted initiative restricting the timing of development to prevail over such parties’ agreement. The Parties acknowledge that Developer shall have the vested right to develop the Project in such order and at such rate and at such times as Developer deems appropriate in the exercise of its business judgment, so long as each phase of construction can operate independently, consistent with the Phasing Plan, as determined by City in its reasonable discretion, and except as otherwise provided for in this Agreement. The adoption of an initiative after the Effective Date by City’s electorate shall have no effect on Developer’s such business judgment. 2.4 New City Laws; Reservations of Authority. Notwithstanding any other provision of this Agreement to the contrary, the following New City Laws shall apply to the development of the Property: 2.4.1 Fees. City updates to Processing Fees, as such fees and charges are adjusted from time to time, provided such updates are uniformly applied on a City-wide basis to all substantially similar types of development projects and properties similar to the Project. 2.4.2 Procedural Rules. Regulations relating to hearing bodies, petitions, applications, notices, findings, records, hearings, reports, recommendations, appeals and any other matter of procedure, provided such procedures are uniformly applied on a City-wide basis to all substantially similar types of Development Projects and properties similar to the Project. Ordinance No. 1299 Page 9 of 31 ___________________ . . Item 3 Page 9 of 31 2.4.3 Construction Standards. Regulations governing construction standards and specifications, including City’s Building Code, Plumbing Code, Mechanical Code, Electrical Code, Fire Code, Grading and Erosion Control provisions and all other uniform construction codes then applicable in City at the time of permit application. 2.4.4 Health and Safety Standards. New City Laws which may be in conflict with the Existing Approvals, but which are necessary to protect persons or property from dangerous or hazardous conditions that create a threat to the public health or safety or create a physical risk, based on findings supported by substantial evidence by City identifying dangerous or hazardous conditions requiring such changes in the law, why there are no feasible alternatives to the imposition of such changes, and how such changes would alleviate the dangerous or hazardous condition. 2.4.5 Green Building Standards. New City Laws establishing or otherwise related to green building standards for residential or commercial development, as in effect at the time of Developer’s application for the applicable building permit. 2.4.6 Laws Not in Conflict with this Agreement. New City Laws applicable to the Property, which do not conflict with this Agreement or the Existing Approvals, provided such New City Laws are uniformly applied on a City-wide basis to all substantially similar types of development projects and properties and do not materially affect Developer’s ability to develop the Property or materially increase the costs of developing the Property consistent with the Applicable Law or the Existing Entitlements. 2.4.7 New Other Laws. City shall not be precluded from adopting and applying Applicable New City Laws to the Project to the extent that such Applicable New City Laws are specifically required to be adopted and applied to the Project by County, State or Federal laws or regulations enacted after the Effective Date. 2.5 Initiatives and Referenda. If any City ordinance is enacted or imposed by a citizen- sponsored initiative or referendum, and if such new City ordinance conflicts with the Applicable Law or Existing Approvals or reduces the development rights or assurances provided by this Agreement (“Citizen’s Initiative”), such Citizen’s Initiative shall not apply to the Property or Project; provided, however, the Parties acknowledge that City’s approval of this Agreement is a legislative action subject to the possibility of referendum. Without limiting the generality of any of the foregoing, no moratorium or other limitation (whether relating to the rate, timing, phasing or sequencing of development) affecting subdivision maps, use permits, building permits or other entitlements to develop or use the Property that are approved or to be approved, issued or granted by City shall apply to the Property or Project during the Term. City, except as otherwise provided herein and except to submit to vote of the electorate initiatives and referendums required by law to be placed on a ballot and fulfill any legal responsibility to defend a ballot measure passed by its voters, shall not support, adopt or enact any New City Law, or take any other action which would violate the express provisions or spirit and intent of this Agreement. 2.6 Regulation by Other Public Agencies. Developer agrees and understands that City does not have authority or jurisdiction over any other public agency’s ability to grant governmental approvals or permits or to impose a moratorium or other limitations that may affect the Project. 2.7 Nuisance. Developer shall not use or permit the use of any portion of the Project for any offensive, noisy or dangerous trade, business manufacturing activity or occupation; for any Ordinance No. 1299 Page 10 of 31 ___________________ . . Item 3 Page 10 of 31 activity which constitutes a nuisance or violated public policy; in violation of any law, ordinance rule or regulation of any governmental authority with jurisdiction over any portion of the Project. Such obligation shall terminate as to any legal lot upon issuance of a certificate of occupancy for a residential unit. PUBLIC BENEFITS 3.1 Community Benefit Contribution. Developer agrees, as a material inducement to the certainty of development rights agreed to in this Agreement, to pay the following community benefit fee, in the amounts and at such times as set forth herein: 3.1.1 Payment 1. Prior to and as a condition to issuance of a grading permit, Developer shall deliver to the City Two Hundred Fifty Thousand Dollars ($250,000). 3.1.2 Payment 2. Prior to and as a condition to issuance of a certificate of occupancy, Developer shall deliver to the City an estimated annual community benefit fee payment (an “Estimated ACBF Payment”) not to exceed Two Hundred Fifty Thousand Dollars ($250,000). The Estimated ACBF Payment shall be based upon the projected electrical usage for the upcoming 12-month period based upon Developer’s reasonable estimate (subject to approval of the General Manager of the City’s Department of Public Utilities) of expected electrical usage of occupant(s) of the Property. The formula set forth below in Section 3.2 will be applied to the estimate of expected electrical usage to calculate the Estimated ACBF. 3.1.3 Payment 3. On the date that is one (1) year after Payment 2 is made, Developer shall deliver to the City an Estimated ACBF Payment not to exceed Two Hundred Fifty Thousand Dollars ($250,000), calculated in the same manner as provided in Section 3.1.2. 3.1.4 Payment 4. On the date that is two (2) years after Payment 2 is made, Developer shall deliver to the City an Estimated ACBF Payment not to exceed Two Hundred Fifty Thousand Dollars ($250,000), calculated in the same manner as provided in Section 3.1.2. 3.2 Calculation of Annual Community Benefit Fee. The final annual community benefit fee payment shall be calculated annually based upon the City electrical power utility user tax (“UUT”) paid by the occupant(s) of the Property for the preceding calendar year as provided herein. The final annual community benefit fee payment shall be calculated based upon the actual user utility tax paid for electrical usage for the twelve (12) month period following an Estimated ACBF. The final annual community benefit fee shall be calculated as follows: 3.2.1 If the Property has generated at least Ten (10) cents of UUT per square foot of building floor area, the final annual community benefit fee shall be $150,000. 3.2.2 If the Property has generated at least Twenty (20) cents of UUT per square foot of building floor area, the final annual community benefit fee shall be $100,000. 3.2.3 If the Property has generated at least Thirty (30) cents of UUT per square foot of building floor area, the final annual community benefit fee shall be $50,000. Ordinance No. 1299 Page 11 of 31 ___________________ . . Item 3 Page 11 of 31 3.2.4 If the Property has generated at least Forty (40) cents of UUT per square foot of building floor area, the final annual community benefit fee shall be zero (0). 3.2.5 If the Estimated ACBF previously paid for a given year is less than the final annual community benefit fee payment amount, Developer shall within thirty (30) days written notice of underpayment (including City’s evidence relied upon to make such determination) remit the unpaid amount to the City. In no event shall City be required to refund to Developer any Estimated ACBF regardless of the final annual community benefit fee payment amount. By way of example and for avoidance of doubt, if Developer makes an Estimated ACBF for Year 2 in the amount of $100,000, and after the end of Year 2 City determines the final annual community benefit fee amount is $50,000, Developer is not entitled to any refund of the Estimated ACBF. If the final annual community benefit payment is determined to be $150,000, Developer is obligated to remit an additional $50,000 to City within the time provided. 3.3 Use Tax Point of Sale/Use Designation. Developer shall use good faith efforts to the extent allowed by law to require all persons and entities providing (i) forklifts and (ii) materials and fixtures to be used for internal materials movement (i.e., the racking system) , to (a) obtain a use tax direct payment permit; and (b) designate the Property as the place of use of materials and/or fixtures used in the construction of the Project in order to have the full local use tax portion of the sales and use tax distributed directly to the City. Developer shall instruct each of its contractors, and all subcontractors, to cooperate with the City to ensure the local use tax is allocated to City as applicable. AMENDMENT AND SUBSEQUENT APPROVALS 4.1 Amendment to Development Agreement. This Agreement may only be amended or canceled in whole or in part by the mutual consent of both Parties in writing. City’s review and approval of an amendment to this Agreement shall be strictly limited to consideration of only those provisions to be added or modified. No amendment, modification, waiver or change to this Agreement or any provision hereof shall be effective for any purpose unless it is specifically set forth in a writing that expressly refers to this Agreement and is signed by the duly authorized representatives of both Parties. All amendments to this Agreement shall be reviewed by the Director of Public Works and considered by the City Council and, if approved, will become part of the Existing Approvals. 4.2 Operating Memoranda. If, during the Term of this Agreement, City and Developer agree that minor clarifications of this Agreement are necessary or appropriate, City and Developer shall effectuate such clarifications by recording an operating memorandum approved by City and Developer, which, after execution and recordation, shall be attached hereto and become part of the Existing Approvals. Any proposed operating memorandum that does not substantially affect (i) the Term of this Agreement, (ii) permitted uses of the Property; (iii) provisions for the reservation or dedication of land, (iv) conditions, terms, restrictions or requirements for Subsequent Approvals, (v) the density or intensity of the use of the Property or the maximum height or size of proposed buildings, (vii) monetary contributions by Developer, or (viii) Developer’s Affordable Housing obligations hereunder may be deemed by City as a “Minor Amendment” subject to implementation through an operating memorandum and shall not, except to the extent otherwise required by law, require notice or public hearing before the parties may execute an amendment hereto. The following Ordinance No. 1299 Page 12 of 31 ___________________ . . Item 3 Page 12 of 31 modifications to the Project may constitute Minor Amendments, in City’s sole and reasonable discretion: (a) changes in landscaping; (b) variations in the location of structures that do not substantially alter the Tentative Map; (c) variations in the location of utilities or other infrastructure connections or facilities not materially affecting design concepts; (d) minor adjustments to the Tentative Map, Final Map or Property legal description; (e) minor variations in park or plaza configurations that do not reduce the overall acreage or proposed facilities; and (f) minor modifications to the Phasing Plan as long as phases continue to operate independently and uses provided in a particular phase are compatible. The City Administrator shall have authority to execute a Minor Amendment, in his or her discretion, or seek approval of a Minor Amendment by City resolution. The City Administrator, in consultation with the City Attorney, shall make the determination on behalf of City whether a requested clarification may be effectuated as an operating memorandum or whether the requested clarification requires formal amendment hereof. 4.3 Formal Amendment. Any amendment to this Agreement other than a Minor Amendment shall require noticed public hearings before the City Council consistent with the Development Agreement Law (“Formal Amendment”). 4.4 Amendments to Existing Approvals. Notwithstanding any other provision of this Development Agreement, Developer may seek and City may review and grant amendments or modifications to the Existing Approvals (including the Subsequent Approvals) subject to the following (except that the procedures for amendment of this Development Agreement are set forth in Section 4.1 herein). Existing Approvals other than this Development Agreement may be amended or modified from time to time, but only at the written request of Developer or with the written consent of Developer (at its sole discretion). All amendments to Existing Approvals shall automatically become part of the Existing Approvals, except to the extent such amendments are considered by the City Administrator, in his or her sole discretion and in consultation with the City Attorney, to require a Formal Amendment of this Agreement. 4.5 Subsequent Approvals. In order to develop the Project as contemplated in this Agreement, the Project will require land use approvals, entitlements, development permits, and use or construction approvals in addition to the Existing Approvals, which may include, without limitation: Site Development Reviews, administrative use permits, variances, subdivision approvals, street abandonments, demolition permits, improvement agreements, infrastructure agreements, grading permits, building permits, lot line adjustments, site plans, sewer and water connection permits, certificates of occupancy, parcel maps, lot splits, landscaping plans, master sign programs, transportation demand management programs, encroachment permits, and amendments thereto and to the Existing Approvals (collectively, “Subsequent Approvals”). At such time as any Subsequent Approval applicable to the Property is approved by City, such Subsequent Approval shall become subject to all terms and conditions herein and shall be treated as a “Existing Approval” under this Agreement. 4.5.1 Scope of Review of Subsequent Approvals. By approving the Existing Approvals, City has made a final policy decision that the Project is in the best interests of the public health, safety and general welfare. Accordingly, City shall not prevent or delay development of the Project in accordance with the Existing Approvals. The Subsequent Approvals shall be deemed to be tools to implement the Existing Approvals. The scope of the review of applications for Subsequent Approvals shall be limited to a review of substantial conformity with the Existing Approvals and Applicable Rules, and compliance with CEQA. Ordinance No. 1299 Page 13 of 31 ___________________ . . Item 3 Page 13 of 31 4.5.2 Conditions of Subsequent Approvals. In connection with any Subsequent Approvals, City shall have the right to impose reasonable conditions including, without limitation, normal and customary dedications for rights of way or easements for public access, utilities, water, sewers, and drainage necessary for the Project and in accordance with the provisions herein; provided, however, no conditions imposed on Subsequent Approvals shall require dedications or reservations for, or construction or funding of, public infrastructure or public improvements beyond those already included in the MMRP or Existing Approvals. ANNUAL REVIEW 5.1 Annual Review. The annual review required by California Government Code section 65865.1 will be conducted for the purposes and in the manner stated in those laws as further provided herein. As part of that review, City and Developer shall have a reasonable opportunity to assert actions that either Party believes have not been undertaken in accordance with this Development Agreement, to explain the basis for such assertion, and to receive from the other Party a justification for the other Party’s position with respect to such actions, and to take such actions as permitted by law. The procedure set forth in this Article shall be used by Developer and City in complying with the annual review requirement. City and Developer agree that the annual review process will review compliance by Developer and City with the obligations under this Development Agreement but will not review compliance with other Existing Approvals or other agreements between City and Developer. 5.2 Commencement of Process; Developer Compliance Letter. At least fifteen (15) days prior to the anniversary of the Effective Date each year, Developer shall submit an annual review form, using a form prepared by the Public Works Department, to the Director of the Public Works Department, demonstrating Developer’s good faith compliance with the material terms and conditions of this Development Agreement. 5.3 Development Services Director/City Engineer Review. Within thirty (30) days after the receipt of Developer’s letter, the Public Works Director shall review Developer’s submission and determine whether Developer has in fact, for the year under review, demonstrated good faith compliance with the material terms and conditions of this Agreement. If Developer has demonstrated good faith compliance, then the Public Works Director shall make such a finding and send a letter back to Developer describing the Public Works Director /City Engineer’s finding and any comments. 5.4 Noncompliance Finding. If the Public Works Director finds and determines that there is substantial evidence that Developer has not complied in good faith with any material term or condition of this Agreement, or that Developer is in material breach of this Development Agreement for the year under review, the Public Works Director shall issue and deliver to Developer a written “Notice of Default” specifying in detail the nature of the failure in performance that the Public Works Director claims constitutes material noncompliance or material breach, all facts demonstrating substantial evidence of material noncompliance, and the manner in which such noncompliance may be satisfactorily cured in accordance with this Agreement. In the event that the material noncompliance is an Event of Default pursuant to Article 6 herein, the Parties shall be Ordinance No. 1299 Page 14 of 31 ___________________ . . Item 3 Page 14 of 31 entitled to their respective rights and obligations under Article 6 herein, except that the particular entity allegedly in default shall be accorded only one 60 (sixty) day cure period. 5.5 Cure Period. If the Public Works Director finds that Developer is not in compliance, the Public Works Director shall grant a reasonable period of time of not less than thirty (30) days for Developer to cure the alleged noncompliance. The Public Works Director shall grant a cure period of at least sixty (60) days and shall extend the sixty (60) day period if Developer is proceeding in good faith to cure the noncompliance and additional time is reasonably needed. At the conclusion of the cure period, the Public Works Director shall either (i) find that Developer is in compliance; or (ii) find that Developer is not in compliance. 5.6 Referral of Noncompliance to City Council. The Public Works Director shall refer the alleged default to the City Administrator or their designee who then shall discuss the matter with the City Council. If Developer fails to cure the alleged noncompliance to the Public Works Director’s reasonable satisfaction during the prescribed cure period and any extensions thereto. The Public Works Director shall refer the alleged noncompliance to the City Administrator who shall forward to the City Council if Developer requests a hearing before the City Council. The Public Works Director shall prepare a staff report to the City Council which shall include, in addition to Developer’s letter, (i) demonstration of City’s good faith compliance with the terms and conditions of this Development Agreement; (ii) the Notice of Default; and (iii) a description of any cure undertaken by Developer during the cure period. 5.6.1 Delivery of Documents. At least five (5) days prior to any City hearing regarding Developer’s compliance with this Development Agreement, City shall deliver to Developer all staff reports and all other relevant documents pertaining to the hearing. 5.6.2 City Council Compliance Finding. If the City Council, following a noticed public hearing pursuant to Section 5.6, determines that Developer is in compliance with the material terms and conditions of this Agreement, the annual review shall be deemed concluded. City shall, at Developer’s request, issue and have recorded a Certificate of Compliance indicating Developer’s compliance with the terms of this Agreement. 5.6.3 City Council Noncompliance Finding. If the City Council, at a properly noticed public hearing pursuant to Section 5.6 finds and determines, on the basis of substantial evidence, that Developer has not complied in good faith with the material terms or conditions of this Agreement and that Developer is in material breach of this Agreement, Developer will have a reasonable time determined by the City Council to meet the reasonable terms of compliance approved by the City Council, which time shall be not less than fifteen (15) days. If Developer does not complete the terms of compliance within the time specified, the City Council shall hold a public hearing regarding termination or modification of this Agreement. Notification of intention to modify or terminate this Agreement shall be delivered to Developer by certified mail containing: (i) the time and place of the City Council hearing; (ii) a statement as to whether City proposes to terminate or modify this Agreement and the terms of any proposed modification; and (iii) any other information reasonably necessary to inform Developer of the nature of the proceedings. At the time of the hearing, Developer shall be given an opportunity to be heard. The City Council may impose conditions to the action it takes as necessary to protect the interests of City, provided that any modification or termination of this Development Agreement pursuant to this provision shall bear a Ordinance No. 1299 Page 15 of 31 ___________________ . . Item 3 Page 15 of 31 reasonable nexus to, and be proportional in severity to the magnitude of, the alleged breach, and in no event shall termination be permitted except in accordance with Article 6 herein. 5.7 Relationship to Default Provisions. The above procedures are independent of, in addition to, and do not replace, that provision of Section 6.1 of this Agreement whereby either City or Developer may, at any time, assert matters which either Party believes have not been undertaken in accordance with this Agreement by delivering a written Notice of Default and following the procedures set forth in Section 6.1. 5.8 Reimbursement of City Costs Incurred in Bringing Cure. Developer shall be obligated to reimburse to City all costs (including fully burdened staff time), expenses, damages and attorneys’ fees incurred as a result of any Developer’s default including all costs incurred in bringing about Developer’s cure of any such default. DEFAULT, REMEDIES AND TERMINATION 6.1 Event of Default. Subject to any extensions of time by mutual consent of the Parties in writing, and subject to the provisions of Section 1.3.3 hereof regarding Excused Delays and a Mortgagee’s right to cure pursuant to Section 9.3 hereof, any failure by either Party to perform any material term or provision of this Agreement (not including any failure by Developer to perform any term or provision of any other Existing Approvals) shall constitute an “Event of Default,” (i) if such defaulting Party does not cure such failure within sixty (60) days following written “Notice of Default” from the other Party, where such failure is of a nature that can be cured within such sixty (60) day period; or (ii) if such failure is not of a nature which can be cured within such sixty (60) day period, the defaulting Party does not within such sixty (60) day period commence substantial efforts to cure such failure, or thereafter does not within a reasonable time prosecute to completion with diligence and continuity the curing of such failure. Any Notice of Default given hereunder shall specify in detail the nature of the failures in performance that the noticing Party claims constitutes the Event of Default, all facts constituting substantial evidence of such failure, and the manner in which such failure may be satisfactorily cured in accordance with the terms and conditions of this Development Agreement. During the time periods herein specified for cure of a failure of performance, the Party charged therewith shall not be considered to be in default for purposes of (a) termination of this Development Agreement, (b) institution of legal proceedings with respect thereto, or (c) issuance of any approval with respect to the Project. The waiver by either Party of any default under this Development Agreement shall not operate as a waiver of any subsequent breach of the same or any other provision of this Development Agreement. 6.2 Meet and Confer. During the sixty (60) day period specified in Section 6.1 for cure of a failure of performance, the Parties shall meet and confer in a timely and responsive manner, to attempt to resolve any matters prior to litigation or other action being taken, including without limitation any action in law or equity; provided, however, nothing herein shall be construed to extend the time period for this meet and confer obligation beyond the sixty (60) day cure period Ordinance No. 1299 Page 16 of 31 ___________________ . . Item 3 Page 16 of 31 referred to in Section 6.1 (even if the sixty (60) day cure period itself is extended pursuant to Section 6.1) unless the Parties agree otherwise in writing. 6.3 Remedies and Termination. If, after notice and expiration of the cure periods and procedures set forth in Sections 6.1 and 6.2, the alleged Event of Default is not cured, the non- defaulting Party, at its option, may institute legal proceedings pursuant to Section 6.4 of this Agreement or terminate this Agreement pursuant to Section 6.5 herein. In the event that this Agreement is terminated pursuant to Section 6.5 herein and litigation is instituted that results in a final decision that such termination was improper, then this Agreement shall immediately be reinstated as though it had never been terminated. 6.4 Legal Action by Parties. 6.4.1 Remedies. Either Party may, in addition to any other rights or remedies, institute legal action to cure, correct or remedy any default, enforce any covenant or agreement herein, enjoin any threatened or attempted violation thereof, enforce by specific performance the obligations and rights of the Parties hereto or to obtain any remedies consistent with the purpose of this Development Agreement. All remedies shall be cumulative and not exclusive of one another, and the exercise of any one or more of these remedies shall not constitute a waiver or election with respect to any other available remedy. Without limiting the foregoing, Developer reserves the right to challenge in court any New City Laws that would conflict with Developer’s vested rights.. 6.5 Termination. 6.5.1 Automatic Termination. Except as otherwise provided herein, this Agreement shall be deemed terminated and of no further effect upon the expiration of the Term, including extension thereof, as set forth in Section 1.3 herein. 6.5.2 Survival of Obligations. Upon the termination or expiration of this Agreement as provided herein, neither Party shall have any further right or obligation with respect to the Property under this Agreement except with respect to any obligation that is specifically set forth as surviving the termination or expiration of this Agreement. The termination or expiration of this Agreement shall not affect the validity of the Existing Approvals (other than this Agreement) for the Project. 6.5.3 Termination by City. Notwithstanding any other provision of this Agreement, City shall not have the right to terminate this Agreement with respect to all or any portion of the Property before the expiration of its Term unless City complies with all termination procedures set forth in the Development Agreement Law and there is an alleged Event of Default by Developer and such Event of Default is not cured pursuant to Article 5 herein or this Article 6 and Developer has first been afforded an opportunity to be heard regarding the alleged default before the City Council and this Agreement is terminated only with respect to that portion of the Property to which the default applies. Ordinance No. 1299 Page 17 of 31 ___________________ . . Item 3 Page 17 of 31 COOPERATION AND IMPLEMENTATION 7.1 Further Actions and Instruments. Each Party to this Development Agreement shall cooperate with and provide reasonable assistance to the other Party and take all actions necessary to ensure that the Parties receive the benefits of this Development Agreement, subject to satisfaction of the conditions of this Development Agreement. Upon the request of any Party, the other Party shall promptly execute, with acknowledgment or affidavit if reasonably required, and file or record such required instruments and writings and take any actions as may be reasonably necessary under the terms of this Development Agreement to carry out the intent and to fulfill the provisions of this Development Agreement or to evidence or consummate the transactions contemplated by this Development Agreement. 7.2 Regulation by Other Public Agencies. Other public agencies not within the control of City may possess authority to regulate aspects of the development of the Property separately from or jointly with City, and this Development Agreement does not limit the authority of such other public agencies. Nevertheless, City shall be bound by, and shall abide by, its covenants and obligations under this Development Agreement in all respects when dealing with any such agency regarding the Property. To the extent that City, the City Council, or any other board, agency, committee, department or commission of City constitutes and sits as any other board, agency, commission, committee, or department, it shall not take any action that conflicts with City’s obligations under this Agreement unless required to by any State or Federal law. 7.3 Other Governmental Permits and Approvals; Grants. Developer shall apply for the permits and approvals from other governmental or quasi- governmental agencies having jurisdiction over the Project as may be required for the development of, or provision of services to, the Project. Developer shall comply with all such permits, requirements and approvals. City shall cooperate with Developer in its endeavors to obtain (a) such permits and approvals and (b) any grants for the Project for which Developer applies. TRANSFERS AND ASSIGNMENTS 8.1 Right to Transfer. Developer shall have the right to sell, transfer, or assign the Property in whole or in part (provided that no such parcel transfer shall violate the Subdivision Map Act (Gov. Code § 66410, et seq.)) and the rights and obligations under this Agreement to any person, partnership, joint venture, firm or corporation at any time during the term of this Agreement. 8.2 Release upon Transfer. Upon the transfer of Developer’s rights and interests to the Property under this Development Agreement pursuant to Section 8.1, Developer shall automatically be released from its obligations Ordinance No. 1299 Page 18 of 31 ___________________ . . Item 3 Page 18 of 31 and liabilities under this Development Agreement with respect to that portion of the Property transferred, and any subsequent default or breach with respect to the transferred rights and/or obligations shall not constitute a default or breach with respect to the retained rights and/or obligations under this Development Agreement. 8.3 Covenants Run with the Land. All of the provisions, agreements, rights, powers, standards, terms, covenants and obligations contained in this Development Agreement shall be binding upon the Parties and their respective successors (by merger, reorganization, consolidation, or otherwise) and assigns, devisees, administrators, representatives, lessees, and all of the persons or entities acquiring the Property or any portion thereof, or any interest therein, whether by operation of law or in any manner whatsoever, and shall inure to the benefit of the Parties and their respective successors (by merger, consolidation or otherwise) and assigns. All of the provisions of this Development Agreement shall be enforceable as equitable servitudes and constitute covenants running with the land pursuant to applicable law, including but not limited to, section 1468 of the Civil Code of the State of California. Each covenant to do, or refrain from doing, some act on the Property hereunder (i) is for the benefit of such Property and is a burden upon such Property: (ii) runs with such Property; (iii) is binding upon each Party and each successive owner during its ownership of such Property or any portion thereof; and (iv) each person or entity having any interest therein derived in any manner through any owner of such Property, or any portion thereof, and shall benefit the Property hereunder, and each other person or entity succeeding to an interest in such Property. MORTGAGEE PROTECTION; CERTAIN RIGHTS OF CURE 9.1 Mortgagee Protection. This Development Agreement shall not prevent or limit Developer in any manner, at Developer’s sole discretion, from encumbering the Property or any portion thereof or any improvement thereon by any mortgage, deed of trust or other security device securing financing with respect to the Property (“Mortgage”). This Development Agreement shall be superior and senior to any lien placed upon the Property or any portion thereof after the date of recording this Development Agreement, including the lien of any Mortgage. Notwithstanding the foregoing, no breach hereof shall defeat, render invalid, diminish or impair the lien of any Mortgage made in good faith and for value, but all of the terms and conditions contained in this Development Agreement shall be binding upon and effective against and inure to the benefit of any person or entity, including any deed of trust beneficiary or mortgagee (“Mortgagee”) who acquires title to the Property, or any portion thereof, by foreclosure, trustee’s sale, deed in lieu of foreclosure, or otherwise. 9.2 Mortgagee Not Obligated. Notwithstanding the provisions of Section 9.1 above, no Mortgagee shall have any obligation or duty under this Development Agreement to perform Developer’s obligations or other affirmative covenants of Developer hereunder, provided, however, that a Mortgagee shall not be entitled to devote the Property to any uses or to construct any improvements thereon other than those uses or improvements provided for or authorized by this Development Agreement, or by the Existing Approvals and Applicable Rules. Ordinance No. 1299 Page 19 of 31 ___________________ . . Item 3 Page 19 of 31 9.3 Notice of Default to Mortgagee; Right of Mortgagee to Cure. If City receives a notice from a Mortgagee requesting a copy of any Notice of Default given to Developer hereunder and specifying the address for service thereof, then City shall deliver to such Mortgagee, concurrently with service thereon to Developer, any notice given to Developer with respect to any claim by City that Developer has committed a default, and if City makes a determination of noncompliance hereunder, City shall likewise serve notice of such noncompliance on such Mortgagee concurrently with service thereof on Developer. Each Mortgagee shall have the right (but not the obligation) during the same period available to Developer to cure or remedy, or to commence to cure or remedy, the Event of Default claimed or the areas of noncompliance set forth in City’s notice. 9.4 No Supersedure. Nothing in this Article 9 shall be deemed to supersede or release a Mortgagee or modify a Mortgagee’s obligations under any subdivision improvement agreement or other obligation incurred with respect to the Project outside this Development Agreement, nor shall any provision of this Article 9 constitute an obligation of City to such Mortgagee, except as to the notice requirements of Section 9.3. 9.5 Technical Amendments. City agrees to reasonably consider and approve interpretations and/or technical amendments to the provisions of this Agreement that are required by lenders for the acquisition and construction of the improvements on the Property or any refinancing thereof and to otherwise cooperate in good faith to facilitate Developer’s negotiations with lenders. MISCELLANEOUS PROVISIONS 10.1 Limitation on Liability. Notwithstanding anything to the contrary contained in this Development Agreement, in no event shall any member, officer, agent or employee of City be personally liable for any breach of this Development Agreement by City or for any amount which may become due to Developer under the terms of this Development Agreement. 10.2 Notices, Demands and Communications Between the Parties. Written notices, demands, correspondence and communications between City and Developer shall be sufficiently given if (i) delivered personally (including delivery by private courier); (ii) dispatched by certified mail, postage prepaid and return receipt requested; or (iii) delivered by nationally recognized overnight courier service; (iv) by electronic facsimile transmission followed by delivery of a “hard” copy to the addresses indicated below; or (v) by electronic mail followed by delivery of a “hard” copy to the addresses indicated below. Such written notices, demands, correspondence and communications may be sent in the same manner to such persons and addresses as either Party may from time-to-time designate in writing at least fifteen (15) days prior to the name and/or address change and as provided in this Section 10.3. Ordinance No. 1299 Page 20 of 31 ___________________ . . Item 3 Page 20 of 31 City City of Vernon 4305 Santa Fe Avenue Vernon, CA 90058 Attn: City Administrator with copies to: City of Vernon 4305 Santa Fe Avenue Vernon, CA 90058 Attn: City Attorney Developer: GPT VERNON OWNER LP 3333 Michelson Drive, Suite 725 Irvine, CA 92612 Attn: Joe Williams/Jenny Tseng, Esq. General Counsel Link Logistics Real Estate LLC 602 W Office Center Dr., Suite 200 Fort Washington, PA 19034 developmentcontracts@linklogistics.com Notices personally delivered shall be deemed to have been received upon delivery. Notices delivered by certified mail, as provided above, shall be deemed to have been given and received on the first to occur of (i) actual receipt by any of the addresses designated above as the Party to whom notices are to be sent; or (ii) within five (5) days after a certified letter containing such notice, properly addressed, with postage prepaid, is deposited in the United States mail. Notices delivered by overnight courier service as provided above shall be deemed to have been received twenty- four (24) hours after the date of deposit. Notices delivered by electronic facsimile transmission or email shall be deemed received upon receipt of sender of electronic confirmation of delivery, provided that a “hard” copy is delivered as provided above. 10.3 Project Is Private Development. The Project constitutes private development, neither City nor Developer is acting as the agent of the other in any respect hereunder, and City and Developer are independent entities with respect to the terms and conditions of this Agreement. Nothing contained in this Development Agreement or in any document executed in connection with this Development Agreement shall be construed as making City and Developer joint venturers or partners. 10.4 Severability. If any terms or provision(s) of this Development Agreement or the application of any term(s)or provision(s) of this Development Agreement to a particular situation, is (are) held by a court of competent jurisdiction to be invalid, void or unenforceable, the remainder of this Development Agreement or the application of this Development Agreement to other situations, shall remain in full force and effect unless amended or modified by mutual consent of the Parties. Notwithstanding the foregoing, if any material provision of this Development Agreement, or the Ordinance No. 1299 Page 21 of 31 ___________________ . . Item 3 Page 21 of 31 application of such provision to a particular situation, is held to be invalid, void or unenforceable, Developer (in its sole and absolute discretion) may terminate this Development Agreement by providing written notice of such termination to City. 10.5 Section Headings. Article and Section headings in this Development Agreement are for convenience only and are not intended to be used in interpreting or construing the terms, covenants or conditions of this Development Agreement. 10.6 Construction of Agreement. This Development Agreement has been reviewed and revised by legal counsel for both Developer and City, and no presumption or rule that ambiguities shall be construed against the drafting Party shall apply to the interpretation or enforcement of this Development Agreement. 10.7 Entire Agreement. This Development Agreement, including the Recitals, and exhibits attached hereto and incorporated by reference herein, together with the Existing Approvals, constitutes the entire understanding and agreement of the Parties and supersedes all negotiations or previous agreements between the Parties with respect to all or any part of the subject matter hereof. 10.8 Estoppel Certificates. Either Party may, at any time during the Term of this Development Agreement, and from time to time, deliver written notice to the other Party requesting such Party to certify in writing that, to the knowledge of the certifying Party, (i) this Development Agreement is in full force and effect and a binding obligation of the Parties; (ii) this Development Agreement has not been amended or modified either orally or in writing, or if amended; identifying the amendments; (iii) the requesting Party is not in default in the performance of its obligations under this Development Agreement, or if in default, to describe therein the nature and amount of any such defaults; and (iv) any other information reasonably requested. The Party receiving a request hereunder shall execute and return such certificate or give a written, detailed response explaining why it will not do so within twenty (20) days following the receipt thereof. The failure of either Party to provide the requested certificate within such twenty (20) day period shall constitute a confirmation that this Agreement is in full force and effect and no modification or default exists. Either the City Administrator or their designee shall have the right to execute any certificate requested by Developer hereunder. City acknowledges that a certificate hereunder may be relied upon by transferees and Mortgagees. 10.9 No Waiver. No delay or omission by either Party in exercising any right or power accruing upon noncompliance or failure to perform by the other Party under any of the provisions of this Development Agreement shall impair any such right or power or be construed to be a waiver thereof. A waiver by either Party of any of the covenants or conditions to be performed by the other Party shall be in writing and signed by a duly authorized representative of the Party against whom enforcement of a waiver is sought, and any such waiver shall not be construed as a waiver of any succeeding breach or non-performance of the same or other covenants and conditions hereof. Ordinance No. 1299 Page 22 of 31 ___________________ . . Item 3 Page 22 of 31 10.10 Time Is of the Essence. Time is of the essence for each provision of this Development Agreement for which time is an element. 10.11 Applicable Law. This Development Agreement shall be construed and enforced in accordance with the laws of the State of California. 10.12 Attorneys’ Fees. Should any legal action be brought by either Party because of a breach of this Development Agreement or to enforce any provision of this Development Agreement, the prevailing party shall be entitled to reasonable attorneys’ fees and such other costs as may be found by the court. 10.13 Third Party Beneficiaries. Except as otherwise provided herein, City and Developer hereby renounce the existence of any third party beneficiary to this Development Agreement and agree that nothing contained herein shall be construed as giving any other person or entity third party beneficiary status. 10.14 Constructive Notice and Acceptance. Every person who now or hereafter owns or acquires any right, title or interest in or to any portion of the Property is and shall be conclusively deemed to have consented and agreed to every provision contained herein, whether or not any reference to this Development Agreement is contained in the instrument by which such person acquired an interest in the Property. 10.15 Counterparts. This Development Agreement may be executed by each Party on a separate signature page, and when the executed signature pages are combined, shall constitute one single instrument. 10.16 Authority. The persons signing below represent and warrant that they have the authority to bind their respective Party and that all necessary board of directors,’ shareholders,’ partners,’ city councils or other approvals have been obtained. IN WITNESS WHEREOF, City and Developer have executed this Development Agreement as of the date first set forth above. [signatures on next page] Ordinance No. 1299 Page 23 of 31 ___________________ . . Item 3 Page 23 of 31 DEVELOPER: GPT VERNON OWNER LP, a Delaware limited partnership By: Link Logistics Real Estate Management, LLC, a Delaware limited liability company By: __________________________________ Its Authorized Agent CITY: CITY OF VERNON a California municipal corporation and California charter City By: __________________________________ Carlos R. Fandino Jr, City Administrator ATTESTATION: By: __________________________________ Lisa Pope City Clerk APPROVED AS TO FORM: By: __________________________________ Zaynah Moussa City Attorney SIGNATURES MUST BE NOTARIZED Ordinance No. 1299 Page 24 of 31 ___________________ . . Item 3 Page 24 of 31 ACKNOWLEDGMENT A notary public or other officer completing this certificate verifies only the identity of the individual who signed the document to which this certificate is attached, and not the truthfulness, accuracy, or validity of that document. State of California ) County of _____________________ ) On ____________________, before me, ____________________________, a Notary Public, personally appeared _______________________________, who proved to me on the basis of satisfactory evidence to be the person(s) whose name(s) is/are subscribed to the within instrument and acknowledged to me that he/she/they executed the same in his/her/their authorized capacity(ies), and that by his/her/their signature(s) on the instrument the person(s), or the entity upon behalf of which the person(s) acted, executed the instrument. I certify under PENALTY OF PERJURY under the laws of the State of California that the foregoing paragraph is true and correct. WITNESS my hand and official seal. Signature Ordinance No. 1299 Page 25 of 31 ___________________ . . Item 3 Page 25 of 31 A notary public or other officer completing this certificate verifies only the identity of the individual who signed the document to which this certificate is attached, and not the truthfulness, accuracy, or validity of that document. State of California ) County of _____________________ ) On ____________________, before me, ____________________________, a Notary Public, personally appeared _______________________________, who proved to me on the basis of satisfactory evidence to be the person(s) whose name(s) is/are subscribed to the within instrument and acknowledged to me that he/she/they executed the same in his/her/their authorized capacity(ies), and that by his/her/their signature(s) on the instrument the person(s), or the entity upon behalf of which the person(s) acted, executed the instrument. I certify under PENALTY OF PERJURY under the laws of the State of California that the foregoing paragraph is true and correct. WITNESS my hand and official seal. Signature Ordinance No. 1299 Page 26 of 31 ___________________ . . Item 3 Page 26 of 31 EXHIBIT A-1 LEGAL DESCRIPTION OF PROPERTY Ordinance No. 1299 Page 27 of 31 ___________________ . . Item 3 Page 27 of 31 EXHIBIT A-2 DEPICTION OF PROPERTY Ordinance No. 1299 Page 28 of 31 ___________________ . . Item 3 Page 28 of 31 EXHIBIT B-1 SITE PLAN Ordinance No. 1299 Page 29 of 31 ___________________ . . Item 3 Page 29 of 31 EXHIBIT B-2 Landscape Plan Ordinance No. 1299 Page 30 of 31 ___________________ . . Item 3 Page 30 of 31 EXHIBIT B-3 Elevations and Materials Board Ordinance No. 1299 Page 31 of 31 ___________________ . . Item 3 Page 31 of 31 NOTICE OF CITY COUNCIL PUBLIC HEARING The City Council of the City of Vernon will conduct a public hearing on March 19, 2024, at 9:00 a.m. (or as soon thereafter as the matter can be heard) which you may attend at Vernon City Hall, City Council Chamber, 4305 Santa Fe Avenue, Vernon, CA 90058 to: CONSIDER AN ORDINANCE APPROVING A DEVELOPMENT AGREEMENT BETWEEN THE CITY OF VERNON AND GPT VERNON OWNER LP FOR THE CONSTRUCTION OF A WAREHOUSE AT 5764 ALCOA AVENUE All relevant documents will be available for public review on the City’s website once the agenda for the meeting is posted or from the City Clerk at CityClerk@cityofvernon.org or (323) 583-8811, ext. 546. All interested persons will be given an opportunity to comment on the above-referenced items during the public hearing. In addition, written comment or questions may be submitted prior to the hearing as set forth below. Written Testimony or questions must be received prior to 9:00 a.m. on the date of the hearing. Please send your comments or questions to: Daniel Wall, Director of Public Works 4305 Santa Fe Avenue, Vernon, CA 90058 (323) 583-8811 ext. 305 Email:dwall@cityofvernon.org If you challenge approval of the Development Agreement or any provision thereof in court, you may be limited to raising only those issues you or someone else raised at the hearing described in this notice or in written correspondence delivered to the City of Vernon at, or prior to, the meeting. In compliance with the Americans with Disabilities Act (ADA), if you need special assistance to participate in the meeting, please contact the City Clerk Department at (323) 583-8811, ext. 546 at least 48 hours prior to the meeting to assure arrangements can be made. The hearing may be continued, adjourned, or cancelled and rescheduled to a stated time and place without further notice of a public hearing. Dated: March 4, 2024, 2024 Lisa Pope, City Clerk Publish: March 7, 2024, 2024 . . Item 3 Page 1 of 2 CALIFORNIA NEWSPAPER SERVICE BUREAU PRE# D A I L Y J O U R N A L C O R P O R A T I O N To the right is a copy of the notice you sent to us for publication in the HUNTINGTON PARK BULLETIN. Please read this notice carefully and call us with any corrections. The Proof of Publication will be filed with the County Clerk, if required, and mailed to you after the last date below. Publication date(s) for this notice is (are): Mailing Address : 915 E FIRST ST, LOS ANGELES, CA 90012 Telephone (800) 788-7840 / Fax (800) 464-2839 Visit us @ www.LegalAdstore.com LISA POPE CITY OF VERNON CITY CLERK 4305 SANTA FE AVE VERNON, CA 90058 HRG NOTICE OF HEARING Notice of Public Hearing - Approval of Development Agreements 03/07/2024 Notice Type: Ad Description COPY OF NOTICE 3789338 !A000006705263! An invoice will be sent after the last date of publication. If you prepaid this order in full, you will not receive an invoice. NOTICE OF CITY COUNCIL PUBLIC HEARING The City Council of the City of Vernon will conduct a public hearing on March 19,2024,at 9:00 a.m.(or as soon thereafter as the matter can be heard)which you may attend at Vernon City Hall,City Council Chamber,4305 Santa Fe Avenue,Vernon,CA 90058 to: CONSIDER AN ORDINANCE APPROVING A DEVELOPMENT AGREEMENT BETWEEN THE CITY OF VERNON AND GPT VERNON OWNER LP FOR THE CONSTRUCTION OF A WAREHOUSE AT 5764 ALCOA AVENUE All relevant documents will be available for public review on the City's website once the agenda for the meeting is posted or from the City Clerk at CityClerk@cityofvernon.org or (323)583-8811, ext.546.All interested persons will be given an opportunity to comment on the above-referenced items during the public hearing.In addition, written comment or questions may be submitted prior to the hearing as set forth below.Written Testimony or questions must be received prior to 9:00 a.m.on the date of the hearing. Please send your comments or questions to: Daniel Wall,Director of Public Works 4305 Santa Fe Avenue,Vernon,CA 90058 (323)583-8811 ext.305 Email:dwall@cityofvernon.org If you challenge approval of the Development Agreement or any provision thereof in court,you may be limited to raising only those issues you or someone else raised at the hearing described in this notice or in written correspondence delivered to the City of Vernon at,or prior to,the meeting. In compliance with the Americans with Disabilities Act (ADA),if you need special assistance to participate in the meeting,please contact the City Clerk Department at (323)583-8811,ext.546 at least 48 hours prior to the meeting to assure arrangements can be made. The hearing may be continued,adjourned,or cancelled and rescheduled to a stated time and place without further notice of a public hearing. Dated:March 4,2024,2024 Lisa Pope,City Clerk Publish:March 7,2024,2024 3/7/24 PRE-3789338# HUNTINGTON PARK BULLETIN . . Item 3 Page 2 of 2 City Council Agenda Report Meeting Date:March 19, 2024 From:Lisa Pope, City Clerk Department:City Clerk Submitted by:Sandra Dolson, Administrative Secretary Subject Meeting Minutes Recommendation Approve the March 5, 2024 Regular City Council Meeting Minutes Background Staff has prepared and submits the minutes for approval. Fiscal Impact There is no fiscal impact associated with this report. Attachments 1. March 5, 2024 Regular City Council Meeting Minutes . . Item 4 Page 1 of 1 MINUTES VERNON CITY COUNCIL REGULAR MEETING TUESDAY, MARCH 5, 2024 COUNCIL CHAMBER, 4305 SANTA FE AVENUE CALL TO ORDER Mayor Pro Tem Merlo called the meeting to order at 9:08 a.m. FLAG SALUTE Mayor Pro Tem Merlo led the Flag Salute. ROLL CALL PRESENT: Judith Merlo, Mayor Pro Tem Melissa Ybarra, Council Member Leticia Lopez, Council Member Jesus Rivera, Council Member ABSENT Crystal Larios, Mayor STAFF PRESENT: Carlos Fandino, City Administrator Zaynah Moussa, City Attorney Yonnie Parker, Deputy City Clerk Jessica Alcaraz, Financial Services Administrator Fredrick Agyin, Health and Environmental Control Director Michael Earl, Human Resources Director Robert Sousa, Police Chief Dan Wall, Public Works Director Todd Dusenberry, Public Utilities General Manager APPROVAL OF THE AGENDA Staff pulled and moved Item 7 from the Consent Calendar to New Business. MOTION Council Member Lopez moved and Council Member Ybarra seconded a motion to approve the agenda. The question was called and the motion carried unanimously, Mayor Larios absent. PUBLIC COMMENT None. . . Item 4 Page 1 of 4 Regular City Council Meeting Minutes Page 2 of 4 March 5, 2024 PRESENTATIONS 1. Proclamation Recognizing Retired Employee - Wenceslao P. Reynoso City Council acknowledged Wenceslao P. Reynoso for his years of service to the City. CONSENT CALENDAR MOTION Council Member Ybarra moved and Council Member Rivera seconded a motion to approve the Consent Calendar, Items 2-6, and 8. The question was called and the motion carried unanimously, Mayor Larios absent. The Consent Calendar consisted of the following items: 2. Meeting Minutes Recommendation: Approve the February 20, 2024 Regular City Council Meeting Minutes. 3. Claims Against the City Recommendation: Receive and file the claim submitted by Jared A. Dickerson. 4. Operating Account Warrant Register Recommendation: Approve Operating Account Warrant Register No. 125, for the period of January 21 through February 3, 2024, totaling $7,617,882.77 and consisting of ratification of electronic payments totaling $6,843,535.52 and ratification of the issuance of early checks totaling $774,347.25. 5. Public Works Department Monthly Report Recommendation: Receive and file the January 2024 Building Report. 6. Services Agreement with Aon Risk Insurance West, Inc. for Professional Property/Casualty Insurance Broker of Record Recommendation: A. Find that it is commercially unreasonable to rebid the proposed service agreement for a professional property/casualty insurance broker of record every three years pursuant to Vernon Municipal Code Section (VMC) 3.32.220 (B); and B. Approve and authorize the City Administrator to execute a Services Agreement with Aon Risk Insurance Services West, Inc., in substantially the same form as submitted, for professional property/casualty insurance broker of record, for a total amount not-to-exceed $462,500, for a five-year term effective July 1, 2024 through June 30, 2029, with an option to extend for an additional two years after the expiration of the initial term. 8. National Association of County and City Health Officials (NACCHO) Grant Program Agreement Between the City of Vernon and Wellness and Equity Alliance, LLC (WEA) Recommendation: Approve and authorize the City Administrator to execute the NAACHO Grant Program Agreement with WEA, in substantially the same form as submitted, for a vaccine equity project, for a total amount not-to-exceed $150,000, for the duration of the NACCHO grant term ending on July 31, 2024. . . Item 4 Page 2 of 4 Regular City Council Meeting Minutes Page 3 of 4 March 5, 2024 NEW BUSINESS 7. Amendment No. 1 to the Southeast Rio Vista Family YMCA Services Agreement City Administrator Fandino and Administrative Analyst Figueroa presented the staff report and answered City Council’s questions related to wear and tear, facilities equipment, and supplies fund allocation. MOTION Council Member Ybarra moved and Council Member Rivera seconded a motion to table Amendment No. 1 to the Services Agreement with Southeast-Rio Vista Family YMCA and directed staff to amend recommendations as stated for Council consideration to the March 19, 2024 Regular City Council Meeting. The question was called and the motion was carried unanimously, Mayor Larios absent. 9. Contract with Elecnor Belco Electric, Inc. for Highway Safety Improvement Program (HSIP) Cycle 9 – Contract No. 20240173 Public Works Director Wall presented the staff report. MOTION Council Member Ybarra moved and Council Member Rivera seconded a motion to: A. Find that the proposed action is categorically exempt from California Environmental Quality Act (CEQA) review, in accordance with CEQA Guidelines Section 15301, because the project consists of the maintenance and minor alteration of the existing City’s traffic signals and involves negligible or no expansion of an existing use; B. Accept the bid proposal from Elecnor Belco Electric Inc. as the lowest responsive and responsible bidder and reject all other bids; C. Approve and authorize the City Administrator to execute a contract with Elecnor Belco Electric Inc., in substantially the same form as submitted, for Traffic Signal Indications Upgrades and Placement of Solar-Powered Speed Signs HSIP Cycle 9 Project in an amount not-to-exceed $247,000; and D. Authorize a contingency amount of ten percent (10%) or $24,700 in the event of an unexpected changed condition in the project and grant authority to the City Administrator to issue change orders for an amount up to the contingency amount, if necessary. The question was called and the motion carried unanimously, Mayor Larios absent. 10. City Council Appointments to Outside Agencies Deputy City Clerk Parker presented the staff report. MOTION Council Member Ybarra moved and Council Member Lopez seconded a motion to A. Appoint Mayor Pro Tem Merlo as the City’s delegate and Council Member Lopez the City’s alternate to represent the City at the Southern California . . Item 4 Page 3 of 4 Regular City Council Meeting Minutes Page 4 of 4 March 5, 2024 Association of Governments 2024 Regional Conference and General Assembly; and B. Table appointment of the City’s representative and alternate to Gateway Cities Council of Governments. The question was called and the motion carried unanimously, Mayor Larios absent. ORAL REPORTS 11. City Administrator Reports on Activities and Other Announcements. City Administrator Fandino announced the February 2024 Vernon Resident Newsletter, upcoming Vernon Housing Commission Meeting on March 13 at 6 p.m. and Business and Industry Commission Meeting on March 14, 2024 at 9 a.m.; Spring Egg-Stravaganza on Thursday, March 21,2024; Presidential Primary on March 5, 2024; and the City of Vernon General Municipal Election on Tuesday April 9, 2024. 12. City Council Reports on Activities (including AB 1234), Announcements, or Directives to Staff. None. ADJOURNMENT Mayor Pro Tem Merlo adjourned the meeting at 9:29 a.m. ______________________________ CRYSTAL LARIOS, Mayor ATTEST: ____________________________ YONNIE PARKER, Deputy City Clerk (seal) . . Item 4 Page 4 of 4 . . Item 5 Page 1 of 59 . . Item 5 Page 2 of 59 . . Item 5 Page 3 of 59 VERNON POLICE DEPARTMENT Police Activity Report Period Ending: 1/31/24 TRAFFIC COLLISIONS NO. PROPERTY RECOVERED TOTAL 35 VEHICLES: $ 524,025.00 NON-INJURY 21 INJURY 14 Persons Injured 20 Pedestrian 1 Fatalities 0 City Property Damage 4 Hit & Run (Felony) 3 Hit & Run (Misdemeanor) 8 VEHICLES STORED PROPERTY RECOVERED FOR Unlicensed Driver/Impounded Vehicle 20 OTHER DEPARTMENTS Unattached Trailer 0 VEHICLES: $ 220,217.00 Abandoned/Stored Vehicle 12 Traffic Hazard 0 CITATIONS Citations Iss (Prisoner Release) 37 Citations Iss (Other Violations) 0 Parking 100 Hazardous 41 Non-Hazardous 43 Citations Iss (Moving) 84 Citations Iss (Total) 184 CASES CLEARED BY ARREST AR24-001 CR24-0001 11364(A) HS AR24-024 CR24-0091 594(B)(1) PC AR24-002 CR24-0002 11364(A) HS AR24-027 CR24-0106 10851 VC AR24-004 CR24-0016 594.2(A) PC AR24-029 CR24-0125 14601.2(A) VC AR24-009 CR24-0035 14601.2(A) VC AR24-030 CR24-0126 14601.2(A) VC AR24-011 CR24-0036 647(F) PC AR24-031 CR24-0127 11364(A) HS AR24-012 CR24-0039 14601.2(A) VC AR24-032 CR24-0131 11377(A) HS AR24-013 CR24-0047 11357(A) HS AR24-033 CR24-0133 11377(A) HS AR24-014 CR24-0048 647(F) PC AR24-034 CR24-0136 14601.2(A) VC AR24-015 CR24-0049 273.6 PC AR24-035 CR24-0143 11364(A) HS AR24-016 CR24-0053 211 PC AR24-037 CR24-0147 487 PC AR24-017 CR24-0053 211 PC AR24-039 CR24-0153 496(A) PC AR24-019 CR24-0073 666.5 PC AR24-040 CR24-0154 20001(A) VC AR24-021 CR24-0082 14601.2(A) VC AR24-041 CR24-0159 14601.2(A) VC AR24-022 CR24-0087 11364(A) HS AR24-042 CR24-0165 11377(A) HS AR24-023 CR24-0088 369I(1) PC AR24-043 CR24-0168 242 PC . . Item 5 Page 4 of 59 CASES CLEARED BY ARREST (CONTINUED) AR24-044 CR24-0170 594(B)(1) PC AR24-045 CR24-0174 10851(A) VC AR24-046 CR24-0175 594(B)(1) PC AR24-047 CR24-0146 459 PC . . Item 5 Page 5 of 59 MALE FEMALE TOTAL ARSON ASSAULT BURGLARY 1 CARRY LOADED FIREARM PERSON/VEH CORPORAL INJURY ON SPOUSE/COHABITANT CHILD ABUSE/CHILD ENDANGERMENT DRIVING UNDER THE INFLUENCE w/ INJURY EMBEZZLEMENT FORGERY GRAND THEFT: AUTO 3 GRAND THEFT: PROPERTY 1 HIT/RUN 1 KIDNAPPING POSSESSION OF STOLEN PROPERTY RAPE RESISTING/OBSTRUCTING ROBBERY 2 SEXUAL BATTERY THREATS VANDALISM 1 WARRANT (VERNON)2 WARRANT (OUTSIDE AGENCY)2 WEAPONS TOTAL FELONY ARRESTS 13 0 13 MALE FEMALE TOTAL ASSAULT 1 CARRY LOADED FIREARM PERSON/VEH DISPLAY UNLAWFUL VEH REGISTRATION DRIVING WITH SUSPENDED LICENSE 6 1 DRUNK IN PUBLIC 2 DUI 6 1 FAIL TO SIGN CITATION ILLEGAL DUMPING MAIL THEFT OPERATE VEHICLE W/O INTERLOCK DEV PETTY THEFT POSSESSION OF NARCOTICS 4 POSSESSION OF PARAPHERNALIA 5 POSSESSION OF STOLEN PROPERTY 1 RECKLESS DRIVING RESISTING/OBSTRUCTING SPEED CONTEST THREATS THROW SUBSTANCE AT VEHICLE TRESPASSING 1 UNDETECTABLE FIREARM VANDALISM 3 VEHICLE TAMPERING VIOLATE COURT ORDER 1 WARRANT (OUTSIDE AGENCY)1 WARRANT (VERNON) WEAPONS 1 TOTAL MISD. ARRESTS 30 4 34 MALE FEMALE TOTAL BURGLARY 0 CARRY LOADED FIREARM IN PUBLIC 0 ROBBERY 0 VANDALISM 0 WARRANT 0 TOTAL JUVENILES DET.0 0 0 13 33 1 47 TOTAL FELONY ARRESTS (ADULT) TO DATE: TOTAL MISDEMEANOR ARRESTS (ADULT) TO DATE: TOTAL JUVENILES DETAINED (FELONY AND MISDEMEANOR) TO DATE: TOTAL ARRESTS AND DETAINED JUVENILES (FELONY AND MISDEMEANOR) TO DATE: VERNON POLICE DEPARTMENT REPORT FOR PERSONS ARRESTED ADULT FELONY ARRESTS AND DISPOSITIONS PERIOD ENDING: 1/31/2024 ADULT MISDEMEANOR ARRESTS AND DISPOSITIONS JUVENILES DETAINED --- FELONY AND MISDEMEANOR . . Item 5 Page 6 of 59 . . Item 5 Page 7 of 59 . . Item 5 Page 8 of 59 . . Item 5 Page 9 of 59 . . Item 5 Page 10 of 59 . . Item 5 Page 11 of 59 . . Item 5 Page 12 of 59 . . Item 5 Page 13 of 59 . . Item 5 Page 14 of 59 . . Item 5 Page 15 of 59 . . Item 5 Page 16 of 59 . . Item 5 Page 17 of 59 . . Item 5 Page 18 of 59 . . Item 5 Page 19 of 59 . . Item 5 Page 20 of 59 . . Item 5 Page 21 of 59 . . Item 5 Page 22 of 59 . . Item 5 Page 23 of 59 . . Item 5 Page 24 of 59 . . Item 5 Page 25 of 59 . . Item 5 Page 26 of 59 . . Item 5 Page 27 of 59 . . Item 5 Page 28 of 59 . . Item 5 Page 29 of 59 . . Item 5 Page 30 of 59 . . Item 5 Page 31 of 59 . . Item 5 Page 32 of 59 . . Item 5 Page 33 of 59 . . Item 5 Page 34 of 59 . . Item 5 Page 35 of 59 . . Item 5 Page 36 of 59 . . Item 5 Page 37 of 59 . . Item 5 Page 38 of 59 . . Item 5 Page 39 of 59 . . Item 5 Page 40 of 59 . . Item 5 Page 41 of 59 . . Item 5 Page 42 of 59 . . Item 5 Page 43 of 59 . . Item 5 Page 44 of 59 . . Item 5 Page 45 of 59 . . Item 5 Page 46 of 59 . . Item 5 Page 47 of 59 . . Item 5 Page 48 of 59 . . Item 5 Page 49 of 59 . . Item 5 Page 50 of 59 . . Item 5 Page 51 of 59 . . Item 5 Page 52 of 59 . . Item 5 Page 53 of 59 . . Item 5 Page 54 of 59 . . Item 5 Page 55 of 59 . . Item 5 Page 56 of 59 . . Item 5 Page 57 of 59 . . Item 5 Page 58 of 59 . . Item 5 Page 59 of 59 City Council Agenda Report Meeting Date:March 19, 2024 From:Jessica Alcaraz, Financial Services Administrator Department:Finance Submitted by:Angela Melgar, Finance Manager Subject Amendments No. 3 and No. 4 to the Services Agreement with Tyler Technologies Recommendation A. Approve and authorize the City Administrator to execute Amendment No. 3 to the Services Agreement with Tyler Technologies, Inc., in substantially the same form as submitted, for Enterprise Resource Planning Software as a Service Hosting and Support for a total amount not- to-exceed $1,271,211.34, for a 3-year term; and B. Approve and authorize the City Administrator to execute Amendment No. 4 to the Services Agreement with Tyler Technologies, Inc., in substantially the same form as submitted, to reflect the addition and removal of various modules from the current Agreement, for a total amount not- to-exceed $568,770.22, for the 3-year term. Background Tyler Technologies, Inc. (Tyler) is the market leader in technology solutions for government Enterprise Resource Planning (ERP) software. Enterprise ERP, formerly Munis, is an integrated financial management software that provides a robust and user-friendly solution to access information, streamline reporting, and enhance workflow efficiencies, which aids local governments to ensure accountability, make well-informed decisions, and elevate financial transparency. EERP integrates all of the City’s core functions, including financial reporting, human resources/payroll, and procurement. Similarly, Enterprise Permitting & Licensing (EP&L), formerly EnerGov, provides a simplified solution for permit management and business licenses by automating manual and repetitive tasks and allowing for electronic submittal by businesses. On December 1, 2020, City Council approved an agreement with Tyler for the implementation of a new ERP system and Software as a Service (SaaS) hosting and support services. Since then, most Enterprise ERP and EP&L modules have been implemented and are currently in use, such as Financials, Human Capital Management, Code Enforcement, and Business Management. This software has aided City staff in providing timely payments, service, and data to vendors, customers, and employees. It has added the capability to apply, pay, and check status online for many functions that were previously in-person or paper-based. General Revenues and Utility Billing module implementations are still in progress. The contract has approximately $700,000 remaining available to see these implementation projects through completion. Once complete, these remaining implementations will divest the City completely from the Eden legacy ERP and will offer true integration of all the City’s financial transactions. Amendment No. 3 renews the SaaS and hosting agreement for a period of 3 years stating the annual subscription fees for the first year and the maximum annual increase rate for years 2 and 3 of the agreement. Amendment No. 4 adds EP&L Environmental Health, GIS to the agreement. Environmental Health is the new solution to replace DHD. It simplifies managing inspections and compliance and has a customer facing online portal where they can search for inspection results and report issues that affect public health and community safety. My Civic App is also being added to the . . Item 6 Page 1 of 2 agreement. This is a comprehensive and customizable mobile app platform that connects government departments with residents, visitors, and business owners to promote engagement and simplify access to City services. Through this app the City can send push notifications, provide a secure access to bill payment portals, receive community-reported issues, and report back issue resolution all in one mobile app. Resident Access will be added to replace Citizen Self Service. Citizen Self Service allows the public to access City services, apply for licenses and permits, and create requests. Resident Access is the newer version with increased functionality across multiple Enterprise ERP modules thus enhancing the user experience with one logon to access City services and various payment options The Inventory module is being removed from the annual maintenance agreement until the Geographic Information System (GIS) study is completed and the City is ready to implement the Enterprise Asset Management (EAM) module. The proposed Amendment No. 3 and Amendment No. 4 have been reviewed and approved as to form by the City Attorney’s Office. Fiscal Impact Total fiscal impact is not-to-exceed $1,839,981.56 for the three-year agreement. Sufficient funds are available in General Fund, Information Technology, Repairs & Maintenance – IT Account No. 011-010-110-529110 and IT Equipment & Software Account No. 011-010-110-660005 for the current fiscal year and funds will be budgeted in subsequent fiscal years. Attachments 1. Amendment 3 – SaaS Fees 2. Amendment 4 – Module Additions and Removals Ye a r 1*Ye a r 2*+Ye a r 3*+Tota l Ame ndm e nt No. 3 Annua l Sa a S Fe e 409,909.50$ 422,206.79$ 439,095.06$ 1,271,211.34$ Ame ndm e nt No. 4 My Civic Sa a S Fe e (Citiz e n Enga ge me nt & Re que sts)20,000.00$ 20,600.00$ 21,424.00$ 62,024.00$ Environme nta l He a lth Sa a S Fe e 75,190.00$ 77,445.70$ 80,543.53$ 233,179.23$ Environme nta l He a lth Imple me nta ti on 63,700.00$ 232,500.00$ -$ 296,200.00$ Citize n Se lf Se rvice Sa a S Fe e (re m ova l)(10,962.00)$ (11,290.86)$ (11,742.49)$ (33,995.35)$ Re side nt Acce ss Sa a S Fe e 10,440.00$ 10,753.20$ 11,183.33$ 32,376.53$ Re side nt Acce ss Imple me nta tion 11,200.00$ -$ -$ 11,200.00$ Inve ntory Sa a S Fe e (re mova l)(10,387.65)$ (10,699.28)$ (11,127.25)$ (32,214.18)$ Am e ndme nt No. 4 Tota l 159,180.35$ 319,308.76$ 90,281.11$ 568,770.22$ 569,089.85$ 741,515.55$ 529,376.17$ 1,839,981.56$ *Agreem ent year spans Feb ruary - January + SaaS fee CPI not to exceed 3% in year 2 and 4% in year 3 . . Item 6 Page 2 of 2 1 AMENDMENT NO. 3 This amendment (“Amendment No. 3”) is effective as of the date of signature of the last party to sign as indicated below (“Amendment Effective Date”), by and between Tyler Technologies, Inc. with offices at One Tyler Drive, Yarmouth, Maine 04096 (“Tyler”) and the City of Vernon, California, with offices at 4305 S. Santa Fe Avenue, Vernon, California 90058 (“Client”). WHEREAS, Tyler and Client are parties to an agreement dated January 13, 2021 (“Agreement”); and WHEREAS, the Initial Term of the Agreement expires January 31, 2024 (“Expiration Date”), subject to an optional renewal term upon the parties’ mutual written agreement and amendment; NOW THEREFORE, in consideration of the mutual promises hereinafter contained, Tyler and Client agree as follows: 1. SaaS Term. The term of the Agreement is hereby renewed for an additional period of three (3) years commencing on the day following the Expiration Date (for the purposes of this Amendment, the “Renewal Term”) unless terminated in writing by either party at least sixty (60) days prior to the end of the then-current term. 2. SaaS Fees. SaaS Fees, as detailed in the proforma attached hereto as Exhibit 1, for year one (1) are invoiced annually in advance, beginning on the commencement date of the Renewal Term. Subsequent annual SaaS Fees are invoiced annually in advance, beginning on the anniversary of the initial invoice date. Tyler will not increase annual SaaS fees by more than 3% in year two (2) and 4% in year three (3) of the Renewal Term. 3. Users Limits. The SaaS fees may be based on user limits indicated in the Agreement. Should the number of users be exceeded, Tyler reserves the right to request renegotiation of the SaaS fees based upon any resulting changes in the pricing categories. 4. This Amendment shall be governed by and construed in accordance with the terms and conditions of the Agreement. 5. Except as expressly indicated in this Amendment, all other terms and conditions of the Agreement shall remain in full force and effect. [SIGNATURE PAGE FOLLOWS] . . Item 6 Page 1 of 7 2 IN WITNESS WHEREOF, the parties hereto have executed this Amendment as of the dates set forth below. Tyler Technologies, Inc. City of Vernon, California By: By: Name: Name: Carlos R. Fandino Jr. Title: Title: City Administrator Date: Date: Attest: By: By: Name: Name: Yonnie Parker Title: Title: Deputy City Clerk Date: Date: Approved as to form: By: Name: Zaynah N. Moussa Title: City Attorney Date: Abigail Diaz Chief Legal Officer March 11, 2024 Robert Kennedy-Jensen Group General Counsel March 11, 2024 . . Item 6 Page 2 of 7 3 Exhibit 1 Proforma REMAINDER OF PAGE INTENTIONALLY LEFT BLANK . . Item 6 Page 3 of 7 4 . . Item 6 Page 4 of 7 5 . . Item 6 Page 5 of 7 6 . . Item 6 Page 6 of 7 7 . . Item 6 Page 7 of 7 1 AMENDMENT NO. 4 This amendment (“Amendment No. 4”) is effective as of the date of signature of the last party to sign as indicated below (“Amendment Effective Date”), by and between Tyler Technologies, Inc. with offices at One Tyler Drive, Yarmouth, Maine 04096 (“Tyler”) and the City of Vernon, California, with offices at 4305 S. Santa Fe Avenue, Vernon, California 90058 (“Client”). WHEREAS, Tyler and Client are parties to an agreement dated January 13, 2021 (“Agreement”); and WHEREAS, Tyler and Client desire to amend the terms of the Agreement as provided herein. NOW THEREFORE, in consideration of the mutual promises hereinafter contained, Tyler and Client agree as follows: 1.Enterprise Permitting & Licensing; Environmental Health; GIS. a.The items set forth in the sales quotation attached as Exhibit 1 to this Amendment are hereby added to the Agreement as of the earlier of (i) commencement of implementation of the Tyler Software set forth in Exhibit 1; or (ii) October 1, 2024 (“Start Date”) and, notwithstanding anything to the contrary in Exhibit 1, ending at the same time as the SaaS Term as defined in the Agreement, as amended. Payment of fees and costs for such items shall conform to the following terms: i.The annual SaaS fees payable under the Agreement shall be increased in the amount of $95,190, for the Tyler Software added herein. The prorated SaaS Fees shall be invoiced on the Start Date. Subsequent SaaS Fees shall be invoiced in accord with the terms of the Agreement. ii.Services added to the Agreement pursuant to this Amendment, along with applicable expenses, shall be invoiced as provided and/or incurred. b.Client acknowledges that Tyler will neither make the Tyler Software set forth in Exhibit 1 available nor commence providing the professional services set forth in Exhibit 1 until the Start Date. 2.Inventory; Citizen Self Service. a.The following Tyler Software as a Service (SaaS) are hereby removed from the Agreement as of February 1, 2024: Inventory Citizen Self Service b.As of such date, Client’s right to access the above-listed software is terminated, as are Tyler’s obligations to maintain, support, host and update such software. . . Item 6 Page 1 of 16 2 c.Additionally, Client’s SaaS fees payment obligation the above-listed software ends on the same date. 3.Resident Access. a.The items set forth in the sales quotation attached as Exhibit 2 to this Amendment are hereby added to the Agreement as of February 1, 2024 and, notwithstanding anything to the contrary in Exhibit 2, ending coterminous with the SaaS Term as defined in the Agreement. Payment of fees and costs for such items shall conform to the following terms: i.The annual SaaS fees payable under the Agreement shall be increased in the amount of $10,440, for the Tyler Software added herein. The first year’s annual SaaS Fees shall be invoiced on February 1, 2024. Subsequent SaaS Fees shall be invoiced in accordance with the terms of the Agreement. ii.Unless otherwise provided herein, services identified at Exhibit 2 and added to the Agreement pursuant to this Amendment, along with applicable expenses, shall be invoiced as provided and/or incurred. 4.This Amendment shall be governed by and construed in accordance with the terms and conditions of the Agreement. 5.Except as expressly indicated in this Amendment, all other terms and conditions of the Agreement shall remain in full force and effect. [SIGNATURE PAGE FOLLOWS] . . Item 6 Page 2 of 16 3 IN WITNESS WHEREOF, the parties hereto have executed this Amendment as of the dates set forth below. Tyler Technologies, Inc. City of Vernon, California By: By: Name: Name: Carlos R. Fandino Jr. Title: Title: City Administrator Date: Date: Attest: By: By: Name: Name: Yonnie Parker Title: Title: Deputy City Clerk Date: Date: Approved as to form: By: Name: Zaynah N. Moussa Title: City Attorney Date: Abigail Diaz Chief Legal Officer March 11, 2024 Robert Kennedy-Jensen Group General Counsel March 11, 2024 . . Item 6 Page 3 of 16 Exhibit 1 4 Exhibit 1 Investment Summary The following Investment Summary details the software, products, and services to be delivered by us to you under the Agreement. This Investment Summary is effective as of the Effective Date, despite any expiration date in the Investment Summary that may have lapsed as of the Effective Date. Capitalized terms not otherwise defined will have the meaning assigned to such terms in the Agreement. In the event of conflict between the Agreement and terms in the Comments section of this Investment Summary, the language in the Agreement will prevail. REMAINDER OF PAGE INTENTIONALLY LEFT BLANK . . Item 6 Page 4 of 16 Exhibit 1 5 . . Item 6 Page 5 of 16 Exhibit 1 6 . . Item 6 Page 6 of 16 Exhibit 1 7 . . Item 6 Page 7 of 16 Exhibit 1 8 . . Item 6 Page 8 of 16 Exhibit 1 9 . . Item 6 Page 9 of 16 Exhibit 1 10 . . Item 6 Page 10 of 16 Exhibit 1 11 . . Item 6 Page 11 of 16 Exhibit 2 12 Exhibit 2 Investment Summary The following Investment Summary details the software, products, and services to be delivered by us to you under the Agreement. This Investment Summary is effective as of the Effective Date, despite any expiration date in the Investment Summary that may have lapsed as of the Effective Date. Capitalized terms not otherwise defined will have the meaning assigned to such terms in the Agreement. In the event of conflict between the Agreement and terms in the Comments section of this Investment Summary, the language in the Agreement will prevail. REMAINDER OF PAGE INTENTIONALLY LEFT BLANK . . Item 6 Page 12 of 16 Exhibit 2 13 . . Item 6 Page 13 of 16 Exhibit 2 14 . . Item 6 Page 14 of 16 Exhibit 2 15 . . Item 6 Page 15 of 16 Exhibit 2 16 . . Item 6 Page 16 of 16 City Council Agenda Report Meeting Date:March 19, 2024 From:Carlos Fandino, City Administrator Department:City Administration Submitted by:Diana Figueroa, Management Analyst Subject Fire Department Activity Report Recommendation Receive and file the January 2024 Fire Department Activity Report. Background Attached is a copy of a Fire Department Activity Report which covers the period of January 1 through January 31, 2024. The report is provided by Los Angeles County Fire and consists of incident details and a summary for the month. Fiscal Impact There is no fiscal impact associated with this report. Attachments 1. Fire Department Activity Report – January 2024 . . Item 7 Page 1 of 1 LOS ANGELES COUNTY FIRE DEPARTMENT CITY OF VERNON FIRE STATISTICAL REPORT JANUARY 2024 1 . . Item 7 Page 1 of 15 FIRES: Incident Date/Time Basic Incident Basic Incident Full Number (FD1) Address Basic Incident Type Code And Property Pre- Description (FD1.21) Basic Basic Property Losses (FD1.35) Basic Contents Pre- Incident Basic Content Losses (FD1.36) Basic Primary Station Name Basic Incident Basic Person Address Favorite Involved Postal Code (FD3.18) Incident Value (FD1.37) Value (FD1.38) Address Postal Code (FD1.78)(FD1.4) Basic Incident City Name (FD1.16): VERNON Basic Incident Postal Code (FD1.19): 90058 01/04/2024 LAC24004995 01/08/2024 LAC24009464 01/09/2024 LAC24011022 East VERNON Avenue and S SANTA FE AV VERNON CA 90058 100 - Fire, other LAC052 4361 South SOTO Street VERNON CA other outside 90058 154 - Dumpster or 500 500 LAC052 LAC027 trash receptacle fire South SB 710 SO 150 - Outside 0 0 0 BANDINI Boulevard rubbish fire, other and 710 FWY VERNON CA 90058 01/16/2024 LAC24020050 01/20/2024 LAC24024316 01/21/2024 LAC24025925 01/24/2024 LAC24029637 LAC24029832 4301 South SANTA FE Avenue VERNON CA 90058 150 - Outside rubbish fire, other LAC052 LAC052 LAC052 LAC052 LAC052 2230 East 38TH Street VERNON CA 90058 111 - Building fire 3810 South SANTA FE Avenue VERNON CA 90058 waste fire 151 - Outside rubbish, trash or 1938 East 46TH Street VERNON CA rubbish fire, other 90058 150 - Outside 2444 South 151 - Outside ALAMEDA Street rubbish, trash or VERNON CA 90058 waste fire 2 . . Item 7 Page 2 of 15 Incident Date/Time Basic Incident Basic Incident Full Basic Incident Type Code And Property Pre- Description (FD1.21) Basic Basic Property Losses (FD1.35) Basic Contents Pre- Incident Basic Content Losses (FD1.36) Basic Primary Station Name Basic Incident Basic Person Number (FD1)Address Address Favorite Involved Postal Code (FD3.18) Incident Value (FD1.37) Value (FD1.38) Address Postal Code (FD1.78)(FD1.4) LAC24029930 East 37TH Street 151 - Outside LAC052 and BANDINI BLVD rubbish, trash or VERNON CA 90058 waste fire 01/25/2024 LAC24031108 01/26/2024 LAC24031868 4333 MAYWOOD VERNON CA 90058 rubbish fire, other 150 - Outside LAC013 LAC052South ALAMEDA 118 - Trash or Street and 25TH ST rubbish fire, VERNON CA 90058 contained 01/28/2024 LAC24034215 LAC24035004 BICKETT Street and 150 - Outside LAC013 LAC027 LAC013 E 54TH ST rubbish fire, other VERNON CA 90058 SB 710 AT BANDINI 131 - Passenger Boulevard VERNON vehicle fire CA 90058 01/29/2024 LAC24035191 5400 South ALCOA 132 - Road freight Avenue and E SLAUSON AV or transport vehicle fire VERNON CA 90058 Count: 14 TRANSPORTS: Disposition Incident Patient Disposition (eDisposition.12)Number of Incidents (ALS) Patient Treated, Transported Canceled (Prior to Arrival At Scene) Canceled on Scene (FD Not Needed) 9 8 11 3Canceled on Scene (Unable to Locate Patient) Care Transferred to BLS 29 11 1 Patient Refusal (AMA) - (No Transport) Treated and Transferred Care 3 . . Item 7 Page 3 of 15 CITY OF VERNON STATISTICS JANUARY 2024 INCIDENT SUMMARY TYPES AND TOTALS: Cad Initial Cad Incident Type Description Fire Initial Cad Incident Type Description (FD1.86) Basic Incident Type Code And Description (FD1.21) Number of incidents Property Loss Content Loss Acres Burned Basic Incident Type Category (FD1.21): (None) Basic Incident City Name (FD1.16): VERNON ALRA ALRWF EMS ALRA ALRWF EMS 1 3 1 1MISC1MISC1 Total: 6 Total: $0 Total: 0 Total: 0 Basic Incident Type Category (FD1.21): 1 - Fire Basic Incident City Name (FD1.16): VERNON INVO INVO 118 - Trash or rubbish fire, contained 132 - Road freight or transport vehicle fire 150 - Outside rubbish fire, other 100 - Fire, other 1 1 1 1 2 2 1 INVO INVO INVO INVO $0 0 MISC1 MISC1 MISC1 MISC1 MISC1 MISC1 MISC1 MISC1 150 - Outside rubbish fire, other 151 - Outside rubbish, trash or waste fire 154 - Dumpster or other outside trash receptacle fire $500 $0RUBRUB150 - Outside rubbish fire, other 151 - Outside rubbish, trash or waste fire 111 - Building fire 2 0 RUB RUB 1 STRC TREE VEHF STRC TREE VEHF 1 150 - Outside rubbish fire, other 131 - Passenger vehicle fire 1 1 Total: 15 Total: $500 Total: 0 Total: 0 Basic Incident Type Category (FD1.21): 3 - Rescue & Emergency Medical Service Incident Basic Incident City Name (FD1.16): VERNON BLEEDA BLEEDA 321 - EMS call, excluding vehicle accident with injury 1 2 1 DB DB 321 - EMS call, excluding vehicle accident with injury DIAA DIAA 321 - EMS call, excluding vehicle accident with injury EMS EMS EMS EMS 300 - Rescue, EMS incident, other 1 3321 - EMS call, excluding vehicle accident with injury 4 . . Item 7 Page 4 of 15 CITY OF VERNON STATISTICS JANUARY 2024 INCIDENT SUMMARY Cad Initial Cad Incident Type Description Fire Initial Cad Incident Type Description (FD1.86) Basic Incident Type Code And Description (FD1.21) Number of incidents Property Loss Content Loss Acres Burned INJA INJA 321 - EMS call, excluding vehicle accident with injury 10 2INJBINJB321 - EMS call, excluding vehicle accident with injury MAT MAT 321 - EMS call, excluding vehicle accident with injury 2 SICKA SNAKE SZR SICKA SNAKE SZR 321 - EMS call, excluding vehicle accident with injury 3 321 - EMS call, excluding vehicle accident with injury 1 321 - EMS call, excluding vehicle accident with injury 2 TCA TCA TCA TCA 300 - Rescue, EMS incident, other 1 4321 - EMS call, excluding vehicle accident with injury TCB TCB TCB TCB TCB TCB 300 - Rescue, EMS incident, other 3 1 3 320 - Emergency medical service, other 321 - EMS call, excluding vehicle accident with injury TCB TCP VEH VEHL TCB TCP VEH VEHL 322 - Motor vehicle accident with injuries 322 - Motor vehicle accident with injuries 322 - Motor vehicle accident with injuries 3 1 1 1321 - EMS call, excluding vehicle accident with injury Total: 46 Total: $0 Total: 0 Total: 0 Basic Incident Type Category (FD1.21): 6 - Good Intent Call Basic Incident City Name (FD1.16): VERNON ALRA ALRA ALRAR ALRWF ALRWFR DB ALRA ALRA ALRAR ALRWF ALRWFR DB 600 - Good intent call, other 4 13 1 611 - Dispatched and cancelled en route 611 - Dispatched and cancelled en route 611 - Dispatched and cancelled en route 600 - Good intent call, other 7 1 611 - Dispatched and cancelled en route 600 - Good intent call, other 1 EMS EMS 1 EMS EMS 611 - Dispatched and cancelled en route 600 - Good intent call, other 2 INJA INJA 1 MISC1 MISC1 MISC1 MISC1 600 - Good intent call, other 2 611 - Dispatched and cancelled en route 1 5 . . Item 7 Page 5 of 15 CITY OF VERNON STATISTICS JANUARY 2024 INCIDENT SUMMARY Cad Initial Cad Incident Type Description Fire Initial Cad Incident Type Description (FD1.86) Basic Incident Type Code And Description (FD1.21) Number of incidents Property Loss Content Loss Acres Burned RUB RUB STRC TCA TCA TCB TCT UNC 600 - Good intent call, other 2 1 2 2 3 1 1 STRC TCA TCA TCB TCT 611 - Dispatched and cancelled en route 600 - Good intent call, other 611 - Dispatched and cancelled en route 600 - Good intent call, other 600 - Good intent call, other UNC 611 - Dispatched and cancelled en route Total: 46 Total: $0 Total: 0 Total: 0 Basic Incident Type Category (FD1.21): 7 - False Alarm & False Call Basic Incident City Name (FD1.16): VERNON ALRA ALRA ALRA ALRA 700 - False alarm or false call, other 5 1735 - Alarm system sounded due to malfunction ALRA ALRA ALRAR ALRA ALRA ALRAR 744 - Detector activation, no fire - unintentional 2 2 1 745 - Alarm system activation, no fire - unintentional 744 - Detector activation, no fire - unintentional ALRMAN ALRWF ALRWF ALRWF ALRMAN ALRWF ALRWF ALRWF 730 - System malfunction, other 700 - False alarm or false call, other 730 - System malfunction, other 1 3 1 3744 - Detector activation, no fire - unintentional ALRWF ALRWF 745 - Alarm system activation, no fire - unintentional 1 ALRWFR ALRWFR ALRWFR ALRWFR 730 - System malfunction, other 1 1735 - Alarm system sounded due to malfunction MISC1 STRC MISC1 STRC 700 - False alarm or false call, other 700 - False alarm or false call, other 1 1 Total: 24 Total: 137 Total: $0 Total: 0 Total: 0 Total: 0 Total: 0Total: $500 6 . . Item 7 Page 6 of 15 CITY OF VERNON STATISTICS JANUARY 2024 CITY DETAILS CITY DETAILS: Alarm Date Time Basic Incident Number (FD1) Cad Initial Cad Incident Type Description Incident Type Address Basic Incident Full Street Address Basic First Arrived At Scene Apparatus ID Basic Property Losses (FD1.35) Basic Content Losses (FD1.36) 01/01/24 01/01/24 LAC24000391 LAC24001059 ALRA 611 - Dispatched and 3450 East VERNON Avenue 3450 East VERNON Avenuecancelled en route VERNON CA 90058 DIAA 321 - EMS call, excluding vehicle accident with injury 4240 BANDINI Boulevard VERNON CA 90023 4240 BANDINI Boulevard S13 E5201/02/24 01/02/24 01/02/24 01/02/24 01/03/24 01/03/24 01/04/24 01/04/24 LAC24001453 LAC24001563 LAC24001637 LAC24001821 LAC24002944 LAC24003846 LAC24003880 LAC24003929 ALRA ALRA ALRA ALRA ALRWF ALRA VEH 700 - False alarm or false call, other 2600 East 28TH Street VERNON CA 90058 2600 East 28TH Street 600 - Good intent call, other 3450 East VERNON Avenue VERNON CA 90058 3450 East VERNON Avenue 600 - Good intent call, other 3055 East 44TH Street VERNON CA 90058 3055 East 44TH Street 600 - Good intent call, other 5580 South ALAMEDA Street 5580 South ALAMEDA VERNON CA 90058 Street 700 - False alarm or false call, other 3425 East VERNON Avenue VERNON CA 90058 3425 East VERNON Avenue E52 611 - Dispatched and 3055 East 44TH Street 3055 East 44TH Street cancelled en route VERNON CA 90058 322 - Motor vehicle 4809 South ALCOA Avenue 4809 South ALCOA Avenue S13 E52 accident with injuries VERNON CA 90058 INJA 321 - EMS call, excluding vehicle accident with injury 4580 South PACIFIC Boulevard VERNON CA 90058 4580 South PACIFIC Boulevard 01/04/24 01/04/24 01/04/24 LAC24004076 LAC24004304 LAC24004485 ALRA ALRA TCB 700 - False alarm or false call, other 3425 East VERNON Avenue VERNON CA 90058 3425 East VERNON Avenue E52 611 - Dispatched and 3450 East VERNON Avenue cancelled en route 3450 East VERNON AvenueVERNON CA 90058 322 - Motor vehicle accident with injuries S SOTO ST VERNON CA 90058 East LEONIS Boulevard and East LEONIS Boulevard E52 and S SOTO ST 01/04/24 01/04/24 LAC24004720 LAC24004995 ALRA 611 - Dispatched and 3055 East 44TH Street 3055 East 44TH Street cancelled en route VERNON CA 90058 MISC1 100 - Fire, other East VERNON Avenue and S East VERNON Avenue E52 SANTA FE AV VERNON CA 90058 and S SANTA FE AV 01/05/24 01/05/24 LAC24005262 LAC24005297 TCP UNC 322 - Motor vehicle accident with injuries and FRUITLAND AV VERNON CA 90058 123 South ALCOA Avenue 123 South ALCOA Avenue and FRUITLAND AV S13 611 - Dispatched and 5831 South SANTA FE cancelled en route 5831 South SANTA FE Avenue S164 Avenue VERNON CA 90058 7 . . Item 7 Page 7 of 15 CITY OF VERNON STATISTICS JANUARY 2024 CITY DETAILS Alarm Date Time Basic Incident Number (FD1) Cad Initial Cad Incident Type Description Incident Type Address Basic Incident Full Street Address Basic First Arrived At Scene Apparatus ID Basic Property Losses (FD1.35) Basic Content Losses (FD1.36) 01/05/24 01/05/24 LAC24005715 LAC24005944 ALRA 611 - Dispatched and 4353 East EXCHANGE 4353 East EXCHANGE Avenuecancelled en route Avenue VERNON CA 90058 SNAKE 321 - EMS call,2646 South DOWNEY Road 2646 South DOWNEY E52 E52 excluding vehicle accident with injury and E 26TH ST VERNON CA Road and E 26TH ST 90023 01/06/24 01/06/24 01/06/24 LAC24006727 LAC24006815 LAC24007103 ALRAR ALRA TCA 611 - Dispatched and 3055 East 44TH Street cancelled en route VERNON CA 90058 3055 East 44TH Street 611 - Dispatched and 3055 East 44TH Street 3055 East 44TH Street cancelled en route VERNON CA 90058 321 - EMS call, excluding vehicle accident with injury 123 South DOWNEY Road and BANDINI BLVD VERNON CA 90023 123 South DOWNEY Road and BANDINI BLVD S13 01/06/24 01/07/24 01/07/24 LAC24007337 LAC24008114 LAC24008459 EMS INJA TCB 321 - EMS call, excluding vehicle accident with injury East SLAUSON Avenue and STATE ST VERNON CA 90058 East SLAUSON Avenue S13 and STATE ST 321 - EMS call, excluding vehicle accident with injury FRUITLAND Avenue and S PACIFIC BLVD VERNON CA S PACIFIC BLVD 90058 FRUITLAND Avenue and E52 300 - Rescue, EMS incident, other South ATLANTIC Boulevard and DISTRICT BLVD VERNON CA 90040 South ATLANTIC Boulevard and E13 DISTRICT BLVD 01/08/24 01/08/24 01/08/24 01/08/24 LAC24008898 LAC24009130 LAC24009273 LAC24009464 RUB 600 - Good intent call, other South ALAMEDA Street and 25TH ST VERNON CA 90058 and 25TH ST South ALAMEDA Street E52 E27ALRA ALRWF MISC1 700 - False alarm or false call, other 4151 BANDINI BLVD #4159 VERNON CA 90023 4151 BANDINI BLVD #4159 611 - Dispatched and 3851 South SANTA FE cancelled en route 3851 South SANTA FE AvenueAvenue VERNON CA 90058 154 - Dumpster or other outside trash receptacle fire 4361 South SOTO Street VERNON CA 90058 4361 South SOTO Street E52 500 01/08/24 01/09/24 LAC24009652 LAC24010340 ALRA DB 611 - Dispatched and 3055 East 44TH Street 3055 East 44TH Street cancelled en route VERNON CA 90058 321 - EMS call, excluding vehicle accident with injury 4625 East 50TH Street VERNON CA 90058 4625 East 50TH Street S13 E5201/09/24 01/09/24 LAC24010365 LAC24011007 ALRA RUB 700 - False alarm or false call, other 5700 South ALAMEDA Street 5700 South ALAMEDA VERNON CA 90058 Street 150 - Outside rubbish BANDINI Boulevard and BANDINI Boulevard and E27 PENNINGTON WY VERNON PENNINGTON WY CA 90201 0 0 fire, other 8 . . Item 7 Page 8 of 15 CITY OF VERNON STATISTICS JANUARY 2024 CITY DETAILS Alarm Date Time Basic Incident Number (FD1) Cad Initial Cad Incident Type Description Incident Type Address Basic Incident Full Street Address Basic First Arrived At Scene Apparatus ID Basic Property Losses (FD1.35) Basic Content Losses (FD1.36) 01/09/24 01/10/24 01/10/24 01/10/24 01/10/24 01/11/24 LAC24011022 LAC24012023 LAC24012208 LAC24012250 LAC24012345 LAC24012970 INVO 150 - Outside rubbish South SB 710 SO BANDINI South SB 710 SO BANDINI Boulevard and 710 FWY E27 0 0 fire, other Boulevard and 710 FWY VERNON CA 90058 TCB 321 - EMS call, excluding vehicle accident with injury East 44TH Street and S BOYLE AV VERNON CA 90058 East 44TH Street and S BOYLE AV E52 TCA 600 - Good intent call, other SB 710 at Bandini SB 710 AT SB 710 at Bandini SB BANDINI Boulevard VERNON CA 90058 S163 710 AT BANDINI Boulevard TCA 321 - EMS call, excluding vehicle accident with injury 5100 DISTRICT Boulevard VERNON CA 90058 5100 DISTRICT Boulevard RUB ALRWF 600 - Good intent call, other DISTRICT Boulevard and HELIOTROPE AV VERNON CA 90040 DISTRICT Boulevard and HELIOTROPE AV E163 E13744 - Detector activation, no fire - unintentional 5215 South BOYLE Avenue VERNON CA 90058 5215 South BOYLE Avenue 01/12/24 01/12/24 LAC24014004 LAC24014187 ALRMAN INJA 730 - System malfunction, other 2590 HARRIETT Street VERNON CA 90058 2590 HARRIETT Street E52 E27321 - EMS call, excluding vehicle accident with injury 4901 BANDINI Boulevard VERNON CA 90201 4901 BANDINI Boulevard 01/12/24 01/12/24 01/12/24 01/12/24 LAC24014196 LAC24014393 LAC24014570 LAC24014966 ALRWFR EMS 730 - System malfunction, other 3268 East VERNON Avenue VERNON CA 90058 3268 East VERNON Avenue E52 S13 E52 E163 300 - Rescue, EMS incident, other 6133 MALBURG Way VERNON CA 90058 6133 MALBURG Way ALRWF EMS 730 - System malfunction, other 2051 East 27TH Street VERNON CA 90058 2051 East 27TH Street 611 - Dispatched and GIFFORD Avenue and cancelled en route GIFFORD Avenue and DISTRICT BLVDDISTRICT BLVD VERNON CA 90058 01/12/24 01/12/24 LAC24014971 LAC24015010 TCA TCB 300 - Rescue, EMS incident, other BANDINI Boulevard and S BONNIE BEACH PL VERNON CA 90023 BANDINI Boulevard and E27 S BONNIE BEACH PL 320 - Emergency medical service, other 4177 BANDINI Boulevard VERNON CA 90023 4177 BANDINI Boulevard E27 01/13/24 01/13/24 LAC24015171 LAC24015247 TCB 322 - Motor vehicle accident with injuries VERNON CA 90058 STATE Street and 61ST ST STATE Street and 61ST E13 ST ALRA 600 - Good intent call, other 4820 East 50TH Street VERNON CA 90058 4820 East 50TH Street E163 9 . . Item 7 Page 9 of 15 CITY OF VERNON STATISTICS JANUARY 2024 CITY DETAILS Alarm Date Time Basic Incident Number (FD1) Cad Initial Cad Incident Type Description Incident Type Address Basic Incident Full Street Address Basic First Arrived At Scene Apparatus ID Basic Property Losses (FD1.35) Basic Content Losses (FD1.36) 01/13/24 LAC24016038 MISC1 600 - Good intent call, other South ATLANTIC Boulevard and 710 FWY VERNON CA 90040 South ATLANTIC Boulevard and 710 FWY E27 01/13/24 01/13/24 01/14/24 01/14/24 01/15/24 01/15/24 01/15/24 01/15/24 01/15/24 01/15/24 LAC24016123 LAC24016456 LAC24016753 LAC24017656 LAC24017897 LAC24017939 LAC24018032 LAC24018033 LAC24018754 LAC24018892 INJA 600 - Good intent call, other 3737 South SOTO Street VERNON CA 90058 3737 South SOTO Street 4444 East 26TH Street 4444 East 26TH Street 4444 East 26TH Street 3055 East 44TH Street 4444 East 26TH Street ALRWF ALRA 611 - Dispatched and 4444 East 26TH Street cancelled en route VERNON CA 90023 700 - False alarm or false call, other 4444 East 26TH Street VERNON CA 90023 ALRWF ALRA 700 - False alarm or false call, other 4444 East 26TH Street VERNON CA 90023 611 - Dispatched and 3055 East 44TH Street cancelled en route VERNON CA 90058 ALRWF ALRWFR ALRWF MISC1 INJA 700 - False alarm or false call, other 4444 East 26TH Street VERNON CA 90023 600 - Good intent call, other 2901 FRUITLAND Avenue VERNON CA 90058 2901 FRUITLAND Avenue E13 611 - Dispatched and 3255 SACO Street VERNON 3255 SACO Street cancelled en route CA 90058 700 - False alarm or false call, other 25TH Street and S SANTA FE AV VERNON CA 90058 25TH Street and S SANTA FE AV E52 E52321 - EMS call, excluding vehicle accident with injury 4800 South SANTA FE Avenue VERNON CA 90058 4800 South SANTA FE Avenue 01/16/24 01/16/24 LAC24019815 LAC24019873 INJA TCB 321 - EMS call, excluding vehicle accident with injury 1 South PACIFIC Boulevard and E 45TH ST VERNON CA Boulevard and E 45TH 90058 1 South PACIFIC E52 S13 E52 ST 321 - EMS call, excluding vehicle accident with injury 5681 South DOWNEY Road and E SLAUSON AV VERNON CA 90058 5681 South DOWNEY Road and E SLAUSON AV 01/16/24 01/16/24 01/17/24 LAC24020050 LAC24020156 LAC24020364 MISC1 ALRA TCB 150 - Outside rubbish 4301 South SANTA FE fire, other Avenue VERNON CA 90058 4301 South SANTA FE Avenue 611 - Dispatched and 3055 East 44TH Street cancelled en route 3055 East 44TH Street VERNON CA 90058 600 - Good intent call, other East VERNON Avenue and S East VERNON Avenue SANTA FE AV VERNON CA 90058 E52 E52 and S SANTA FE AV 2600 East 28TH Street01/17/24 LAC24020444 SZR 321 - EMS call, excluding vehicle accident with injury 2600 East 28TH Street VERNON CA 90058 10 . . Item 7 Page 10 of 15 CITY OF VERNON STATISTICS JANUARY 2024 CITY DETAILS Alarm Date Time Basic Incident Number (FD1) Cad Initial Cad Incident Type Description Incident Type Address Basic Incident Full Street Address Basic First Arrived At Scene Apparatus ID Basic Property Losses (FD1.35) Basic Content Losses (FD1.36) 01/17/24 01/17/24 LAC24020472 LAC24021230 MISC1 600 - Good intent call, other 2100 25TH Street VERNON CA 90058 2100 25TH Street E52 EMS TCB 600 - Good intent call, other SANTA FE Avenue and E SLAUSON AV VERNON CA 90255 SANTA FE Avenue and E SLAUSON AV S164 01/18/24 01/18/24 01/19/24 01/19/24 01/19/24 01/19/24 01/19/24 01/19/24 01/19/24 01/19/24 LAC24021680 LAC24021842 LAC24022818 LAC24022824 LAC24022896 LAC24022901 LAC24022926 LAC24023013 LAC24023015 LAC24023578 300 - Rescue, EMS incident, other South ATLANTIC Boulevard and 710 FWY VERNON CA 90040 South ATLANTIC Boulevard and 710 FWY E27 S13MAT TCA 321 - EMS call, excluding vehicle accident with injury 3385 East LEONIS Boulevard 3385 East LEONIS VERNON CA 90058 Boulevard 611 - Dispatched and East SLAUSON Avenue and cancelled en route East SLAUSON Avenue and STATE STSTATE ST VERNON CA 90058 TCA 321 - EMS call, excluding vehicle accident with injury East SLAUSON Avenue and STATE ST VERNON CA 90058 East SLAUSON Avenue S13 and STATE ST INJA SICKA TCB 321 - EMS call, excluding vehicle accident with injury 1937 East VERNON Avenue VERNON CA 90058 1937 East VERNON Avenue E52 E13 E52 S13 E27 321 - EMS call, excluding vehicle accident with injury 3870 SEVILLE Avenue VERNON CA 90058 3870 SEVILLE Avenue 321 - EMS call, excluding vehicle accident with injury East 46TH Street and S SOTO ST VERNON CA 90058 East 46TH Street and S SOTO ST EMS MAT MISC1 611 - Dispatched and 4221 South BANDINI cancelled en route 4221 South BANDINI BoulevardBoulevard VERNON CA 90023 321 - EMS call, excluding vehicle accident with injury 4222 BANDINI Boulevard VERNON CA 90023 4222 BANDINI Boulevard 611 - Dispatched and South GRANDE VISTA cancelled en route South GRANDE VISTA Avenue and EAvenue and E WASHINGTON BLVD VERNON CA 90023 WASHINGTON BLVD 01/20/24 01/20/24 LAC24024316 LAC24024426 STRC EMS 111 - Building fire 2230 East 38TH Street VERNON CA 90058 2230 East 38TH Street T164 321 - EMS call,0 South DOWNEY Road and 0 South DOWNEY Road E13 excluding vehicle accident with injury E EXCHANGE AV VERNON CA 90058 and E EXCHANGE AV 11 . . Item 7 Page 11 of 15 CITY OF VERNON STATISTICS JANUARY 2024 CITY DETAILS Alarm Date Time Basic Incident Number (FD1) Cad Initial Cad Incident Type Description Incident Type Address Basic Incident Full Street Address Basic First Arrived At Scene Apparatus ID Basic Property Losses (FD1.35) Basic Content Losses (FD1.36) 01/20/24 01/21/24 LAC24024432 LAC24025925 EMS 321 - EMS call, excluding vehicle accident with injury 4401 South DOWNEY Road VERNON CA 90058 4401 South DOWNEY Road Q13 E52RUB151 - Outside rubbish, trash or waste fire 3810 South SANTA FE Avenue VERNON CA 90058 3810 South SANTA FE Avenue 01/22/24 01/22/24 LAC24026773 LAC24026928 ALRA TCA 611 - Dispatched and 3055 East 44TH Street 3055 East 44TH Street cancelled en route VERNON CA 90058 600 - Good intent call, other South SANTA FE Avenue and E 48TH ST VERNON CA Avenue and E 48TH ST 90058 South SANTA FE E52 01/22/24 01/23/24 01/23/24 01/24/24 LAC24027223 LAC24027926 LAC24028193 LAC24028994 TCA 611 - Dispatched and 4615 South ALCOA Avenue cancelled en route VERNON CA 90058 4615 South ALCOA Avenue ALRA ALRA ALRA 611 - Dispatched and 4601 South SOTO Street cancelled en route VERNON CA 90058 4601 South SOTO Street 611 - Dispatched and 2700 FRUITLAND Avenue 2700 FRUITLAND Avenuecancelled en route VERNON CA 90058 745 - Alarm system activation, no fire - unintentional 3336 FRUITLAND Avenue VERNON CA 90058 3336 FRUITLAND Avenue E13 E52 E52 E52 01/24/24 01/24/24 01/24/24 LAC24029078 LAC24029262 LAC24029375 TCB 322 - Motor vehicle South SANTA FE Avenue South SANTA FE accident with injuries and E 54TH ST VERNON CA Avenue and E 54TH ST 90058 ALRA INJA 735 - Alarm system sounded due to malfunction 5353 South DOWNEY Road VERNON CA 90058 5353 South DOWNEY Road 321 - EMS call, excluding vehicle accident with injury 2049 East 27TH Street VERNON CA 90058 2049 East 27TH Street 1938 East 46TH Street01/24/24 01/24/24 LAC24029637 LAC24029832 MISC1 MISC1 150 - Outside rubbish 1938 East 46TH Street E52 E52 fire, other VERNON CA 90058 151 - Outside rubbish, trash or waste fire 2444 South ALAMEDA Street 2444 South ALAMEDA VERNON CA 90058 East 37TH Street and BANDINI BLVD VERNON CA BANDINI BLVD 90058 Street 01/24/24 01/24/24 LAC24029930 LAC24030079 MISC1 STRC 151 - Outside rubbish, trash or waste fire East 37TH Street and E52 611 - Dispatched and FRUITLAND Avenue and FRUITLAND Avenue and E13 LOMA VISTA AVcancelled en route LOMA VISTA AV VERNON CA 90270 12 . . Item 7 Page 12 of 15 CITY OF VERNON STATISTICS JANUARY 2024 CITY DETAILS Alarm Date Time Basic Incident Number (FD1) Cad Initial Cad Incident Type Description Incident Type Address Basic Incident Full Street Address Basic First Arrived At Scene Apparatus ID Basic Property Losses (FD1.35) Basic Content Losses (FD1.36) 01/25/24 LAC24030540 ALRA 745 - Alarm system activation, no fire - unintentional 5353 South DOWNEY Road VERNON CA 90058 5353 South DOWNEY Road E13 01/25/24 01/25/24 01/26/24 01/26/24 LAC24030865 LAC24031108 LAC24031465 LAC24031549 TCB 600 - Good intent call, other 2468 East 26TH Street VERNON CA 90058 2468 East 26TH Street 4333 MAYWOOD E52 E13 E52 S163 TREE STRC INJB 150 - Outside rubbish 4333 MAYWOOD VERNON fire, other CA 90058 700 - False alarm or false call, other 2150 East 37TH Street VERNON CA 90058 2150 East 37TH Street 4950 East 49TH Street321 - EMS call, excluding vehicle accident with injury 4950 East 49TH Street VERNON CA 90058 01/26/24 01/26/24 01/26/24 01/26/24 01/27/24 01/27/24 01/28/24 01/28/24 LAC24031605 LAC24031649 LAC24031868 LAC24032048 LAC24032636 LAC24032896 LAC24033874 LAC24033906 INJA 321 - EMS call, excluding vehicle accident with injury 4454 South PACIFIC Boulevard VERNON CA 90058 4454 South PACIFIC Boulevard E52 ALRWF INVO 611 - Dispatched and 4621 South PACIFIC cancelled en route 4621 South PACIFIC BoulevardBoulevard VERNON CA 90058 118 - Trash or rubbish fire, contained South ALAMEDA Street and 25TH ST VERNON CA 90058 and 25TH ST South ALAMEDA Street E52 E27TCB300 - Rescue, EMS incident, other 3939 South ATLANTIC Boulevard VERNON CA 90040 3939 South ATLANTIC Boulevard EMS BANDINI Boulevard and S ATLANTIC BLVD VERNON CA 90040 BANDINI Boulevard and S ATLANTIC BLVD ALRWF INJA 611 - Dispatched and 4621 South PACIFIC cancelled en route 4621 South PACIFIC BoulevardBoulevard VERNON CA 90058 321 - EMS call, excluding vehicle accident with injury 4440 DISTRICT Boulevard VERNON CA 90058 4440 DISTRICT Boulevard S13 E52BLEEDA321 - EMS call,South SANTA FE Avenue South SANTA FE excluding vehicle accident with injury and E 58TH ST VERNON CA Avenue and E 58TH ST 90058 01/28/24 01/28/24 LAC24034215 LAC24034769 RUB INJB 150 - Outside rubbish BICKETT Street and E 54TH BICKETT Street and E E13 E52 fire, other ST VERNON CA 90058 54TH ST 321 - EMS call, excluding vehicle accident with injury 3333 South DOWNEY Road VERNON CA 90023 3333 South DOWNEY Road 13 . . Item 7 Page 13 of 15 CITY OF VERNON STATISTICS JANUARY 2024 CITY DETAILS Alarm Date Time Basic Incident Number (FD1) Cad Initial Cad Incident Type Description Incident Type Address Basic Incident Full Street Address Basic First Arrived At Scene Apparatus ID Basic Property Losses (FD1.35) Basic Content Losses (FD1.36) 01/28/24 01/29/24 01/29/24 LAC24035004 LAC24035191 LAC24035200 VEHF 131 - Passenger vehicle fire SB 710 AT BANDINI Boulevard VERNON CA 90058 SB 710 AT BANDINI Boulevard E3 INVO TCB 132 - Road freight or 5400 South ALCOA Avenue transport vehicle fire and E SLAUSON AV VERNON CA 90058 5400 South ALCOA Avenue and E SLAUSON AV E13 E163600 - Good intent call, other DISTRICT Boulevard and S ATLANTIC BLVD VERNON CA 90040 DISTRICT Boulevard and S ATLANTIC BLVD 01/29/24 01/29/24 LAC24035203 LAC24035232 DB 611 - Dispatched and 3501 East VERNON Avenue 3501 East VERNON Avenuecancelled en route VERNON CA 90058 ALRWFR 735 - Alarm system sounded due to malfunction 2050 East 38TH Street VERNON CA 90058 2050 East 38TH Street E52 01/29/24 01/29/24 01/29/24 LAC24035289 LAC24035302 LAC24035470 ALRWF ALRWF SICKA 611 - Dispatched and 2640 East 26TH Street cancelled en route VERNON CA 90058 2640 East 26TH Street 2300 East 57TH Street611 - Dispatched and 2300 East 57TH Street cancelled en route VERNON CA 90058 321 - EMS call, excluding vehicle accident with injury 2801 East VERNON Avenue VERNON CA 90058 2801 East VERNON Avenue E52 S13 E52 E52 S13 01/29/24 01/29/24 01/29/24 01/29/24 01/29/24 01/30/24 01/30/24 LAC24035492 LAC24035667 LAC24035689 LAC24036125 LAC24036271 LAC24036620 LAC24036642 DB 321 - EMS call, excluding vehicle accident with injury 5455 South BOYLE Avenue VERNON CA 90058 5455 South BOYLE Avenue ALRWF ALRWF SICKA MISC1 ALRA ALRA 745 - Alarm system activation, no fire - unintentional 2300 East 57TH Street VERNON CA 90058 2300 East 57TH Street 2126 East 52ND Street744 - Detector activation, no fire - unintentional 2126 East 52ND Street VERNON CA 90058 321 - EMS call, excluding vehicle accident with injury 4955 MAYWOOD Avenue VERNON CA 90058 4955 MAYWOOD Avenue East SLAUSON Avenue and S ALCOA AV VERNON CA 90058 East SLAUSON Avenue E13 and S ALCOA AV 744 - Detector activation, no fire - unintentional 3355 East 26TH Street VERNON CA 90023 3355 East 26TH Street 3355 East 26TH Street E52 611 - Dispatched and 3355 East 26TH Street cancelled en route VERNON CA 90023 14 . . Item 7 Page 14 of 15 CITY OF VERNON STATISTICS JANUARY 2024 CITY DETAILS Alarm Date Time Basic Incident Number (FD1) Cad Initial Cad Incident Type Description Incident Type Address Basic Incident Full Street Address Basic First Arrived At Scene Apparatus ID Basic Property Losses (FD1.35) Basic Content Losses (FD1.36) 01/30/24 01/30/24 LAC24036685 LAC24036705 ALRWF ALRA 744 - Detector activation, no fire - unintentional 2345 East 52ND Street VERNON CA 90058 2345 East 52ND Street 2345 East 52ND Street E52 E52 E27 744 - Detector activation, no fire - unintentional 2345 East 52ND Street VERNON CA 90058 01/30/24 01/30/24 01/30/24 01/30/24 01/30/24 LAC24036741 LAC24036782 LAC24036793 LAC24036832 LAC24036853 ALRWF ALRWF ALRWF ALRA 4168 BANDINI Boulevard VERNON CA 90023 4168 BANDINI Boulevard 4168 BANDINI Boulevard VERNON CA 90023 4168 BANDINI Boulevard 4168 BANDINI Boulevard VERNON CA 90023 4168 BANDINI Boulevard 3280 East 44TH Street VERNON CA 90058 3280 East 44TH Street ALRAR 744 - Detector activation, no fire - unintentional 4621 South PACIFIC Boulevard VERNON CA 90058 4621 South PACIFIC Boulevard E52 S13 E52 E52 E27 E13 01/30/24 01/31/24 01/31/24 01/31/24 01/31/24 LAC24037046 LAC24037664 LAC24038557 LAC24038560 LAC24038572 Count: 137 TCT 600 - Good intent call, other South DOWNEY Road and E South DOWNEY Road WASHINGTON BLVD VERNON CA 90023 and E WASHINGTON BLVD SZR INJA TCA VEHL 321 - EMS call, excluding vehicle accident with injury 4646 HAMPTON Street VERNON CA 90058 4646 HAMPTON Street 321 - EMS call, excluding vehicle accident with injury South SANTA FE Avenue and E VERNON AV VERNON Avenue and E VERNON CA 90058 South SANTA FE AV 321 - EMS call, excluding vehicle accident with injury 3768 BANDINI Boulevard VERNON CA 90023 3768 BANDINI Boulevard 321 - EMS call, excluding vehicle accident with injury East 45TH Street and S PACIFIC BLVD VERNON CA PACIFIC BLVD 90058 East 45TH Street and S 15 . . Item 7 Page 15 of 15 City Council Agenda Report Meeting Date:March 19, 2024 From:Jessica Alcaraz, Financial Services Administrator Department:Finance Submitted by:John Lau, Accountant Subject Operating Account Warrant Register Recommendation Approve Operating Account Warrant Register No. 126, for the period of February 4 through February 17, 2024, totaling $8,774,682.53 and consisting of ratification of electronic payments totaling $8,123,746.31 and ratification of the issuance of early checks totaling $650,936.22. Background Vernon Municipal Code Section 2.32.060 indicates the City Treasurer, or an authorized designee, shall prepare warrants covering claims or demands against the City which are to be presented to City Council for its audit and approval. Pursuant to the aforementioned code section, the Deputy City Treasurer has prepared Operating Account Warrant Register No. 126 covering claims and demands presented during the period of February 4 through February 17, 2024, drawn, or to be drawn, from East West Bank for City Council approval. Fiscal Impact The fiscal impact of approving Operating Account Warrant Register No. 126, totals $8,774,682.53. The Finance Department has determined that sufficient funds to pay such claims/demands, are available in the respective accounts referenced on Operating Account Warrant Register No. 126. Attachments 1. Operating Account Warrant Register No. 126 . . Item 8 Page 1 of 1 STAFF REPORT FINANCE/TREASURY DEPARTMENT DATE: TO: March 11, 2024 Honorable Mayor and City Council FROM: RE: Joaquin Leon, Deputy City Treasurer Operating Account Warrant Register for City Council Agenda of March 19, 2024 It is recommended that the attached Operating Account Warrant Register No. 126 be approved at the City Council meeting of March 19, 2024. Operating Account Warrant Register No. 126 totals $8,774,682.53, and covers claims and demands presented for February 04, 2024 to February 17, 2024, drawn or to be drawn, from East West Bank. The following list details the components of Operating Account Warrant Register No. 126: 1. Ratification of electronic payments totaling $8,123,746.31. 2. Ratification of the issuance of early checks totaling $650,936.22. . . Item 8 Page 1 of 35 OPERATING ACCOUNT WARRANT REGISTER City of Vernon No.126 I hereby Certify: that claims or demands covered by the above listed warrants have been audited as to accuracy and availability of funds for payments thereof; and that said claims or demands are accurate and that funds are available for payments thereof. This is to certify that the claims or demands covered by the above listed warrants have been audited by the City Council of the City of Vernon and that all of said warrants are approved for pay- ments except Warrant Numbers: Joa Dep DATE DATE 3/11/2024Date: Page 1 of 1 Operating Account Warrant Register Cover - 126 : Warrant . . Item 8 Page 2 of 35 CITY OF VERNON OPERATING ACCOUNT WARRANT REGISTER NO. 126 DATE 03/19/2024 EARLY CHECKS TOTAL:650,936.22 327.31VENDOR - 1948 - AT&T Invoice PAYMENT # 612340 2/8/2024 Line Item Amount 327.31 Description Account PO or Contract 6149284802 ACCT 831-001-3015 328 PERIOD 12/17/23- 1/16/24 011-010-110-526010 20230186 Invoice Total:327.31 VENDOR - 4448 - BATTERY SYSTEMS, INC Invoice Description PAYMENT # 612341 PO or Contract 240021 2/8/2024 Line Item Amount 806.05 806.05 Account 2875013024160 VEHICLE BATTERIES 4 011-040-420-522000 Invoice Total:806.05 VENDOR - 6054 - BEAR COMMUNICATIONS INC PAYMENT # 612342 PO or Contract PD-0186 2/8/2024 Line Item Amount 867.63 867.63 Invoice 5681064 Description Account RADIO EQUIPMENT MAINTENANCE 02/24 011-030-300-529000 Invoice Total:867.63 VENDOR - 6609 - BPP PAC IND REIT PROP OWNER 1 Invoice Description 013024 PAYMENT # 612343 PO or Contract 2/8/2024 Line Item Amount 25,206.46 77,178.28 Account SPECIAL PARCEL TAX REFUND 6310-027- 011-400-000-400900 050 FY19-20 Invoice Total: Invoice Total: Invoice Total: 25,206.46 013024(2) 013024(3) SPECIAL PARCEL TAX REFUND 6310-027- 011-400-000-400900 050 FY20-21 25,704.24 25,704.24 SPECIAL PARCEL TAX REFUND 6310-027- 011-400-000-400900 050 FY21-22 26,267.58 26,267.58 VENDOR - 4163 - CENTRAL FORD AUTOMOTIVE, INC. Invoice Description PAYMENT # 612344 PO or Contract 2/8/2024 1,882.31 Account Line Item Amount Page 1 of 33 . . Item 8 Page 3 of 35 CITY OF VERNON OPERATING ACCOUNT WARRANT REGISTER NO. 126 DATE 03/19/2024 39573 39578 AUTO PARTS AUTO PARTS 011-040-420-522000 011-040-420-522000 240016 101.19 101.19Invoice Total: 240016 1,781.12 1,781.12Invoice Total: VENDOR - 1473 - CITY OF DOWNEY Invoice Description 237117 PAYMENT # 612345 PO or Contract HD-0037 2/8/2024 1,804.60 Account Line Item Amount ANIMAL CONTROL SERVICES, FY23/24 2QT 011-020-200-529225 1,804.60 Invoice Total:1,804.60 VENDOR - 4860 - CLEANSTREET, LLC PAYMENT # 612346 PO or Contract CS-1434 2/8/2024 27,162.29 72.54 Invoice Description STREET SWEEPING SERVICES 01/24 Account Line Item Amount 108023CS 011-040-430-529000 27,162.29 Invoice Total:27,162.29 VENDOR - 310 - CRAIG WELDING SUPPLY, CO Invoice Description 650607 CYLINDER RENTAL PAYMENT # 612347 PO or Contract 240040 2/8/2024 Account Line Item Amount 055-050-586-529003-72.54 Invoice Total:72.54 VENDOR - 6011 - DANN FROEHLICH Invoice Description VER994 PAYMENT # 612348 PO or Contract 240328 2/8/2024 673.44 Account Line Item Amount VERNON RECRUITMENT BROCHURE 011-010-120-529215 242.44 242.44 431.00 Invoice Total: 240328VER995DIRECTOR OF FINANCE BROCHURE / RECRUITMENT 011-010-120-529215 Invoice Total:431.00 VENDOR - 6625 - DFM ASSOCIATES Invoice Description 49173 PAYMENT # 612349 PO or Contract 240314 2/8/2024 225.23 Account Line Item Amount 225.232024 CALIFORNIA ELECTION CODE BOOK 011-010-125-529300 Page 2 of 33 . . Item 8 Page 4 of 35 CITY OF VERNON OPERATING ACCOUNT WARRANT REGISTER NO. 126 DATE 03/19/2024 Invoice Total:225.23 VENDOR - 7750 - ERIC OSUNA Invoice PAYMENT # 612350 PO or Contract 2/8/2024 62.00 1,765.60 2,265.25 7,282.00 3,510.36 1,660.05 Description Account Line Item Amount 020124 LIVE SCAN REIMBURSEMENT 011-010-120-529215 62.00 Invoice Total:62.00 VENDOR - 1926 - F. GAVINA & SONS, INC Invoice Description 4384879 COFFEE SUPPLIES PAYMENT # 612351 PO or Contract 240320 2/8/2024 Account Line Item Amount 011-040-435-522000 1,765.60 Invoice Total:1,765.60 VENDOR - 7503 - GRAFFITI PROTECTIVE COATINGS, INC Invoice Description 99550923 GRAFFITI REMOVAL PAYMENT # 612352 PO or Contract 20230030 2/8/2024 Account Line Item Amount 011-040-430-529000 2,265.25 Invoice Total:2,265.25 VENDOR - 7503 - GRAFFITI PROTECTIVE COATINGS, INC PAYMENT # 612353 PO or Contract 20230030 2/8/2024 Invoice 99551023 Description Account Line Item Amount GRAFFITI REMOVAL 10/23 011-040-430-529000 7,282.00 Invoice Total:7,282.00 VENDOR - 1355 - HACH COMPANY Invoice Description 13851693 PAYMENT # 612354 PO or Contract 240079 2/8/2024 Account Line Item Amount ELECTRODE 055-050-586-520235-3,510.36 Invoice Total:3,510.36 VENDOR - 3065 - HDL COREN & CONE PAYMENT # 612355 PO or Contract FI-0040 2/8/2024 Invoice Description PROPERTY TAX MANAGEMENT 1Q 2024 Account Line Item Amount SIN035477 011-010-130-529215 1,660.05 Invoice Total:1,660.05 Page 3 of 33 . . Item 8 Page 5 of 35 CITY OF VERNON OPERATING ACCOUNT WARRANT REGISTER NO. 126 DATE 03/19/2024 VENDOR - 7004 - KEN R UMEMOTO Invoice Description 10360 WEB HOSTING 2024 PAYMENT # 612356 2/8/2024 Line Item Amount 960.00 62.00 50.00 50.00 Account PO or Contract 240299011-010-110-529110 960.00 Invoice Total:960.00 VENDOR - 7752 - KEVIN RODRIGUEZ Invoice Description 020224 LIVE SCAN REIMBURSEMENT PAYMENT # 612357 PO or Contract 2/8/2024 Account Line Item Amount 011-010-120-529215 62.00 Invoice Total:62.00 VENDOR - 1792 - LA COUNTY ASSESSOR OFFICE PAYMENT # 612358 PO or Contract IT-0153 2/8/2024 Invoice Description Account Line Item Amount 24ASRE097 PARCEL MANAGEMENT SYSTEM 11/23 011-010-110-529110 50.00 Invoice Total:50.00 VENDOR - 1792 - LA COUNTY ASSESSOR OFFICE PAYMENT # 612359 PO or Contract IT-0153 2/8/2024 Invoice Description Account Line Item Amount 24ASRE118 PARCEL MANAGEMENT SYSTEM 12/1/23- 12/31/23 011-010-110-529110 50.00 Invoice Total:50.00 VENDOR - 5333 - LA COUNTY SHERIFF'S DEPT.PAYMENT # 612360 PO or Contract 2/8/2024 500.49 2.82 Invoice 10832 Description Account Line Item Amount Payroll Run 1 - Warrant 240208 011-000-000-210260 500.49 Invoice Total:500.49 VENDOR - 3272 - LANGUAGE LINE SERVICES, INC PAYMENT # 612361 PO or Contract 20230162 2/8/2024 Invoice 11213834 Description Account Line Item Amount LANGUAGE LINE SERVICES 01/24 011-030-300-529220 2.82 Invoice Total:2.82 VENDOR - 610 - LEONARDO GOMEZ VAZQUEZ PAYMENT # 612362 2/8/2024 170.64 Page 4 of 33 . . Item 8 Page 6 of 35 CITY OF VERNON OPERATING ACCOUNT WARRANT REGISTER NO. 126 DATE 03/19/2024 Invoice Description VEHICLE REPAIR VEHICLE REPAIR Account PO or Contract Line Item Amount 69 69 011-040-420-522000 011-040-420-529000 240331 240331 60.64 110.00 Invoice Total:170.64 VENDOR - 6667 - MEGA RENOVATION, INC PAYMENT # 612363 PO or Contract 20230172 2/8/2024 3,151.00 4,395.06 Invoice 3121 Description Account Line Item Amount HOUSING RENOVATION REPAIRS 011-040-415-529000 3,151.00 Invoice Total:3,151.00 VENDOR - 6203 - MRC SMART TECHNOLOGY SOLUTIONS PAYMENT # 612364 PO or Contract IT-0141 2/8/2024 Invoice Description Account Line Item Amount IN3955155 MANAGED PRINT SERVICES 11/30/23- 12/29/23 011-010-110-529110 1,335.09 Invoice Total:1,335.09 IN3955282 MANAGED PRINT SERVICES 12/30/23- 1/29/24 011-010-110-529110 IT-0141 3,059.97 Invoice Total:3,059.97 VENDOR - 309 - NAPA AUTO PARTS Invoice Description 216885 PAYMENT # 612365 PO or Contract 240014 2/8/2024 5,379.60 Account Line Item Amount PRESSURE WASHER AUTO PARTS 011-040-420-522000 4,924.22 4,924.22 422.79 422.79 32.59 Invoice Total: 240014217586011-040-420-522000 011-040-420-522000 Invoice Total: 2400142248217784AUTO PARTS Invoice Total:32.59 VENDOR - 7618 - NORTHERN CALIFORNIA POWER Invoice Description 259520124040 PROFESSIONAL SERVICES (ASCEND) PAYMENT # 612366 PO or Contract 20230232 2/8/2024 339,535.00 Account Line Item Amount 055-050-590-529215 339,535.00 Invoice Total:339,535.00 Page 5 of 33 . . Item 8 Page 7 of 35 CITY OF VERNON OPERATING ACCOUNT WARRANT REGISTER NO. 126 DATE 03/19/2024 VENDOR - 7618 - NORTHERN CALIFORNIA POWER Invoice Description PAYMENT # 612367 2/8/2024 Line Item Amount 11,667.50 10,195.00 Account PO or Contract 20230230259520124039 PROFESSIONAL SERVICES (NEWGEN)055-050-580-529215 11,667.50 Invoice Total:11,667.50 VENDOR - 2617 - OPERATION TECHNOLOGY, INC PAYMENT # 612368 PO or Contract 240310 2/8/2024 Invoice 82284IN Description Account Line Item Amount ETAP SOFTWARE MAINTENANCE AGREEMENT 055-050-585-529110 10,195.00 Invoice Total:10,195.00 VENDOR - 1943 - PLUMBING & INDUSTRIAL SUPPLY Invoice Description PAYMENT # 612369 PO or Contract 240056 2/8/2024 217.76 Account Line Item Amount S1291361001 PARTS & SUPPLIES S1291373001 PARTS & SUPPLIES S1291393001 PARTS & SUPPLIES 011-040-415-522000 165.32 165.32 7.56 Invoice Total: 240056011-040-415-522000 011-040-415-522000 Invoice Total: 240056 7.56 44.88 44.88Invoice Total: VENDOR - 1457 - QUINN COMPANY PAYMENT # 612370 PO or Contract 240318 2/8/2024 19,729.88 Invoice Description Account Line Item Amount WO810255988 FORKLIFT PARTS & REPAIR WO810255988 FORKLIFT PARTS & REPAIR 011-040-420-522000 011-040-420-529000 4,458.08 15,271.80 19,729.88 240318 Invoice Total: VENDOR - 3908 - RAFAEL A. LOPEZ PAYMENT # 612371 PO or Contract 240013 2/8/2024 483.54 Invoice 9898 Description Account Line Item Amount NEW TIRES NEW TIRE 011-040-420-522000 246.37 246.37 237.17 Invoice Total: 2400139998011-040-420-522000 Page 6 of 33 . . Item 8 Page 8 of 35 CITY OF VERNON OPERATING ACCOUNT WARRANT REGISTER NO. 126 DATE 03/19/2024 Invoice Total:237.17 VENDOR - 805 - RIO HONDO COLLEGE PAYMENT # 612372 PO or Contract 2/8/2024 75.00 Invoice Description Account Line Item Amount F23207ZVRN RECRUITMENT REGISTRATION FEES 011-010-120-529905 75.00 Invoice Total:75.00 VENDOR - 380 - STACY MEDICAL CENTER PAYMENT # 612373 PO or Contract 20230054 2/8/2024 3,001.50 Invoice Description Account Line Item Amount 521153536 PRE-BOOKING PHYSICAL EXAMINATIONS 011-030-300-529215 3,001.50 Invoice Total:3,001.50 VENDOR - 6997 - TRINITY CONSULTANTS, INC PAYMENT # 612374 PO or Contract 20230076 2/8/2024 5,662.51 4,002.93 Invoice 1428775 Description Account Line Item Amount ODOR STUDY PROJECT 230510.0001 011-020-200-529225 5,662.51 Invoice Total:5,662.51 VENDOR - 4783 - ULINE Invoice PAYMENT # 612375 PO or Contract 240210 2/8/2024 Description Account Line Item Amount 169684156 SUPPLIES 011-040-430-522000 4,002.93 Invoice Total:4,002.93 VENDOR - 5480 - VISTA PAINT CORPORATION PAYMENT # 612376 PO or Contract 240311 2/8/2024 1,243.71 Invoice Description Account Line Item Amount 202432867000 PAINT 011-040-430-522000 1,243.71 Invoice Total:1,243.71 VENDOR - 454 - WESLEY CRUZ Invoice PAYMENT # 612377 PO or Contract 2/8/2024 62.23 Description Account Line Item Amount 110223 EXPENSE REIMBURSEMENT 011-040-405-529670 62.23 Invoice Total:62.23 Page 7 of 33 . . Item 8 Page 9 of 35 CITY OF VERNON OPERATING ACCOUNT WARRANT REGISTER NO. 126 DATE 03/19/2024 VENDOR - 7669 - WILLDAN FINANCIAL SERVICES PAYMENT # 612378 2/8/2024 Line Item Amount 9,847.00 1,449.00 152.00 Invoice 1057269 Description Account PO or Contract 20240099COST ALLOCATION PLAN SERVICES 011-010-130-529215 9,847.00 Invoice Total:9,847.00 VENDOR - 6372 - XPRESS WASH, INC Invoice Description 17938 CAR WASH SERVICES PAYMENT # 612379 PO or Contract 20240053 2/8/2024 Account Line Item Amount 011-040-420-527000 1,449.00 Invoice Total:1,449.00 VENDOR - 1948 - AT&T Invoice PAYMENT # 612380 PO or Contract 2/15/2024 Description Account Line Item Amount 3424716807 ACCT 831-000-0922 427 PERIOD 12/19/23- 1/18/24 055-050-590-526010 152.00 Invoice Total:152.00 VENDOR - 4448 - BATTERY SYSTEMS, INC Invoice Description PAYMENT # 612381 PO or Contract 240021 2/15/2024 124.20 Account Line Item Amount 3896240214084 VEHICLE BATTERIES 7 011-040-420-522000 124.20 Invoice Total:124.20 VENDOR - 6054 - BEAR COMMUNICATIONS INC PAYMENT # 612382 PO or Contract PD-0186 2/15/2024 345.00 Invoice 5669270 Description Account Line Item Amount RADIO EQUIPMENT MAINTENANCE 011-030-300-529000 345.00 Invoice Total:345.00 VENDOR - 256 - CALPORTLAND COMPANY Invoice Description 96200122 PAYMENT # 612383 PO or Contract 20240059 2/15/2024 1,339.00 Account Line Item Amount CONCRETE 058-070-700-529000 1,339.00 Invoice Total:1,339.00 Page 8 of 33 . . Item 8 Page 10 of 35 CITY OF VERNON OPERATING ACCOUNT WARRANT REGISTER NO. 126 DATE 03/19/2024 VENDOR - 4163 - CENTRAL FORD AUTOMOTIVE, INC. Invoice Description 39760 PAYMENT # 612384 2/15/2024 Line Item Amount 675.43 10,665.83 319.08 Account PO or Contract 240016AUTO PARTS 011-040-420-522000 675.43 Invoice Total:675.43 VENDOR - 3846 - CITY OF HUNTINGTON PARK PAYMENT # 612385 PO or Contract PD-0181 2/15/2024 Invoice 20669 Description Account Line Item Amount INMATE BOOKINGS 11/23-12/23 011-030-300-529220 10,665.83 Invoice Total:10,665.83 VENDOR - 310 - CRAIG WELDING SUPPLY, CO Invoice Description 650807 WELDING SUPPLIES PAYMENT # 612386 PO or Contract 240091 2/15/2024 Account Line Item Amount 011-040-435-522000 234.19 234.19 84.89 Invoice Total: 240091650808WELDING SUPPLIES 011-040-435-522000 Invoice Total:84.89 VENDOR - 1336 - CURRENT WHOLESALE ELECTRIC Invoice Description 282508 PARTS & SUPPLIES PAYMENT # 612387 PO or Contract 240141 2/15/2024 215.05 Account Line Item Amount 011-040-415-522000 215.05 Invoice Total:215.05 VENDOR - 6696 - ELLIOTT AUTO SUPPLY CO, INC PAYMENT # 612388 PO or Contract 240012 2/15/2024 1,092.90 Invoice Description Account Line Item Amount 125768657 AUTO PARTS 011-040-420-522000 1,092.90 Invoice Total:1,092.90 VENDOR - 1926 - F. GAVINA & SONS, INC Invoice Description 4397850 COFFEE SUPPLIES 4397850 COFFEE SUPPLIES PAYMENT # 612389 PO or Contract 240333 2/15/2024 2,430.49 Account Line Item Amount 011-040-435-522000 011-040-435-522000 1,498.50 51.99240333 Page 9 of 33 . . Item 8 Page 11 of 35 CITY OF VERNON OPERATING ACCOUNT WARRANT REGISTER NO. 126 DATE 03/19/2024 Invoice Total:1,550.49 880.00 880.00 4398828 COFFEE SUPPLIES 011-040-435-522000 240333 Invoice Total: VENDOR - 280 - HARPER & ASSOC ENGINEERING, INC PAYMENT # 612390 PO or Contract LP-0615 2/15/2024 13,459.00 1,346.27 Invoice ENG8159 Description Account Line Item Amount STRUCTURAL INSPECTION SERVICES 05/23 058-070-700-660000 13,459.00 Invoice Total:13,459.00 VENDOR - 6308 - HI TECH ENTERPRISE Invoice Description 39421 39421 PAYMENT # 612391 PO or Contract 240304 2/15/2024 Account Line Item Amount AUTO REPAIRS 011-040-420-522000 011-040-420-529000 446.27 900.00AUTO REPAIRS 240304 Invoice Total:1,346.27 VENDOR - 7753 - JUAN BENAVIDES Invoice Description 020724 LIVESCAN REIMBURSEMENT PAYMENT # 612392 PO or Contract 2/15/2024 79.00 79.00 Account Line Item Amount 011-010-120-529215 79.00 Invoice Total:79.00 VENDOR - 7753 - JUAN BENAVIDES PAYMENT # 612393 PO or Contract 2/15/2024 Invoice Description LIVESCAN REIMBURSEMENT Account Line Item Amount 020724(2)011-010-120-529215 79.00 Invoice Total:79.00 VENDOR - 1832 - KENNEDY NAMEPLATE COMPANY, INC PAYMENT # 612394 PO or Contract 2/15/2024 290.39 Invoice 78601 Description Account Line Item Amount 2019 VINYL DECALS FOR VEHICLE INSPECTION PROGRAM 011-020-200-522000 290.39 Invoice Total:290.39 Page 10 of 33 . . Item 8 Page 12 of 35 CITY OF VERNON OPERATING ACCOUNT WARRANT REGISTER NO. 126 DATE 03/19/2024 VENDOR - 7742 - KOA CONSULTING, INC PAYMENT # 612395 2/15/2024 Line Item Amount 6,810.00 Invoice Description Account PO or Contract K1230101 SEWC PRGM MGMT SVCS 11/16/23- 12/31/23 095-095-905-705000-20240262 6,810.00 Invoice Total:6,810.00 VENDOR - 171 - L&M FOOTWEAR Invoice Description 58413IN PAYMENT # 612396 PO or Contract 240237 2/15/2024 137.01 Account Line Item Amount WORK BOOTS 055-050-585-524000 137.01 Invoice Total:137.01 VENDOR - 309 - NAPA AUTO PARTS Invoice Description 218606 PAYMENT # 612397 PO or Contract 240014 2/15/2024 3,220.72 Account Line Item Amount AUTO PARTS AUTO PARTS AUTO PARTS 011-040-420-522000 180.35 180.35Invoice Total: 240014218962011-040-420-522000 011-040-420-522000 173.88 Invoice Total: 240014 173.88 6265284607 2,866.49 2,866.49Invoice Total: VENDOR - 5934 - O'REILLY AUTO ENTERPRISES, LLC PAYMENT # 612398 PO or Contract 240015 2/15/2024 174.03 Invoice Description Account Line Item Amount 3049106555 AUTO PARTS AUTO PARTS AUTO PARTS 011-040-420-522000 189.40 189.40 56.78 Invoice Total: 2400153049471620 3049472657 011-040-420-522000 011-040-420-522000 Invoice Total: 240015 56.78 (72.15) (72.15)Invoice Total: VENDOR - 7656 - QUALITY PHYSICALS LLC PAYMENT # 612399 PO or Contract 20240068 2/15/2024 130.00 Invoice 33285 Description Account Line Item Amount 130.00DRUG & ALCOHOL COMPLIANCE 011-010-120-529700 Page 11 of 33 . . Item 8 Page 13 of 35 CITY OF VERNON OPERATING ACCOUNT WARRANT REGISTER NO. 126 DATE 03/19/2024 Invoice Total:130.00 VENDOR - 3908 - RAFAEL A. LOPEZ Invoice Description 9984 AUTO PARTS & ACCESSORIES PAYMENT # 612400 PO or Contract 240013 2/15/2024 140.00 Account Line Item Amount 011-040-420-529000 140.00 Invoice Total:140.00 VENDOR - 6305 - STARBOARD TACK SUPPLY INC PAYMENT # 612401 PO or Contract 240057 2/15/2024 2,012.53 Invoice Description Account Line Item Amount S1404794001 SUPPLIES 011-040-415-522000 1,186.76 1,186.76 825.77 Invoice Total: 240057S1406408001 SUPPLIES 011-040-415-522000 Invoice Total:825.77 VENDOR - 1973 - STEVEN J. BURRIS Invoice Description 76305 76305 PAYMENT # 612402 PO or Contract 240008 2/15/2024 759.93 Account Line Item Amount FRONT AXLE & ALIGNMENT REPAIR 011-040-420-522000 011-040-420-529000 397.43 362.50 759.93 FRONT AXLE & ALIGNMENT REPAIR 240008 Invoice Total: VENDOR - 7743 - STONEX FINANCIAL INC.PAYMENT # 612403 PO or Contract 20240255 2/15/2024 5,000.00 Invoice 1310111 Description Account Line Item Amount ENERGY RISK MANAGEMENT SVCS 01/01/24 - 01/31/24 055-050-580-529215 5,000.00 Invoice Total:5,000.00 VENDOR - 7643 - THE PUN GROUP, LLP Invoice Description 114309 PROFESSIONAL AUDITING SERVICES PAYMENT # 612404 PO or Contract 20230273 2/15/2024 10,000.00 Account Line Item Amount 011-010-130-529225 10,000.00 Invoice Total:10,000.00 VENDOR - 7275 - TOTAL-WESTERN, INC PAYMENT # 612405 2/15/2024 6,991.32 Page 12 of 33 . . Item 8 Page 14 of 35 CITY OF VERNON OPERATING ACCOUNT WARRANT REGISTER NO. 126 DATE 03/19/2024 Invoice 352068 Description Account PO or Contract Line Item Amount 6,991.32REPAIRS & MAINTENANCE 055-050-586-529007-20240047 Invoice Total:6,991.32 VENDOR - 282 - TRI-CITY MUTUAL WATER COMPANY Invoice Description 020124 HYDRANT ACCT 350.09 PAYMENT # 612406 PO or Contract 2/15/2024 225.00 Account Line Item Amount 011-030-305-526000 225.00 Invoice Total:225.00 VENDOR - 6997 - TRINITY CONSULTANTS, INC PAYMENT # 612407 PO or Contract 20230057 2/15/2024 16,261.26 Invoice 1393984 Description Account Line Item Amount CONSULTING SERVICES PROJECT NO. 220509.0029 011-020-200-529225 563.75 Invoice Total:563.75 1428770 CONSULTING SERVICES PROJECT NO. 230509.0199 011-020-200-529225 20230057 15,697.51 Invoice Total:15,697.51 VENDOR - 883 - UNITED RENTALS (NORTH AMERICA), INC Invoice Description PAYMENT # 612408 PO or Contract 20240188 2/15/2024 4,703.29 1,787.60 1,995.00 Account Line Item Amount 227748158002 FORKLIFT RENTAL 055-050-586-529005-4,703.29 Invoice Total:4,703.29 VENDOR - 883 - UNITED RENTALS (NORTH AMERICA), INC PAYMENT # 612409 PO or Contract 20240017 2/15/2024 Invoice Description Account Line Item Amount 228750788001 EQUIPMENT TOOL RENTALS 011-040-415-522000 1,787.60 Invoice Total:1,787.60 VENDOR - 7669 - WILLDAN FINANCIAL SERVICES PAYMENT # 612410 PO or Contract 20240099 2/15/2024 Invoice 1056842 Description Account Line Item Amount COST ALLOCATION PLAN SERVICES 011-010-130-529215 1,995.00 Invoice Total:1,995.00 Page 13 of 33 . . Item 8 Page 15 of 35 CITY OF VERNON OPERATING ACCOUNT WARRANT REGISTER NO. 126 DATE 03/19/2024 PAYROLL CHECKS Invoice 2/8/2024 Line Item Amount 8,536.78 Description Account PO or Contract 012524 012524 PAYROLL CHECKS PAYROLL CHECKS 011-000-000-210110 056-000-000-210110 2,882.31 5,654.47 8,536.78Invoice Total: Page 14 of 33 . . Item 8 Page 16 of 35 CITY OF VERNON OPERATING ACCOUNT WARRANT REGISTER NO. 126 DATE 03/19/2024 ELECTRONIC TOTAL:8,123,746.31 8.00VENDOR - 6695 - ALFONSO MADRIGAL Invoice Description 122623 PAYMENT # 16688 2/9/2024 Line Item Amount 8.00 Account PO or Contract TRAINING: ARREST AND CONTROL / USE OF FORCE 011-030-300-529500 Invoice Total:8.00 VENDOR - 7393 - APPLY THE PRESSURE GROUP PAYMENT # 16689 PO or Contract 20240066 2/9/2024 Line Item Amount 483.75 483.75 7,254.08 8.00 Invoice Description Account 78 GRAFFITI ABATEMENT SERVICES 011-040-430-529215 Invoice Total:483.75 VENDOR - 4303 - ATHENS INSURANCE SERVICES, INC Invoice Description IVC34233 PAYMENT # 16690 PO or Contract 2/9/2024 Line Item Amount 7,254.08 Account TPA 01/24 011-010-120-529220 Invoice Total:7,254.08 VENDOR - 7244 - BRITTANY GONZALEZ Invoice Description 122623 PAYMENT # 16691 PO or Contract 2/9/2024 Line Item Amount 8.00 Account TRAINING: ARREST AND CONTROL / USE OF FORCE 011-030-300-529500 Invoice Total:8.00 VENDOR - 3782 - CARLOS OURIQUE Invoice Description 010324 PAYMENT # 16692 PO or Contract 2/9/2024 Line Item Amount 8.00 8.00 Account TRAINING: CRITICAL INCIDENT RESPONSE 011-030-300-529500 Invoice Total:8.00 VENDOR - 447 - CDW GOVERNMENT, INC Invoice Description LS98845 PD DISPATCH PRINTER PAYMENT # 16693 PO or Contract 240149 2/9/2024 Line Item Amount 2,219.40 6,519.82 Account 011-010-110-522010 Page 15 of 33 . . Item 8 Page 17 of 35 CITY OF VERNON OPERATING ACCOUNT WARRANT REGISTER NO. 126 DATE 03/19/2024 Invoice Total:2,219.40 4.00LT21705 LT21705 PD DISPATCH LAPTOP/COMPUTER PD DISPATCH LAPTOP/COMPUTER 011-010-110-522010 011-010-110-522010 240149 240149 2,268.48 2,272.48 274.35 274.35 Invoice Total: 240252NJ10312 NS22142 NS22144 MISCELLANEOUS IT EQUIPMENT MISC IT EQUIPMENT 011-010-110-522010 011-010-110-522010 011-010-110-522010 Invoice Total: 240273 1,273.60 1,273.60 479.99 479.99 Invoice Total: 240273MISC IT EQUIPMENT Invoice Total: VENDOR - 1444 - COUNTY OF LOS ANGELES PAYMENT # 16694 PO or Contract 2/9/2024 1,390,914.45 Invoice Description Account Line Item Amount C0011816 FIRE PROTECTION SERVICES 03/24 011-030-305-529215 1,390,914.45 Invoice Total:1,390,914.45 VENDOR - 6661 - CYNTHIA MACIEL Invoice Description 010424 PAYMENT # 16695 PO or Contract 2/9/2024 16.00 Account Line Item Amount TRAINING: CRITICAL INCIDENT RESPONSE 011-030-300-529500 8.00 Invoice Total: Invoice Total: 8.00 122623 TRAINING: ARREST AND CONTROL / USE OF FORCE 011-030-300-529500 8.00 8.00 VENDOR - 1206 - DELL MARKETING LP PAYMENT # 16696 PO or Contract 240275 2/9/2024 18,634.53 Invoice Description SPARE DESKTOPS FOR IT Account Line Item Amount 10722833471 011-010-110-522010 18,634.53 Invoice Total:18,634.53 VENDOR - 7353 - EXTENDED OFFICE SOLUTIONS, INC Invoice Description PAYMENT # 16697 PO or Contract 2/9/2024 456.15 Account Line Item Amount Page 16 of 33 . . Item 8 Page 18 of 35 CITY OF VERNON OPERATING ACCOUNT WARRANT REGISTER NO. 126 DATE 03/19/2024 19207 ADDITIONAL PRI LINE 2/1-2/29/24 011-010-110-529110 IT-0172 456.15 Invoice Total:456.15 VENDOR - 1701 - FUJITSU NETWORK COMMUNICATIONS PAYMENT # 16698 PO or Contract 20230184 2/9/2024 64,312.00 750.50 Invoice 92033581 Description Account Line Item Amount FIBER OPTICS NETWORK UPGRADE 059-080-800-660000 64,312.00 Invoice Total:64,312.00 VENDOR - 7107 - GEOTAB USA, INC Invoice Description IN371417 GEOTAB GPS SERVICES PAYMENT # 16699 PO or Contract 20240030 2/9/2024 Account Line Item Amount 011-040-420-529000 750.50 Invoice Total:750.50 VENDOR - 1712 - GRAINGER, CO PAYMENT # 16700 PO or Contract 240035 2/9/2024 490.44 Invoice Description PARTS & SUPPLIES Account Line Item Amount 9933360365 055-050-586-520231-490.44 Invoice Total:490.44 VENDOR - 6061 - GREGORY GARCIA Invoice Description 121223 TRAINING: BASIC PEER SUPPORT PAYMENT # 16701 PO or Contract 2/9/2024 16.00 Account Line Item Amount 011-030-300-529500 16.00 Invoice Total:16.00 VENDOR - 5350 - HAUL-AWAY RUBBISH SERVICE CO., INC PAYMENT # 16702 PO or Contract CS-1371 2/9/2024 2,455.80 Invoice Description WASTE DISPOSAL Account Line Item Amount 3CX00110 011-040-415-529215 795.68 795.68 795.00 795.00 638.12 638.12 227.00 Invoice Total: CS-13713CX001111 41X00108 41X00115 WASTE DISPOSAL WASTE DISPOSAL WASTE DISPOSAL 011-040-415-529215 011-040-415-529215 011-040-415-529215 Invoice Total: CS-1371 Invoice Total: CS-1371 Page 17 of 33 . . Item 8 Page 19 of 35 CITY OF VERNON OPERATING ACCOUNT WARRANT REGISTER NO. 126 DATE 03/19/2024 Invoice Total:227.00 VENDOR - 7301 - INTERGRAPH CORPORATION PAYMENT # 16703 PO or Contract 20230225 2/9/2024 31,920.00 205.00 Invoice Description Account Line Item Amount CLAI001060 MGS WORK ORDER SOFTWARE 055-050-586-660005-31,920.00 Invoice Total:31,920.00 VENDOR - 7645 - KEVIN CABALLERO Invoice Description 010824 TRINING: ALLAN HANCOCK COLLEGE PAYMENT # 16704 PO or Contract 2/9/2024 Account Line Item Amount 011-030-300-529500 205.00 Invoice Total:205.00 VENDOR - 2169 - KONECRANES, INC PAYMENT # 16705 PO or Contract 20240116 2/9/2024 810.00 Invoice Description INSPECTION SERVICES 11/23 Account Line Item Amount 154923202 055-050-570-529000 810.00 Invoice Total:810.00 VENDOR - 6520 - MATHESON TRI-GAS, INC Invoice Description 29050541 SPECIALTY GASES PAYMENT # 16706 PO or Contract LP-0790 2/9/2024 1,501.67 Account Line Item Amount 055-050-586-529000-504.09 504.09 997.58 997.58 Invoice Total: LP-07909048353SPECIALTY GASES 055-050-586-529000- Invoice Total: VENDOR - 1150 - MCMASTER-CARR SUPPLY COMPANY Invoice Description 13443891 PARTS & SUPPLIES PAYMENT # 16707 PO or Contract 240126 2/9/2024 6,360.93 Account Line Item Amount 055-050-586-529000-239.48 239.48 537.72 537.72 216.80 216.80 Invoice Total: 24012616805185 17110181 SUPPLIES 055-050-586-529000- 055-050-555-522000 Invoice Total: 240107PARTS & SUPPLIES Invoice Total: Page 18 of 33 . . Item 8 Page 20 of 35 CITY OF VERNON OPERATING ACCOUNT WARRANT REGISTER NO. 126 DATE 03/19/2024 17184540 17333204 17573818 18195865 18480249 18919449 18934499 PARTS & SUPPLIES PARTS & SUPPLIES PARTS & SUPPLIES PARTS & SUPPLIES PARTS & SUPPLIES PARTS & SUPPLIES PARTS & SUPPLIES 055-050-555-522000 055-050-586-520231- 055-050-586-520231- 055-050-555-522000 055-050-586-529002- 055-050-586-529011- 055-050-586-529009- 240107 589.87 589.87 817.90 817.90 633.33 633.33 2,309.17 2,309.17 766.85 766.85 55.37 Invoice Total: 240126 Invoice Total: 240126 Invoice Total: 240107 Invoice Total: 240126 Invoice Total: 240126 Invoice Total: 240126 55.37 194.44 194.44Invoice Total: VENDOR - 7299 - MELISSA HERNANDEZ Invoice Description 122623 PAYMENT # 16708 PO or Contract 2/9/2024 8.00 25,778.75 8.00 Account Line Item Amount TRAINING: ARREST AND CONTROL / USE OF FORCE 011-030-300-529500 8.00 Invoice Total:8.00 VENDOR - 16 - MOTOROLA SOLUTIONS, INC PAYMENT # 16709 PO or Contract IT-0182 2/9/2024 Invoice Description Account Line Item Amount 8230412736 MOTOROLA SERVICE AGREEMENT FY23/24 011-010-110-529110 25,778.75 Invoice Total:25,778.75 VENDOR - 6950 - NICHOLAS MANNINO Invoice Description 122623 PAYMENT # 16710 PO or Contract 2/9/2024 Account Line Item Amount TRAINING: ARREST AND CONTROL / USE OF FORCE 011-030-300-529500 8.00 Invoice Total:8.00 Page 19 of 33 . . Item 8 Page 21 of 35 CITY OF VERNON OPERATING ACCOUNT WARRANT REGISTER NO. 126 DATE 03/19/2024 VENDOR - 7695 - RAFAEL SEPULVEDA Invoice Description 010824 TRAINING: ALLAN HANCOCK COLLEGE PAYMENT # 16711 2/9/2024 Line Item Amount 205.00 208.00 8.00 Account PO or Contract 011-030-300-529500 205.00 Invoice Total:205.00 VENDOR - 6884 - RELX, INC Invoice PAYMENT # 16712 PO or Contract LD-0045 2/9/2024 Description Account Line Item Amount 3094931441 SUBSCRIPTION DUES 01/24 011-010-115-529600 208.00 Invoice Total:208.00 VENDOR - 7512 - RUDY HERNANDEZ Invoice Description 122623 PAYMENT # 16713 PO or Contract 2/9/2024 Account Line Item Amount TRINING: ARREST AND CONTROL / USE OF 011-030-300-529500 FOCE 8.00 Invoice Total:8.00 VENDOR - 6780 - THE HITT COMPANIES, INC PAYMENT # 16714 PO or Contract 240017 2/9/2024 35.54 Invoice Description Account Line Item Amount OE120594 NAME PLATES (Y. GASTELUM / K. PEREZ) 011-010-130-522000 35.54 Invoice Total:35.54 VENDOR - 1447 - TYLER TECHNOLOGIES, INC PAYMENT # 16715 PO or Contract IT-0152 2/9/2024 2,800.00 Invoice 45447311 Description Account Line Item Amount TYLER TECHNOLOGIES ERP SYSTEM 011-010-110-660005 2,100.00 2,100.00 700.00 Invoice Total: IT-015245448117TYLER TECHNOLOGIES ERP SYSTEM 011-010-110-660005 Invoice Total:700.00 VENDOR - 7489 - WEA CA PC Invoice PAYMENT # 16716 PO or Contract 20240109 2/9/2024 41,729.41 Description Account Line Item Amount 34,535.46INV0089PUBLIC HEALTH SERVICES 02/24 011-020-200-529230- Page 20 of 33 . . Item 8 Page 22 of 35 CITY OF VERNON OPERATING ACCOUNT WARRANT REGISTER NO. 126 DATE 03/19/2024 Invoice Total:34,535.46 7,193.95 7,193.95 INV0099 HEALTH OFFICER SERVICES 01/24 011-020-200-529230-HD-0054 Invoice Total: VENDOR - 3584 - WILLIAMS SERVICE CORPORATION Invoice Description 637969 PAYMENT # 16717 PO or Contract 2/9/2024 1,542.21 4,114.20 Account Line Item Amount 011-010-125-529215 1,542.21 Invoice Total:1,542.21 VENDOR - 5323 - IBEW LOCAL 47 Invoice Description 10831 PAYMENT # 16718 PO or Contract 2/9/2024 Account Line Item Amount IBEW MEMBERSHIP ASSOCIATION DUES 011-000-000-210250 14.09 3,615.25 327.87 02.08.24 10831 10831 10831 IBEW MEMBERSHIP ASSOCIATION DUES 02.08.24 IBEW MEMBERSHIP ASSOCIATION DUES 02.08.24 IBEW MEMBERSHIP ASSOCIATION DUES 02.08.24 055-000-000-210250 056-000-000-210250 058-000-000-210250 156.99 Invoice Total:4,114.20 VENDOR - 3407 - VERNON POLICE OFFICERS BENEFIT PAYMENT # 16719 PO or Contract 2/9/2024 2,524.50 Invoice 10829 Description Account Line Item Amount VERNON POLICE ASSOCIATION DUES 02.08.24 011-000-000-210250 2,524.50 Invoice Total:2,524.50 VENDOR - 1401 - CENTRAL BASIN MWD PAYMENT # 16724 PO or Contract 2/13/2024 23,645.60 Invoice VER-DEC23 VER-DEC23 Description Account Line Item Amount POTABLE WATER CHARGES 12/23 POTABLE WATER CHARGES 12/23 058-070-700-520130 055-050-586-520135- 8,124.18 15,521.42 23,645.60Invoice Total: Page 21 of 33 . . Item 8 Page 23 of 35 CITY OF VERNON OPERATING ACCOUNT WARRANT REGISTER NO. 126 DATE 03/19/2024 VENDOR - 2886 - WALTERS WHOLESALE ELECTRIC, CO Invoice Description PAYMENT # 16725 2/13/2024 Line Item Amount 991.83 Account PO or Contract S12395743100 WCU MTW 12 CU STRANDED SPOOL 1|2|3|4 058-070-700-660000 240309 991.83 Invoice Total:991.83 VENDOR - 2412 - CALIFORNIA ISO PAYMENT # 16726 PO or Contract 2/9/2024 579,291.09 Invoice Description Account Line Item Amount 2024020631- 62941351 REVISED CHARGES 02/23 055-050-590-520150 (11,008.67) 2024020631- 62941351 2024020631- 62941351 2024020631- 62941351 2024020631- 62941351 2024020631- 62941351 2024020631- 62941351 2024020631- 62941351 2024020631- 62941351 2024020631- 62941351 2024020631- 62941351 2024020631- 62941351 2024020631- 62941351 REVISED CHARGES 02/23 REVISED CHARGES 02/23 REVISED CHARGES 02/23 REVISED CHARGES 10/23 REVISED CHARGES 10/23 REVISED CHARGES 10/23 REVISED CHARGES 04/22 REVISED CHARGES 04/22 REVISED CHARGES 04/22 INITIAL CHARGES 01/24 INITIAL CHARGES 01/24 INITIAL CHARGES 01/24 INITIAL CHARGES 01/24 055-050-590-520180 055-050-590-520190 055-050-590-520170 055-050-590-520170 055-050-590-520190 055-050-590-520150 055-050-590-520150 055-050-590-520190 055-050-590-520170 055-050-590-520170 055-050-590-520190 055-050-590-520210 055-050-590-520150 (499.30) (308.68) 1,385.09 (3,586.36) (382.66) 1,067.64 (1,018.67) (229.16) 1,672.33 (1,521.24) 5,537.33 11,080.35 577,103.09 579,291.09 2024020631- 62941351 Invoice Total: Page 22 of 33 . . Item 8 Page 24 of 35 CITY OF VERNON OPERATING ACCOUNT WARRANT REGISTER NO. 126 DATE 03/19/2024 VENDOR - 3049 - PETRELLI ELECTRIC, INC PAYMENT # 16727 2/15/2024 Line Item Amount 1,948,018.79 9,804.61 Invoice 021424 Description Account PO or Contract LP-0761-1ELECTRIC SYSTEM MAINTENANCE 01/24 055-000-000-200400 1,948,018.79 Invoice Total:1,948,018.79 VENDOR - 1490 - ALL CITY MANAGEMENT SERVICES, INC.PAYMENT # 16728 PO or Contract 20240119 2/16/2024 Invoice 89849 Description Account Line Item Amount CROSSING GUARD SERVICES 011-010-160-529215 2,875.33 2,875.33 1,443.60 1,443.60 2,598.48 2,598.48 2,887.20 2,887.20 Invoice Total: 2024011990298 90726 91101 CROSSING GUARD SERVICES CROSSING GUARD SERVICES CROSSING GUARD SERVICES 011-010-160-529215 011-010-160-529215 011-010-160-529215 Invoice Total: 20240119 Invoice Total: 20240119 Invoice Total: VENDOR - 7393 - APPLY THE PRESSURE GROUP PAYMENT # 16729 PO or Contract 20240066 2/16/2024 3,442.50 1,325.00 Invoice Description Account Line Item Amount 80 GRAFFITI ABATEMENT SERVICES 011-040-430-529215 3,442.50 Invoice Total:3,442.50 VENDOR - 2533 - BANK OF NEW YORK MELLON TRUST PAYMENT # 16730 PO or Contract 2/16/2024 Invoice Description Account Line Item Amount 2522609208 ADMINISTRATION FEE, ELECTRIC SYSTEM 055-050-580-529010 BOND 2012B 1,325.00 Invoice Total:1,325.00 VENDOR - 5506 - BEST BEST & KRIEGER, LLP Invoice Description 987909 LEGAL SERVICES PAYMENT # 16731 PO or Contract LD-0036-1 2/16/2024 97.50 Account Line Item Amount 011-010-115-529200 97.50 Invoice Total:97.50 Page 23 of 33 . . Item 8 Page 25 of 35 CITY OF VERNON OPERATING ACCOUNT WARRANT REGISTER NO. 126 DATE 03/19/2024 VENDOR - 5490 - CINTAS CORPORATION NO. 2 PAYMENT # 16732 2/16/2024 Line Item Amount 2,372.10 Invoice 4174227455 4174227455 Description UNIFORM RENTAL SERVICE UNIFORM RENTAL SERVICE Account PO or Contract CS-1397011-040-420-524000 011-040-430-524000 37.38 264.60 301.98 297.14 242.02 200.71 15.36 CS-1397 Invoice Total: LP-06634177817237 4177817237 4177817237 4177817237 4177817237 UNIFORM RENTAL SERVICE UNIFORM RENTAL SERVICE UNIFORM RENTAL SERVICE UNIFORM RENTAL SERVICE UNIFORM RENTAL SERVICE 055-050-586-524000- 056-060-600-524000 058-070-700-524000 055-050-550-524000 055-050-555-524000 LP-0663 LP-0663 LP-0663 LP-0663 198.19 953.42 297.14 96.50 Invoice Total: LP-06634178453301 4178453301 4178453301 4178453301 4178453301 UNIFORM RENTAL SERVICE UNIFORM RENTAL SERVICE UNIFORM RENTAL SERVICE UNIFORM RENTAL SERVICE UNIFORM RENTAL SERVICE 055-050-586-524000- 056-060-600-524000 058-070-700-524000 055-050-550-524000 055-050-555-524000 LP-0663 LP-0663 200.71 15.36LP-0663 LP-0663 198.19 807.90 27.13 Invoice Total: CS-13974181418542 4181418542 UNIFORM RENTAL SERVICE UNIFORM RENTAL SERVICE 011-040-420-524000 011-040-430-524000 CS-1397 281.67 308.80Invoice Total: VENDOR - 5658 - DAVID E DAN Invoice PAYMENT # 16733 PO or Contract LP-0463 2/16/2024 22,666.38 Description Account Line Item Amount VERN100 VERN98 VERN99 MARCH 2024 055-050-590-529215 7,639.19 7,639.19 7,388.00 7,388.00 7,639.19 7,639.19 Invoice Total: LP-0463JANUARY 2024 FEBRUARY 2024 055-050-590-529215 055-050-590-529215 Invoice Total: LP-0463 Invoice Total: VENDOR - 1936 - EMPIRE CHEMICAL CO., INC PAYMENT # 16734 2/16/2024 4,828.69 Page 24 of 33 . . Item 8 Page 26 of 35 CITY OF VERNON OPERATING ACCOUNT WARRANT REGISTER NO. 126 DATE 03/19/2024 Invoice Description Account PO or Contract Line Item Amount 4,828.69S6256540001 SUPPLIES 011-040-415-522000 240317 Invoice Total:4,828.69 VENDOR - 1701 - FUJITSU NETWORK COMMUNICATIONS PAYMENT # 16735 PO or Contract 20240223 2/16/2024 148,195.60 Invoice 92036589 Description Account Line Item Amount NETWORK MAINTENANCE AGREEMENT 059-080-800-529215 71,118.00 71,118.00 77,077.60 77,077.60 Invoice Total: 2024022392036590NETWORK MAINTENANCE RENEWAL 059-080-800-529215 Invoice Total: VENDOR - 1712 - GRAINGER, CO PAYMENT # 16736 PO or Contract 240114 2/16/2024 2,589.76 Invoice Description Account Line Item Amount 9917491392 PARTS & SUPPLIES PARTS & SUPPLIES PARTS & SUPPLIES PARTS & SUPPLIES 055-050-560-529000 753.22 753.22 580.80 580.80 633.74 633.74 622.00 622.00 Invoice Total: 2401149923097928 9923772025 9956505508 055-050-560-529000 055-050-560-529000 058-070-700-522000 Invoice Total: 240114 Invoice Total: 240042 Invoice Total: VENDOR - 5350 - HAUL-AWAY RUBBISH SERVICE CO., INC PAYMENT # 16737 PO or Contract CS-1371 2/16/2024 17,048.74 Invoice Description Account Line Item Amount 3AX00121 DISPOSAL & RECYCLING SERVICES 011-040-415-529215 4,139.70 4,139.70Invoice Total: CS-137141X00116DISPOSAL & RECYCLING SERVICES 011-040-415-529215 12,909.04 12,909.04Invoice Total: VENDOR - 4500 - ICE US OTC COMMODITY MARKETS, LLC PAYMENT # 16738 PO or Contract 2/16/2024 1,250.00 Invoice Description Account Line Item Amount 124001688006 JANUARY 2024 055-050-590-529215 52.50 Page 25 of 33 . . Item 8 Page 27 of 35 CITY OF VERNON OPERATING ACCOUNT WARRANT REGISTER NO. 126 DATE 03/19/2024 Invoice Total:52.50 1,197.50 1,197.50 124001688088 JANUARY 2024 055-050-590-529215 Invoice Total: VENDOR - 5093 - JCL TRAFFIC SERVICES PAYMENT # 16739 PO or Contract 240054 2/16/2024 104.63 Invoice 122870 Description Account Line Item Amount TRAFFIC CONTROL SUPPLIES 011-040-430-522000 104.63 Invoice Total:104.63 VENDOR - 6722 - MUNISERVICES, LLC PAYMENT # 16740 PO or Contract FI-0043 2/16/2024 5,767.55 Invoice Description Account Line Item Amount INV06017847 UUT AUDITING SERVICES, 2023 Q4 011-010-130-529225 3,825.00 3,825.00 1,942.55 1,942.55 Invoice Total: FI-0042INV06018220CLEARVIEW/ STARS SERVICE 2023 3Q 011-010-130-529215 Invoice Total: VENDOR - 6687 - NEXTDAY DELIVERY SERVICE, LLC PAYMENT # 16741 PO or Contract FI-0041 2/16/2024 298.68 Invoice 830560 Description Account Line Item Amount MAIL SORTING SERVICES 011-010-130-522000 298.68 Invoice Total:298.68 VENDOR - 5614 - NORTHWEST ELECTRICAL SERVICES,PAYMENT # 16742 PO or Contract 20240224 2/16/2024 72,105.00 Invoice 1848 Description PROFESSIONAL SERVICES PROFESSIONAL SERVICES PROFESSIONAL SERVICES PROFESSIONAL SERVICES PROFESSIONAL SERVICES Account Line Item Amount 058-070-700-660000 058-070-700-660000 058-070-700-529000 055-050-560-529000 055-050-585-660000 7,410.00 712.501848 1848 1848 1848 20240224 20240224 712.50 20240224 5,130.00 58,140.00 72,105.00 20240224 Invoice Total: VENDOR - 870 - PARNASA TOV INC Invoice Description PAYMENT # 16743 PO or Contract 2/16/2024 12.00 Account Line Item Amount Page 26 of 33 . . Item 8 Page 28 of 35 CITY OF VERNON OPERATING ACCOUNT WARRANT REGISTER NO. 126 DATE 03/19/2024 1302 CAR WASH SERVICES 011-030-300-527000 240063 12.00 Invoice Total:12.00 VENDOR - 3701 - RAFAEL LANDA Invoice Description 020824 TUITION REIMBURSMENT PAYMENT # 16744 PO or Contract 2/16/2024 459.00 Account Line Item Amount 011-010-120-529680 459.00 Invoice Total:459.00 VENDOR - 6198 - S&S LABOR FORCE, INC PAYMENT # 16745 PO or Contract 20230234 2/16/2024 139,312.00 Invoice 12206 Description Account Line Item Amount SECURITY SERVICES (CITY HALL) 01/24 011-040-415-529215 11,492.00 11,492.00 92,425.60 Invoice Total: 2023023412207 12207 SECURITY GUARD SERVICES (POWER PLANT) 01/24 SECURITY GUARD SERVICES (POWER PLANT) 01/24 055-050-555-529215 055-050-580-529215 20230234 23,106.40 Invoice Total:115,532.00 12208 SECURITY SERVICES (CITY HALL EXTRA PATROL) 01/24 011-040-415-529215 20230234 12,288.00 Invoice Total:12,288.00 VENDOR - 2517 - SCPPA Invoice PAYMENT # 16746 PO or Contract 2/16/2024 8,289.72 Description Account Line Item Amount 224 224 224 RESOLUTION BILLING 02/24 RESOLUTION BILLING 02/24 RESOLUTION BILLING 02/24 055-050-590-529200 055-050-580-529215 055-050-595-529702 683.84 5,450.00 2,155.88 8,289.72Invoice Total: VENDOR - 7361 - SIEMENS ENERGY, INC Invoice Description 90916947 HEXAGON HEAD BOLT PAYMENT # 16747 PO or Contract 20230274 2/16/2024 1,110.22 Account Line Item Amount 055-050-586-529005-1,110.22 Invoice Total:1,110.22 Page 27 of 33 . . Item 8 Page 29 of 35 CITY OF VERNON OPERATING ACCOUNT WARRANT REGISTER NO. 126 DATE 03/19/2024 VENDOR - 59 - SO CAL EDISON Invoice PAYMENT # 16748 2/16/2024 Line Item Amount 24,669.00 400.30 Description Account PO or Contract 7501653294 JANUARY 2024 055-050-590-520170 24,669.00 Invoice Total:24,669.00 VENDOR - 6975 - THE ARROYO GROUP Invoice Description 1010827 WESTSIDE PROJECT SPECIFIC PLAN PAYMENT # 16749 PO or Contract 2/16/2024 Account Line Item Amount 011-040-405-529225 400.30 Invoice Total:400.30 VENDOR - 1695 - VULCAN MATERIALS COMPANY Invoice Description 73873268 AGG & ASPHALT PAYMENT # 16750 PO or Contract 240048 2/16/2024 896.81 Account Line Item Amount 058-070-700-529000 233.24 233.24 663.57 663.57 Invoice Total: 24004873900445AGG & ASPHALT 058-070-700-529000 Invoice Total: VENDOR - 1658 - WATER REPLENISHMENT DISTRICT PAYMENT # 16751 PO or Contract 2/16/2024 155,346.75 2,020.89 Invoice 123123 Description Account Line Item Amount GROUNDWATER PRODUCTION & ASSESSMENT 12/23 058-070-700-520110 155,346.75 Invoice Total:155,346.75 VENDOR - 7110 - WATERLINE TECHNOLOGIES, INC PAYMENT # 16752 PO or Contract 20240032 2/16/2024 Invoice 5651827 Description Account Line Item Amount SODIUM HYPOCHLORITE 058-070-700-520140 337.37 337.37 337.37 337.37 337.37 337.37 336.26 Invoice Total: 202400325654117 5656415 5662050 SODIUM HYPOCHLORITE SODIUM HYPOCHLORITE SODIUM HYPOCHLORITE 058-070-700-520140 058-070-700-520140 058-070-700-520140 Invoice Total: 20240032 Invoice Total: 20240032 Page 28 of 33 . . Item 8 Page 30 of 35 CITY OF VERNON OPERATING ACCOUNT WARRANT REGISTER NO. 126 DATE 03/19/2024 Invoice Total:336.26 336.26 336.26 336.26 336.26 5665179 5665180 SODIUM HYPOCHLORITE SODIUM HYPOCHLORITE 058-070-700-520140 058-070-700-520140 20240032 Invoice Total: 20240032 Invoice Total: VENDOR - 3584 - WILLIAMS SERVICE CORPORATION PAYMENT # 16753 PO or Contract 2/16/2024 437.50 Invoice 637532 Description Account Line Item Amount STORAGE SERVICES 01/24 011-010-125-529215 437.50 Invoice Total:437.50 VENDOR - 2412 - CALIFORNIA ISO PAYMENT # 16764 PO or Contract 2/15/2024 890,285.41 Invoice Description Account Line Item Amount 2024021331630 REVISED CHARGES 01/22 055-050-590-520150 (3,417.93) 64914 2024021331630 REVISED CHARGES 01/22 64914 2024021331630 REVISED CHARGES 01/22 64914 2024021331630 REVISED CHARGES 10/23 64914 2024021331630 REVISED CHARGES 10/23 64914 2024021331630 REVISED CHARGES 10/23 64914 2024021331630 INITIAL CHARGES 02/24 64914 2024021331630 INITIAL CHARGES 02/24 64914 2024021331630 INITIAL CHARGES 02/24 64914 055-050-590-520190 055-050-590-520170 055-050-590-520170 055-050-590-520150 055-050-590-520190 055-050-590-520170 055-050-590-520190 055-050-590-520210 055-050-590-520150 055-450-590-450015 (0.98) 59.13 (1,351.52) (1,234.71) (154.73) (2,528.98) 845.85 1,565.68 100,557.94 (119,117.86) 2024021331630 INITIAL CHARGES 02/24 64914 2024021331630 INITIAL CHARGES 01/24 64914 Page 29 of 33 . . Item 8 Page 31 of 35 CITY OF VERNON OPERATING ACCOUNT WARRANT REGISTER NO. 126 DATE 03/19/2024 2024021331630 INITIAL CHARGES 01/24 64914 2024021331630 INITIAL CHARGES 01/24 64914 2024021331630 INITIAL CHARGES 01/24 64914 2024021331630 INITIAL CHARGES 01/24 64914 2024021331630 INITIAL CHARGES 01/24 64914 2024021331630 INITIAL CHARGES 01/24 64914 055-050-590-520190 055-050-590-520240 055-050-590-520210 055-050-590-520180 055-050-590-520170 055-050-590-520150 4,742.54 8,911.35 10,373.67 207,346.01 243,809.64 439,880.31 890,285.41Invoice Total: VENDOR - 714 - CALPERS PAYMENT # 16862 PO or Contract 2/9/2024 236,383.55 Invoice 10827 Description Account Line Item Amount CALPERS PAY DAY 02.08.24 CALPERS PAY DAY 02.08.24 CALPERS PAY DAY 02.08.24 CALPERS PAY DAY 02.08.24 CALPERS PAY DAY 02.08.24 CALPERS PAY DAY 02.08.24 011-000-000-210240 055-000-000-210240 056-000-000-210240 058-000-000-210240 059-000-000-210240 011-010-130-523034 159,450.49 63,923.81 3,995.39 8,926.92 87.64 10827 10827 10827 10827 10827 (0.70) Invoice Total:236,383.55 VENDOR - 1635 - EMPLOYMENT DEVELOPMENT DEPT PAYMENT # 16863 PO or Contract 2/9/2024 44,236.13 Invoice 10828 Description Account Line Item Amount STATE WITHHOLDING PAY DAY 02.08.24 STATE WITHHOLDING PAY DAY 02.08.24 STATE WITHHOLDING PAY DAY 02.08.24 STATE WITHHOLDING PAY DAY 02.08.24 STATE WITHHOLDING PAY DAY 02.08.24 011-000-000-210210 055-000-000-210210 056-000-000-210210 058-000-000-210210 059-000-000-210210 25,210.02 16,116.32 1,209.38 1,675.99 24.42 10828 10828 10828 10828 Invoice Total:44,236.13 VENDOR - 4075 - THE DEPARTMENT OF THE TREASURY PAYMENT # 16864 2/9/2024 136,194.31 Page 30 of 33 . . Item 8 Page 32 of 35 CITY OF VERNON OPERATING ACCOUNT WARRANT REGISTER NO. 126 DATE 03/19/2024 Invoice 10830 Description Account PO or Contract Line Item Amount 80,269.92FWH, STW, AND MEDICARE PAY DAY 02.08.24 011-000-000-210210 10830 10830 10830 10830 FWH, STW, AND MEDICARE PAY DAY 02.08.24 FWH, STW, AND MEDICARE PAY DAY 02.08.24 FWH, STW, AND MEDICARE PAY DAY 02.08.24 FWH, STW, AND MEDICARE PAY DAY 02.08.24 055-000-000-210210 056-000-000-210210 058-000-000-210210 059-000-000-210210 47,114.26 3,110.55 5,648.95 50.63 Invoice Total:136,194.31 VENDOR - 7541 - MISSIONSQUARE RETIREMENT PAYMENT # 16865 PO or Contract 2/8/2024 30,880.83 Invoice 10833 Description Account Line Item Amount DEFERRED COMPENSATION PAY DAY 011-000-000-210220 16,046.39 12,989.80 1,219.13 575.51 02.08.24 10833 10833 10833 10833 DEFERRED COMPENSATION PAY DAY 02.08.24 DEFERRED COMPENSATION PAY DAY 02.08.24 DEFERRED COMPENSATION PAY DAY 02.08.24 DEFERRED COMPENSATION PAY DAY 02.08.24 055-000-000-210220 056-000-000-210220 058-000-000-210220 059-000-000-210220 50.00 Invoice Total:30,880.83 VENDOR - 714 - CALPERS Invoice PAYMENT # 16866 PO or Contract 2/8/2024 23,223.00 Description Account Line Item Amount 1000000157822 CALPERS SETTLEMENT AGREEMENT 11 011-000-000-111100 23,223.00 Invoice Total:23,223.00 VENDOR - 714 - CALPERS PAYMENT # 16867 PO or Contract 2/12/2024 1,266,891.00 Invoice Description Account Line Item Amount Page 31 of 33 . . Item 8 Page 33 of 35 CITY OF VERNON OPERATING ACCOUNT WARRANT REGISTER NO. 126 DATE 03/19/2024 1000000174408 CALPERS FY2024 CERBT CONTRIBUTION 011-010-120-513040 1,266,891.00 44 Invoice Total:1,266,891.00 VENDOR - 1635 - EMPLOYMENT DEVELOPMENT DEPT PAYMENT # 16868 PO or Contract 2/7/2024 451.00 Invoice Description Account Line Item Amount L0979159376 UNEMPLOYMENT INSURANCE BENEFIT CHARGE 011-020-200-513070 451.00 Invoice Total:451.00 PAYROLL DIRECT DEPOSIT Invoice 2/8/2024 706,316.11 Description Account PO or Contract Line Item Amount 012524 012524 012524 012524 012524 PAYROLL DIRECT DEPOSIT PAYROLL DIRECT DEPOSIT PAYROLL DIRECT DEPOSIT PAYROLL DIRECT DEPOSIT PAYROLL DIRECT DEPOSIT 011-000-000-210110 055-000-000-210110 056-000-000-210110 058-000-000-210110 059-000-000-210110 439,126.57 222,510.72 10,161.05 34,268.62 249.15 Invoice Total:706,316.11 Page 32 of 33 . . Item 8 Page 34 of 35 CITY OF VERNON OPERATING ACCOUNT WARRANT REGISTER NO. 126 DATE 03/19/2024 FUND EARLY CHECKS TOTAL ELECTRONIC TOTAL GRAND TOTAL 011 - GENERAL 055 - LIGHT & POWER 056 - NATURAL GAS 058 - WATER $ $ $ $ 241,709.73 381,964.02 5,654.47 $ $ $ $ $ 3,580,351.75 $ $ $ $ $ $ $ 3,822,061.48 4,081,571.37 20,361.89 4,463,535.39 26,016.36 14,798.00 228,491.86 212,969.44 243,289.86 212,969.44 6,810.00 059 - FIBER 095 - SEWC JPA $6,810.00 Total $650,936.22 $8,123,746.31 8,774,682.53 Page 33 of 33 AM . . Item 8 Page 35 of 35 City Council Agenda Report Meeting Date:March 19, 2024 From:Todd Dusenberry, General Manager of Public Utilities Department:Public Utilities Submitted by:Adriana Ramos, Management Analyst Subject License Agreement with Southern California Edison Company Recommendation A. Find that the proposed action is categorically exempt from California Environmental Quality Act (CEQA) review, in accordance with CEQA Guidelines Section 15301, because the proposed action involves the leasing of an existing public utility service facility and involves negligible or no expansion of an existing use; and B. Approve and authorize the City Administrator to execute a License Agreement with the Southern California Edison Company (SCE), in substantially the same form as submitted, for the use of land at the Laguna Bell Substation for a total amount not-to-exceed $2,208.21, for a five- year term. Background Vernon Public Utilities (VPU) has been operating remote terminal units in a shed at the Southern California Edison Company (SCE) Laguna Bell Substation since 1989. On January 15, 2019, the City Council approved a five-year License Agreement with SCE, which is set to expire on March 31, 2024. The purpose of the License Agreement is to allow the City to use the land at the Laguna Bell Substation for the purposes of a remote terminal unit, access road, and parking. The City has negotiated an extension of the lease with SCE of the property at the Laguna Bell Substation for an additional five years, starting from April 1, 2024 through March 31, 2029. Staff recommends approving the License Agreement with SCE for the use of the land at the Laguna Bell Substation, for a total amount not exceeding $2,208.21. As part of the agreement, the City must provide evidence of sufficient insurance coverage and include SCE as an additional insured party. If approved, VPU staff will work with the Finance Department to provide the necessary insurance documents to SCE. Pursuant to Vernon Municipal Code Section 3.32.030(B) City Council approval is required for the proposed License Agreement since the City has awarded SCE contracts worth over $100,000 in the last 12 months. The License Agreement has been reviewed and approved as to form by the City Attorney’s Office. Fiscal Impact The fiscal impact is not-to-exceed $2,208.21 for a five-year term. Sufficient funds for the proposed agreement are available in Electric Fund, Engineering Department, Repairs & Maintenance-IT Account No. 055-050-585-529110 for the current fiscal year. Attachments 1. Southern California Edison – License Agreement . . Item 9 Page 1 of 1 SCE Doc. 23563 Att. Contract No. 9.2324 (Formerly Contract No. L2845) Initial (_______)/(_______) Licensor/Licensee -1- Rev9 2023-03-08 JR-KB CITY OF VERNON L I C E N S E A G R E E M E N T I N D E X O F A R T I C L E S 1. USE 2. TERM 3. CONSIDERATION 4. INSURANCE 5. LICENSOR’S USE OF THE PROPERTY 6. LICENSEE’S IMPROVEMENTS 7. LICENSEE'S PERSONAL PROPERTY 8. HEIGHT LIMITATIONS AND VERTICAL CLEARANCES 9. ACCESS AND CLEARANCES 10. PARKING 11. WEEDS, BRUSH, RUBBISH AND DEBRIS (WEED ABATEMENT) 12. FLAMMABLES, WASTE AND NUISANCES 13. PESTICIDES AND HERBICIDES 14. HAZARDOUS MATERIALS AND WASTE 15. SIGNS 16. FENCING AND EXISTING FIXTURES 17. PARKWAYS AND LANDSCAPING 18. IRRIGATION EQUIPMENT 19. UNDERGROUND TANKS 20. UNDERGROUND FACILITIES 21. UTILITIES 22. TAXES, ASSESSMENTS AND LIENS 23. EXPENSE 24. ASSIGNMENTS 25. COMPLIANCE WITH LAWS AND REGULATIONS 26. GOVERNING LAW 27. INDEMNIFICATION; ASSUMPTION OF RISK; RELEASE 28. TERMINATION 29. EVENTS OF DEFAULT 30. REMEDIES 31. LICENSEE’S PERSONAL PROPERTY UPON TERMINATION OR EXPIRATION 32. LIMITATION OF LIABILITY 33. NON-POSSESSORY INTEREST 34. WAIVER 35. AUTHORITY 36. ELECTRIC AND MAGNETIC FIELDS . . Item 9 Page 1 of 19 SCE Doc. 23563 Att. Contract No. 9.2324 (Formerly Contract No. L2845) Initial (_______)/(_______) Licensor/Licensee -2- Rev9 2023-03-08 JR-KB 37. INDUCED VOLTAGES 38. NOTICES 39. RECORDING 40. COMPLETE AGREEMENT 41. SIGNATURE AUTHORITY 42. SURVIVAL APPENDIX: GUIDELINES FOR STANDARD LICENSEE IMPROVEMENTS ADDENDUM(S) PARKING . . Item 9 Page 2 of 19 SCE Doc. 23563 Att. Contract No. 9.2324 (Formerly Contract No. L2845) Initial (_______)/(_______) Licensor/Licensee -3- Rev9 2023-03-08 JR-KB LICENSE AGREEMENT THIS AGREEMENT between SOUTHERN CALIFORNIA EDISON COMPANY, a corporation organized under the laws of the State of California, called "Licensor", and CITY OF VERNON, called "Licensee"; WITNESSETH: That Licensor, for and in consideration of the faithful performance by Licensee of the terms, covenants and agreements hereinafter set forth to be kept and performed by Licensee, does hereby give to Licensee the license to use that certain real property solely for the purpose hereinafter specified, upon and subject to the terms, reservations, covenants and conditions hereinafter set forth, hereinafter designated as "Property” on the Exhibit "A" attached hereto and made a part hereof, being a portion of Assessor’s Parcel Number 6330-001-805, situated in the City of Commerce County of Los Angeles, State of California, subject to any and all covenants, restrictions, reservations, exceptions, rights and easements, whether or not of record. Acknowledgment of License and Disclaimer of Tenancy Licensee acknowledges and agrees that the License constitutes a limited, revocable, non-possessory, personal and non-assignable privilege to use the Property solely for those permitted uses and activities expressly identified in the Agreement (the “License Privilege”). Licensee further acknowledges and agrees that: ● The consideration paid by Licensee pursuant to Article 3 of the Agreement is consistent with the value of the rights comprising the License Privilege; the consideration is not consistent with the higher market value for a greater right, privilege or interest (such as a lease) in the Property or similarly situated parcels. ● Licensee is not a tenant or lessee of Licensor and holds no rights of tenancy or leasehold in relation to the Property. ● The Agreement and/or any prior and/or future acts or omissions of Licensor shall not create (or be construed as creating) a leasehold, tenancy or any other interest in the Property. ● Licensor may terminate the License and revoke the License Privilege at any time, subject, if applicable, to a notice period agreed upon by the parties, as more particularly set forth in the Agreement. ● In consideration of Licensor’s grant of the License, Licensee specifically and expressly waives, releases and relinquishes any and all right(s) to assert any claim of right, privilege or interest in the Property other than the License. ● Licensee further acknowledges and agrees that without the representations and agreements set forth herein, Licensor would not enter into the Agreement. . . Item 9 Page 3 of 19 SCE Doc. 23563 Att. Contract No. 9.2324 (Formerly Contract No. L2845) Initial (_______)/(_______) Licensor/Licensee -4- Rev9 2023-03-08 JR-KB 1. Use: Licensee will use the Property for remote terminal unit, access road, and parking purposes only. Licensor makes no representation, covenant, warranty or promise that the Property, and any fixtures thereon, are fit or suitable for any particular use, including the use for which this Agreement is made and Licensee is not relying on any such representation, covenant, warranty or promise. Licensee’s use of the property for any other purpose and/or failure to utilize the Property in accordance with this License as determined by the Licensor in its sole discretion will be deemed a material default and grounds for immediate termination of this Agreement in accordance with Article s 28 and/or 30. 2. Term: Unless otherwise terminated as provided herein, this Agreement will be in effect for a term of five (5) years commencing on the first day of April, 2024 and ending on the last day of March, 2029. Licensee acknowledges that this Agreement does not entitle Licensee to any subsequent agreement, for any reason whatsoever, regardless of the use Licensee makes of the Property, the improvements Licensee places on or makes to the Property , or for any other reason. 3. Consideration: Licensee will pay to Licensor the sum of Two Thousand Two Hundred Eight and 21/100 Dollars ($2,208.21) upon the execution and delivery of this Agreement for the full term of this Agreement. Payment to Licensor must be in the form of a check or money order payable to Southern California Edison Company. No cash payments will be accepted by Licensor. All accounts not paid by the agreed upon due date may be subject to a late fee of up to 20% of the amount that was due on the date. All payments subsequent to the initial payment will be paid to the Southern California Edison Company, Post Office Box 800 Rosemead, California, 91770, and Attention: Corporate Accounting Department – Accounts Receivable. 4. Insurance: During the term of this Agreement, Licensee shall maintain the following insurance: (a) Workers’ Compensation with statutory limits, under the laws of the State of California and Employer’s Liability with limits of not less than $1,000,000.00 each accident, disease/each employee, and disease/policy limit. Licensee shall require its insurer to waive all rights of subrogation against Licensor, its officers, agents and employees, except for any liability resulting from the willful or grossly negligent acts of the Licensor. (b) Commercial General Liability Insurance, including contractual liability and products liability, with limits not less than $1,000,000.00 per occurrence and $1,000,000.00 in the aggregate. Such insurance shall: (i) name Licensor, its officers, agents and employees as additional insureds, but only for Licensee’s negligent acts or omissions; (ii) be primary for all purposes and (iii) contain separation of insureds or cross-liability clause, and (iv) require its insurer to waive all rights of subrogation against Licensor, its officers, agents and employees, except for any liability resulting from the willful or grossly negligent acts of the Licensor. (c) Commercial Automobile Liability insurance with a combined single limit of $1,000,000.00. Such insurance shall cover the use of owned, non-owned and hired vehicles on the Property. . . Item 9 Page 4 of 19 SCE Doc. 23563 Att. Contract No. 9.2324 (Formerly Contract No. L2845) Initial (_______)/(_______) Licensor/Licensee -5- Rev9 2023-03-08 JR-KB (d) Self - Insurance: Licensee may self-insure all of the insurance requirements above if they belong to an approved Secondary Use Category and the self -insurance is maintained under a self-insurance program reasonably satisfactory to Licensor. Remote terminal unit, access road and parking use is an approved Secondary Use Category; Licensee may submit written verification of self-insurance to meet the above insurance requirements. The failure to maintain such insurance may be deemed by Licensor a material default of this Agreement and grounds for immediate termination pursuant to Articles 28 and/or 30. Licensee shall provide Licensor with proof of such insurance by submission of certificates of insurance, pursuant to Article 38 “Notices”, at least ten days prior to the effective date of this Agreement, and thereafter at least ten days prior to each insurance renewal date. Licensee must provide Licensor at least thirty (30) days notice before any such insurance will be canceled, allowed to expire, or materially reduced. However, in the event insurance is canceled for the non-payment of a premium, Licensee must provide to Licensor at least ten (10) days’ prior written notice before the effective date of cancellation. The required insurance policies shall be maintained with insurers reasonably satisfactory to Licensor and shall be primary and non-contributory with any insurance or self-insurance maintained by Licensor. 5. Licensor's Use of the Property: Licensee agrees that Licensor, its successors and assigns, have the right to enter the Property, at all times, for any purpose, and the right to conduct any activity on the Property. Exercise of these rights by Licensor, its successors and assigns, will not result in compensation to Licensee for any damages whatsoever to personal property, structures, and/or crops located on the Property, nor shall Licensee be entitled to any compensation for any loss of use of the Property or a portion thereof, and/or any related damages, as a result of Licensor’s activities under this Article. 6. Licensee's Improvements: Licensee must submit, for Licensor's prior written approval, complete improvement plans, including, but not limited to, grading, lighting, landscaping, grounding, and irrigation plans, - identifying all existing and proposed improvements, a minimum of sixty (60) days prior to making any use of the Property. Licensee’s conceptual plans for proposed improvements shall be developed in accordance with the guidelines contained in the Appendix to this License. It is understood and agreed that the general guidelines contained in the Appendix are intended to provide a framework for the development of conceptual plans only; and that Licensor may m odify or add to the conditions contained in the Appendix hereto, based on individual site characteristics, Licensor’s existing or potential operating needs or Licensee’s proposed use(s). Licensee must submit, for Licensor's prior written approval plans for any modifications to such improvements. Written approval may be modified and/or rescinded by Licensor for any reason whatsoever. To the extent Licensor reviews and/or approves any improvement plans, Licensor is doing so only for purposes of determining whether said improvements are compatible with Licensor’s use of the Property. Under no circumstances shall such review and/or approval be construed as a warranty, representation, or promise that the Property is fit for the proposed improvements, or that said improvements comply with any applicable city, state, or county building requirements, other legal requirements, or the generally accepted standard of care. At any time, Licensor may require Licensee to modify and/or remove any or all such previously approved improvements at Licensee’s risk and expense and without compensation from Licensor. Licensor is not required, at any time, to make any repairs, improvements, alterations, changes or additions of any nature whatsoever to the Propertyand/or any fixtures thereon. Licensee expressly acknowledges that . . Item 9 Page 5 of 19 SCE Doc. 23563 Att. Contract No. 9.2324 (Formerly Contract No. L2845) Initial (_______)/(_______) Licensor/Licensee -6- Rev9 2023-03-08 JR-KB any expenditures or improvements will in no way alter Licensor’s right to terminate in accordance with Articles 28, and/or 30. 7. Licensee's Personal Property: (i) Licensor grants Licensee permission to place Licensee’s personal property on the Property consistent with the use identified in Article 1 and other terms of this Agreement. Such permission granted by Licensor shall be revoked upon the earlier of the termination or expiration of this Agreement. All equipment and other property brought, placed or erected on the Property by Licensee shall be and remain the property of Licensee, except as otherwise set forth herein. Licensee shall be responsible for any damage to the Property and/or Licensor’s personal property arising out of Licensee’s activities on the Property, including its use and/or removal of Licensee’s personal property. Licensee further acknowledges and agrees that Licensor is not responsible for Licensee’s personal property during the effectiveness of this Agreement, or upon termination or expiration. Licensor further assumes no duty or obligation to maintain or secure Licensee’s personal property at any time. (ii) Unless as specifically provided for in an Addendum to this Agreement, Licensee shall not store on the Property, for a period longer than twenty-four (24) consecutive hours, any personal property owned by a non-party to this Agreement. Licensee will defend and indemnify Licensor, its directors, officers, agents, subcontractors, and employees, and its successors and assigns, from any and all claims, loss, damage, actions, causes of action, expenses and/or liability arising from the storage of, damage to, and/or loss of use of such non- party’s personal property. 8. Height Limitations and Vertical Clearances: Any equipment used by Licensee or its agents, employees or contractors, on and/or adjacent to the Property, will be used and opera ted so as to maintain minimum clearances from all overhead electrical conductors as designated in the table below: Vehicle/ Equipment Vertical Clearance 500 kV 35 feet 220 kV – 66kV 30 feet <66kV (Distribution facilities) 25 feet Telecom 18 feet All trees and plants on the Property will be maintained by Licensee at a maximum height of fifteen (15) feet. If requested by Licensor, Licensee will remove or relocate at Licensee’s expense, any tree and/or other planting. 9. Access and Horizontal Clearances: Licensee will provide Licensor with adequate access to all of Licensor's facilities on the Property and at no time will there be any interference with the free movement of Licensor's equipment, personnel, and materials over the Property. Licensor may require Licensee to provide and maintain access roads within the Property, at a minimum usable width of sixteen (16) feet, with commercial driveway aprons and curb depressions capable of supporting a gross load of forty (40) tons on a three-axle vehicle. The minimum width of all roads shall be increased on curves by a distance equal to 400/inside radius of curvature. All curves shall have a radius of not less than 50 feet measured at the inside edge of the usable road surface. Unless otherwise specified in writing by Licensor, Licensee will make no use of the area directly underneath Licensor's towers and will maintain the following minimum clearances: . . Item 9 Page 6 of 19 SCE Doc. 23563 Att. Contract No. 9.2324 (Formerly Contract No. L2845) Initial (_______)/(_______) Licensor/Licensee -7- Rev9 2023-03-08 JR-KB a. A 50-foot-radius around suspension tower legs, H-Frames and poles and 100-foot radius around dead-end tower legs, H-Frames and poles. b. A 25-foot-radius around all other poles. NOTE: Additional clearance may be required by Licensor for structures. 10. Parking: Licensee will not park, store, repair or refuel any motor vehicles or allow parking, storage, repairing or refueling of any motor vehicles on the Property unless specifically approved in a writing executed by Licensor. 11. Weeds, Brush, Rubbish and Debris (Weed Abatement): Licensee will keep the Property clean, free from weeds, brush, rubbish and debris and in a condition satisfactory to Licensor. 12. Flammables, Waste and Nuisances: Unless permitted by Licensor in writing, Licensee will not, or allow others, to place, use, or store any flammable or combustible materials or waste materials on the Property or commit any waste or damage to the Property or allow any to be done. Licensee will be responsible for the control of and will be liable for any damage or disturbance, caused by any trespasser, dust, odor, flammable or waste materials, noise or other nuisance disturbances. Licensee will not permit dogs on the Property. 13. Pesticides and Herbicides: Any pesticide or herbicide applications and disposals will be made in accordance with all Federal, State, County and local laws. Licensee will dispose of all pesticides, herbicides and any other toxic substances declared to be either a health or environmental hazard , and all materials contaminated by such substances, including but not limited to, containers, clothing and equipment, in the manner prescribed by law. 14. Hazardous Material and Waste: Licensee will not engage in, or permit any other party to engage in, any activity on the Property that violates federal, state or local laws, rules or regulations pertaining to the use, management, storage, or disposal of waste, including, but not limited to hazardous, toxic or infectious materials. Unless permitted by Licensor in writing, Licensee will not, or allow others to, place, use, or store any hazardous, toxic or infectious materials and/or waste on the Property. Licensee will indemnify and hold Licensor, its directors, officers, agents and employees, and its successors and assigns, harmless from all claims, loss, damage, actions, causes of action, expenses and/or liability arising from leaks of, spills of, and/or contamination by or from hazardous materials as defined by applicable laws or regulations, which may occur during and after the Agreement term, and are attributable to the actions of, or failure to act by, Licensee or any person claiming under Licensee. 15. Signs: Licensee must obtain written approval from Licensor prior to the construction or placement of any sign, signboard or other form of outdoor advertising. Licensee shall within three (3) days from the date on which the Licensee learns of the graffiti remove any signs containing graffiti or shall otherwise remove such graffiti from the signs in a manner reasonably acceptable to Licensor. Notwithstanding any other language in this Article, Licensee shall not advertise on any sign any product, service, or good which is (i) not directly related to Licensee’s use of the Property, (ii) offensive to the public, or (iii) which Licensor, in its reasonable discretion, deems objectionable. 16. Fencing and Existing Fixtures: Licensor disclaims any and all express or implied warranties for any fencing and/or other fixtures affixed to the Property, and further disclaims any liability arising from any disrepair of the same. Licensee may install fencing on the Property with prior . . Item 9 Page 7 of 19 SCE Doc. 23563 Att. Contract No. 9.2324 (Formerly Contract No. L2845) Initial (_______)/(_______) Licensor/Licensee -8- Rev9 2023-03-08 JR-KB written approval from Licensor. Such fencing will include double drive gates, in locations specified by Licensor, a minimum of twenty (20) feet in width and designed to accommodate separate Licensor and Licensee locks. Licensee will maintain and repair all fencing and other fixtures affixed to the Property, including any grounding of the same as deemed necessary by Licensor, in a manner acceptable to Licensor. Grounding plans must be prepared and stamped by a licensed electrical engineer and submitted to Licensor. 17. Parkways and Landscaping: Licensee will keep parkway and sidewalk areas adjacent to the Property free of weeds, brush, rubbish and debris. Licensee will maintain parkways on the Property and provide landscaping that is compatible with adjoining prop erties and that is satisfactory to Licensor. 18. Irrigation Equipment: Any irrigation equipment located on the Property prior to the commencement of this Agreement, including but not limited to pipelines, well pumping equipment and other structures, is the property of Licensor and will remain on and be surrendered with the Property upon termination of this Agreement. Should Licensee desire to use the irrigation equipment, Licensee will maintain, operate, repair and replace, if necessary, all irrigation equipment at its own expense. 19. Underground and Above-Ground Tanks: Licensee will not install underground or above- ground storage tanks, as defined by any and all applicable laws or regulations, without Licensor's prior written approval in accordance with Article 6. 20. Underground Facilities: Any underground facilities must be approved by Licensor pursuant to Article 6. Licensee must contact Dig Alert and comply with the applicable processes, policies and/or procedures of Dig Alert, prior to any underground installation. Any underground facilities installed or maintained by Licensee on the Property must have a minimum cover of three feet from the top of the facility and be capable of withstanding a gross load of forty (40) tons on a three -axle vehicle. Licensee will compact any earth excavated to a compaction of ninety percent (90%). Licensee will relocate its facilities at its own expense so as not to interfere with Licensor's proposed facilities. 21. Utilities: Licensee will pay all charges and assessments for, or in connection with, water, electric current or other utilities which may be furnished to or used on the Property. 22. Taxes, Assessments and Liens: Licensee will pay all taxes and assessments which may be levied upon any crops, personal property, and improvements, including but not limited to, buildings, structures, and fixtures on the Property. Licensee will keep the Property free from all liens, including but not limited to, mechanics liens and encumbrances by use or oc cupancy by Licensee, or any person claiming under Licensee. If Licensee fails to pay the above-mentioned taxes, assessments or liens when due, Licensor may pay the same and charge the amount to the Licensee. All accounts not paid within thirty (30) days of the agreed upon due date will be charged a "late fee" on all amounts outstanding up to the maximum rate allowed by law. 23. Expense: Licensee will perform and pay all obligations of Licensee under this Agreement. All matters or things required by Licensee will be performed and paid for at the sole cost and expense of Licensee, without obligation by Licensor to make payment or incur cost or expense for any such matters or things. 24. Assignments: This Agreement is personal to Licensee, and Licensee will not assign, transfer or sell this Agreement or any privilege hereunder in whole or in part, and any attempt to do so will be void and confer no right on any third party. . . Item 9 Page 8 of 19 SCE Doc. 23563 Att. Contract No. 9.2324 (Formerly Contract No. L2845) Initial (_______)/(_______) Licensor/Licensee -9- Rev9 2023-03-08 JR-KB 25. Compliance with Laws and Regulations: Licensee will comply with all applicable federal, state, county and local laws, all covenants, conditions and restrictions of record and all applicable ordinances, zoning restrictions, rules, regulations, orders and any requirements of any duly constituted public authorities now or hereafter in any manner affecting the Property or the streets and ways adjacent thereto. Licensee will obtain all permits and other governmental approvals required in connection with Licensee's activities hereunder. Licensee shall also comply with the requirements of every addendum attached hereto. Licensee shall hold harmless, defend and indemnify Licensor, its officers, agents and employees, and its successors and assigns, from and against all claims, loss, damage, actions, causes of actions, expense and/or liability arising from or resulting from any violation of this provision. 26. Governing Law: The existence, validity, construction, operation and effect of this Agreement and all of its terms and provisions will be determined in accordance with the laws of the State of California. 27. Indemnification; Assumption of Risk; Release: Licensee shall hold harmless, defend and indemnify Licensor, its officers, agents and employees, and its successors and assigns, from and against all claims, loss, damage, actions, causes of actions, expense and/or liability arising from or growing ou t of loss or damage to property, including that of Licensor, or injury to or death of persons, including employees of Licensor resulting in any manner whatsoever, directly or indirectly, by reason of this Agreement or the use or occupancy of the Property by Licensee or any person claiming under Licensee. Licensee agrees to assume all risk of loss by fire, flood, earthquake, theft, accident, or casualty of any kind, which may affect the Property, any improvements constructed or installed thereon by Licensee, Licensee’s use of the Property, or exercise of the rights granted herein. Licensee releases and waives all claims against Licensor and each of the indemnified parties for loss or damage caused by, arising out of, or in any way connected with Licensor’s or Licensee’s use of the Property or the exercise of the rights granted herein. 28. Termination: Licensor or Licensee may terminate this Agreement, at any time, for any reason, upon thirty (30) days notice in writing. Additionally, Licensor may immediately terminate this Agreement pursuant to Article 30. Termination does not release Licensee from any liability or obligation (indemnity or otherwise) which Licensee may have incurred. Upon termination, Licensor may immediately recover from Licensee all amounts due and owing hereunder, plus interest at the maximum rate permitted by law on such amounts until paid, as well as any other amount necessary to compensate Licensor for all the detriment proximately caused by Licensee’s failure to perform its obligations under this Agreement. Licensee's continued presence after termination shall be deemed a trespass. In the event of a termination for any reason other than non-payment of the License fee, Licensor shall refund any previously collected/pre-paid License fees covering the unused portion of the remaining term, to the extent such fees exceed any offset claimed by Licensor under the Agreement 29. Events of Default: In addition to material defaults otherwise described herein, the occurrence of any of the following shall constitute a material default and breach of this Agreement by Licensee: (a) Any failure by Licensee to pay the consideration due under Article 3, or to make any other payment required to be made by Licensee when due. (b) The abandonment or vacating of the Property by Licensee. . . Item 9 Page 9 of 19 SCE Doc. 23563 Att. Contract No. 9.2324 (Formerly Contract No. L2845) Initial (_______)/(_______) Licensor/Licensee -10- Rev9 2023-03-08 JR-KB (c) Any attempted assignment or subletting of this Agreement by Licensee in violation of Article 24. (d) The violation by Licensee of any resolution, ordinance, statute, code, regulation or ot her rule of any governmental agency applicable to Licensee’s activities under this Agreement. (e) Any attempt to exclude Licensor from the licensed premises. (f) The making by Licensee of any general assignment for the benefit of creditors; the appointment of a receiver to take possession of substantially all of Licensee's assets located on the Property or of Licensee's privileges hereunder where possession is not restored to Licensee within five (5) days; the attachment, execution or other judicial seizure of substantially all of Licensee's assets located on the Property or of Licensee's privileges hereunder, where such seizure is not discharged within five (5) days. (g) Any case, proceeding or other action brought against Licen see seeking any of the relief mentioned in "clause f" of this Article which has not been stayed or dismissed within thirty (30) days after the commencement thereof. (h) Any claim by Licensee that it has a possessory interest and/or irrevocable license in the Property. (i) With respect to items not otherwise listed in Article 29.a-h, the failure by Licensee to observe and perform any other provision of this Agreement to be observed or performed by Licensee. Licensor shall provide written notice of such failur e and Licensee shall be considered in material default where such failure continues for a total of ten (10) or more consecutive days from the date of the notice. Further, with respect to items not otherwise listed in Article 29.a-h, Licensee shall be considered in material default should Licensee fail to observe or perform any other provision of this Agreement for more than fifteen (15) days during the entire Term of the Agreement in the aggregate, after Licensor provides an initial written notice of such failure. After providing initial notice under this provision, Licensor will not be required to provide any subsequent notice of breach of this Agreement. 30. Remedies: Notwithstanding the notice requirement in Article 28, in the event of any material default by Licensee, then in addition to any other remedies available to Licensor at law or in equity, Licensor shall have the option to immediately terminate this Agreement and all rights of Licensee hereunder by giving written notice of such immediate termination to Licensee. 31. Licensee’s Personal Property Upon Termination or Expiration: In the event that this Agreement is terminated, whether termination is effected pursuant to Article 28 and/or 30, or in the event this Agreement expires pursuant to Article 2, Licensee shall, at Licensee’s sole cost and expense and prior to the earlier of the effective termination date or expiration date, remove all weeds, debris, and waste from the Property and peaceably quit, surrender and restore the licensed Property to the condition it was in prior to the Licensee’s use of the Property, in a manner satisfactory to Licensor. If Licensee fails or refuses to remove any of Licensee’s personal property, building(s), fixture(s) or structure(s) from the Property prior to the earlier of the termination date or expiration date, said personal property, building(s), fixture(s) or structure(s) shall be deemed abandoned by the Licensee, a nd the . . Item 9 Page 10 of 19 SCE Doc. 23563 Att. Contract No. 9.2324 (Formerly Contract No. L2845) Initial (_______)/(_______) Licensor/Licensee -11- Rev9 2023-03-08 JR-KB Licensor shall have the right, but not the obligation, to remove, destroy, sell or otherwise dispose of them with no further notice to Licensee. Licensor shall not be required to seek and/or obtain judicial relief (including, but not limited to, the filing of an unlawful detainer action), nor shall Licensor be responsible for the value of Licensee’s personal property. Licensor shall have the right to charge and recover from Licensee all costs and expenses incurred by Licensor related to (i) the removal, disposal or sale of Licensee’s personal property, building(s), fixture(s) or structure(s), (ii), the removal of any waste, weeds, or debris on the Property, (iii) environmental studies and environmental remediation and/or cleanup attributable to Licen see’s use of the Property, and (iv) the restoration of the Property to the condition it was in prior to Licensor’s initial use of the Property. Licensee agrees to pay such expenses to Licensor upon demand. 32. Limitation of Liability: IN ORDER FOR LICENSEE TO OBTAIN THE BENEFIT OF THE FEE IDENTIFIED IN ARTICLE 3, WHICH INCLUDES A LESSER ALLOWANCE FOR RISK FUNDING FOR LICENSOR, LICENSEE AGREES TO LIMIT LICENSOR’S LIABILITY PURSUANT TO THIS AGREEMENT. AS SUCH, IF LICENSEE IS ENTITLED TO ANY RELIEF FOR LICENSOR’S NEGLIGENCE, INCLUDING GROSS NEGLIGENCE, FOR DAMAGE OR DESTRUCTION OF LICENSEE’S PERSONAL PROPERTY, BUILDING(S), STRUCTURE(S) OR FIXTURE(S), THE TOTAL LIABILITY OF LICENSOR SHALL NOT EXCEED THE TOTAL FEES ACTUALLY PAID BY LICENSEE TO LICENSOR DURING THE TERM OF THIS AGREEMENT. FURTHER, IN NO EVENT SHALL LICENSOR BE LIABLE UNDER ANY CIRCUMSTANCES FOR INJURY OR DAMAGE TO LICENSEE’S BUSINESS, IF ANY, INCLUDING, BUT NOT LIMITED TO, LOSS OF PROFITS, LOSS OF RENTS OR OTHER EVENTS, LOSS OF BUSINESS OPPORTUNITY, LOSS OF GOODWILL OR LOSS OF USE, IN EACH CASE, HOWEVER OCCURRING, RELATED TO THIS AGREEMENT. THE PROVISIONS OF THIS SECTION 32 SHALL EXPRSSLY SURVIVE THE TERMINATION OR EXPIRATION OF THIS AGREEMENT. 33. Non-Possessory Interest: Licensor retains full possession of the Property and Licensee will not acquire any possessory interest, whether temporary, permanent, or otherwise by reason of this Agreement, or by the exercise of the permission given herein. Licensee will make no claim to any such interest and Licensee will not claim that it has or ever had an irrevocable license in the Property. 34. Waiver: Licensor shall not be deemed to waive any provision of this Agreement orally or by conduct. Any waiver by Licensor of any provision of this Agreement must be in a writing signed by Licensor. No waiver by Licensor of any provision shall be deemed a waiver of any other provision or of any subsequent breach by Licensee of the same or any other provision. Licensor's consent to or approval of any act shall not be deemed to render unnecessary the obtaining of Licensor's consent to or approval of any subsequent act by Licensee. Licensor’s acceptance of payment after providing notice of termination to Licensee shall not constitute a waiver of Licensor’s termination of the Agreement. 35. Authority: This Agreement is executed subject to General Order No. 69-C of the Public Utilities Commission of the State of California dated and effective July 10, 1985, incorporated by this reference. As set forth in General Order 69-C, this License is made conditional upon the right of the Licensor either on order of the Public Utilities Commission or on Grantor’s own motion to resume the use of that property (including, but not limited to the removal of any obstructions) whenever, in the interest of Licensor’s service to its patrons or consumers, it shall appear necessary or desirable to do so. . . Item 9 Page 11 of 19 SCE Doc. 23563 Att. Contract No. 9.2324 (Formerly Contract No. L2845) Initial (_______)/(_______) Licensor/Licensee -12- Rev9 2023-03-08 JR-KB Licensee agrees to comply with all federal, state and local laws and regulations. This Agreement should not be construed as a subordination of Licensor’s rights, title and interest in and to its fee ownership, nor should this Agreement be construed as a waiver of any of the provisions contained in said License or a waiver of any costs of relocation of affected Licensor facilities. 36. Electric and Magnetic Fields (“EMF”): There are numerous sources of power frequency electric and magnetic field (“EMF”), including household or building wiring, electrical appliances and electric power transmission and distribution facilities. There have been numerous scientific studies about the potential health effects of EMF. Interest in a potential link between long -term exposures to EMF and certain diseases is based on this scientific research and public concerns. While some 40 years of research have not established EMF as a health hazard, some health authorities have identified magnetic field exposures as a possible human carcinogen. Many of the questions about diseases have been successfully resolved due to an aggressive international research program. However, potentially important public health questions remain about whether there is a link between EMF exposures in homes or work and some diseases including childhood leukemia and a variety of other adult diseases (e.g. adult cancers and miscarriages). While scientific research is continuing on a wide range of questions relating to exposures at both work and in our communities, a quick resolution of the remaining scientific uncertainties is not expected. Since Licensee plans to license or otherwise enter Licensor property that is in close proximity to Licensor electric facilities, Licensor wants to share with Licensee and those who may enter the property under this agreement, the information available about EMF. Accordingly, Licensor has attached to this document a brochure that explains some basic facts about EMF and that describes Licensor policy on EMF. Licensor also encourages Licensee to obtain other information as needed to assist in understanding the EMF regarding the planned use of this property. 37. Induced Voltages: Licensee hereby acknowledges that any structures (including, but not limited to, buildings, fences, light poles) that exist or may be constructed on the Property licensed herein, (hereinafter, the “Structures”) in close proximity to one or more high volt age (66 kilovolt or above) electric transmission lines and/or substation facilities may be susceptible to induced voltages, static voltages and/or related electric fault conditions (hereinafter collectively referred to as “Induced Voltages”) unless appropriate grounding or other mitigation measures are incorporated into the Structures. If not properly mitigated, Induced Voltages can cause a variety of safety and/or nuisance conditions including, but not limited to, electric shocks or other injuries to individuals contacting the Structures or other utilities connected to the Structures (including, but not limited to, natural gas lines, water lines or cable television lines), or interference with or damage to sensitive electronic equipment in or around the Structures. Measures to mitigate Induced Voltages, if required, will vary from case to case because of factors such as electric facility configuration and voltage, other utilities in volved, or sensitivity of electronic equipment. Licensee will be responsible to determine what Induced Voltages mitigation measures should be undertaken regarding the Structures and to implement such mitigation measures at its sole cost and expense. Licensee agrees for itself and for its contractors, agents, licensees, invitees, and employees, to save harmless and indemnify Licensor, its parent, subsidiaries and affiliated entities and their respective officers and employees against all claims, loss, damag e, actions, causes of action, expenses and/or liability arising from or growing out of loss or damage to property, including Licensor’s own personal property, or injury to or death of persons, including employees of Licensor caused by or resulting from or connected to Induced Voltages on or related to the Structures. . . Item 9 Page 12 of 19 SCE Doc. 23563 Att. Contract No. 9.2324 (Formerly Contract No. L2845) Initial (_______)/(_______) Licensor/Licensee -13- Rev9 2023-03-08 JR-KB 38. Notices: All notices required to be given by either party shall be made in writing and shall be deemed to have been given and received (a) when personally delivered, or delivered by same- day courier; or (b) on the third business day after mailing by registered or certified mail, postage prepaid, return receipt requested; or (c) upon delivery when sent by prepaid overnight express delivery service (e.g., FedEx, UPS); or (d) when sent by email and upon the receipt by the sending party of written confirmation by the receiving party. Notices shall be addressed as follows: To Licensor: Southern California Edison Company Vegetation & Land Management Land Management – Metro Region East 2 Innovation Way Pomona, CA 91768 Email: landuse@sce.com To Licensee: City Of Vernon 4305 Santa Fe Avenue Vernon, CA 90058 Email: tbass@cityofvernon.org Business Telephone No. (323) 583-8811 Ext. 851 Notice will be deemed effective on the third calendar day after mailing. A party will immediately notify the other party in writing of any address change. 39. Recording: Licensee will not record this Agreement. 40. Complete Agreement: Licensor and Licensee acknowledge that the foregoing provisions and any appendix, addenda and exhibits attached hereto constitute the entire Agreement between the parties. Any appendices, addenda and exhibits attached hereto are incorporated herein and made an integral part hereof. This Agreement may not be modified, amended, contradicted, supplemented or altered in any way by any previous written or oral agreements or any subsequent oral agreements or unsigned written agreements. This Agreement may be modified or amended only by way of a writing executed by both parties. In case any provision in this Agreement shall be deemed invalid, illegal or unenforceable, the validity, legality and enforceability of the remaining provisions shall not in any way be affected or impaired thereby and such provision shall be ineffective only t o the extent of such invalidity, illegality or unenforceability. 41. Signature Authority: Each of the persons executing this Agreement warrants and represents that he or she has the full and complete authority to enter into this Agreement on behalf of the Party for which he or she is signing, and to bind said party to the agreements, covenants and terms contained herein. 42. Survival: Any provision of this Agreement that imposes an obligation after termination or expiration of this Agreement shall survive the termination or expiration of this Agreement. . . Item 9 Page 13 of 19 SCE Doc. 23563 Att. Contract No. 9.2324 (Formerly Contract No. L2845) Initial (_______)/(_______) Licensor/Licensee -14- Rev9 2023-03-08 JR-KB IN WITNESS WHEREOF, the parties hereto have caused this Agreement to be executed in duplicate . LICENSOR: SOUTHERN CALIFORNIA EDISON COMPANY By___________________________________________ ARYN REYNOLDS Real Estate Specialist Land Management – Metro Region East Vegetation & Land Managment _____________________ Date LICENSEE: CITY OF VERNON By___________________________________________ CARLOS FANDINO, City Administrator _____________________ Date ATTEST: _________________________________ YONNIE PARKER, Deputy City Clerk APROVED AS TO FORM: _________________________________ ZAYNAH N. MOUSSA, City Attorney . . Item 9 Page 14 of 19 SCE Doc. 23563 Att. Contract No. 9.2324 (Formerly Contract No. L2845) Initial (_______)/(_______) Licensor/Licensee - 1 - Rev9 2023-03-08 JR-KB APPENDIX Guidelines for Standard Licensee Improvements The following criteria are provided to aid in developing a conceptual plot plan to be submitted to Southern California Edison Company herein after referred to as “Licensor” for consideration and approval prior to the start of any construction on “Licensor” property. Plans should be developed indicating the size and location of all planned improvements. The plan should specify the dimensions of all planned improvements and the distance of all planned improvements from property lines and all adjacent “Licensor” towers, poles, guy wires or other “Licensor” facilities. The plan must show the locations of all “Licensor” towers and poles, 16-foot-wide access roads, main water lines and water shut-off valves, electrical service lines and parking areas. All plans must indicate adjacent streets and include a “north arrow” and the Licensee’s name. SHADE STRUCTURES (Definition: A non-flammable frame covered on the top with a material designed to provide sh ade to aid in growing plants) 1. Shade structures must maintain minimum spacing of 50 feet between shade structure locations, should be placed perpendicular to Licensor’s overhead electrical conductors (wires) unless otherwise approved in writing by Licensor, and should not exceed maximum dimensions of: a. 100 feet in length b. 50 feet in width c. 15 feet in height 2. Shade structures will not be permitted within the following areas reserved for Licensor’s access: a. Within 2 feet from edge of 16-foot-wide access roads b. 50-foot radius around suspension tower legs, H-Frames, and poles c. 100-foot radius around dead-end tower legs, H-Frames, and poles d. 25-foot radius around anchors/guy wires, poles, and wood poles 3. Shade structures must utilize the following design: a. Temporary/slip joint construction only b. Non-flammable frame only c. Adequately grounded in accordance with plans approved and stamped by a California electrical engineer d. Shade covering must be non-flammable and manufactured with non-hydrocarbon materials. . . Item 9 Page 15 of 19 SCE Doc. 23563 Att. Contract No. 9.2324 (Formerly Contract No. L2845) Initial (_______)/(_______) Licensor/Licensee - 2 - Rev9 2023-03-08 JR-KB SHADEHOUSES/HOTHOUSES (Definition: A simple, non-flammable, enclosed structure designed to control temperature without the benefit of heating and/or air conditioning units to aid in propagating and/or growing plants) 1. Shadehouses/hothouses must maintain minimum spacing of 50 feet between shadehouse/hothouse locations, should be placed in perpendicular to Licensor’s overhead electrical conductors (wires) unless otherwise approved in writing by Licensor, and should not exceed maximum dimensions of: a. 100 feet in length b. 50 feet in width c. 15 feet in height 2. Shadehouses/hothouses will not be permitted within the following areas reserved for Licensor’s access: a. Within 2 feet from edge of 16-foot-wide access roads b. 50-foot radius around suspension tower legs, H-Frames, and poles c. 100-foot radius around dead-end tower legs, H-Frames, and poles d. 25-foot radius around anchors/guy wires, poles, and wood poles 3. Shadehouses/hothouses must utilize the following design: a. Temporary/slip joint construction only b. Non-flammable frame only c. Adequately grounded in accordance with plans approved and stamped by a California electrical engineer d. Covering must be non-flammable and manufactured with non-hydrocarbon materials GREENHOUSES (Definition: An enclosed structure designed to control temperature and/or humidity by the use of heating and/or air conditioning units to aid in propagating and/or growing plants) Greenhouses will be considered on a case-by-case basis. IRRIGATION SYSTEMS / WELLS 1. Maximum diameter of pipe: 3 inches 2. All pipes must be plastic Schedule 40 or better 3. No irrigation system will be permitted within the following areas reserved for Licensor’s access: a. Within 2 feet from edge of 16-foot-wide access roads b. 50 -foot radius around suspension tower legs, H-Frames, and poles . . Item 9 Page 16 of 19 SCE Doc. 23563 Att. Contract No. 9.2324 (Formerly Contract No. L2845) Initial (_______)/(_______) Licensor/Licensee - 3 - Rev9 2023-03-08 JR-KB c. 100-foot radius around dead-end tower legs, H-Frames, and poles 4. Sprinkler and drip irrigation controllers must be located at the edge of the right of way 5. Suitable identification markers will be required on main controllers and valves 6. Locations of main shut off valve will be provided and shown on a plot plan 7. Underground facilities must have a minimum cover of three feet 8. Earth disturbed must be compacted to ninety percent (90%) LANDSCAPING 1. No trees will be permitted under the overhead electrical conductors or within 20 feet of the area directly located under the outer circumference of the overhead conductors, which is commonly known as the “drip line.” 2. Trees must have slow to moderate growth, and must be of a variety that grows to a maximum height of only 40 feet and must be maintained by the Licensee at a height not to exceed 15 feet 3. Placement of large rocks (boulders) must be approved in writing by Licensor 4. Any mounds or change of grade must be approved in writing by Licensor 5. No cactus or thorny shrubs will be permitted 6. Retaining walls, planters, etc. may be considered on a case-by-case basis and must be approved in writing by Licensor 7. No crushed or freshly laid asphalt will be permitted TRAILERS (Definition: Removable / portable office modules are not permitted without Licensor’s prior permission. Trailers must meet the following criteria to be considered: Trailers must meet the following criteria: a. Must have axles and wheel and be able to be moved b. Maximum length: 40 feet c. Maximum height: 15 feet d. Maximum width: 12 feet 2. No trailers will be permitted within the following areas reserved for Licensor’s access: a. Within 2 feet from edge of 16-foot-wide access roads b. 50-foot radius around suspension tower legs, H-Frames, and poles c. 100-foot radius around dead-end tower legs, H-Frames, and poles d. 25-foot radius around anchors/guy wires, poles, and wood poles . . Item 9 Page 17 of 19 SCE Doc. 23563 Att. Contract No. 9.2324 (Formerly Contract No. L2845) Initial (_______)/(_______) Licensor/Licensee - 4 - Rev9 2023-03-08 JR-KB e. Under or within 10 feet of the conductor “drip lines” 3. Sewer or gas lines to trailers must be approved in writing by Licensor 4. Location of all electrical and telephone lines must be approved in writing by Licensor 5. Electrical lines must be installed by a licensed -general contractor. 6. Trailers shall not be used for residential purposes 7. Toxic or flammable materials will not be permitted in trailers 8. Adequately grounded in accordance with plans approved and stamped by a California electrical engineer PARKING AREAS Parking areas should not be designed under the overhead electrical conductors or within 10 feet of the “drip lines” without Licensor’s prior written approval. Parking spaces to be identified under the approved site plan. “No Parking” striping may be requir ed in areas where additional clearance is required. MATERIAL STORAGE 1. If an emergency occurs, Licensee must immediately relocate all materials specified by Licensor to provide Licensor clear access to its facilities. 2. Licensee must provide Licensor with a list of material stored on the right of way 3. No toxic or flammable materials will be permitted 4. No materials shall be stored within the following areas reserved for Licensor’s access: a. Within 2 feet from edge of 16-foot-wide access roads b. 50 - foot radius around suspension tower legs, H-Frames, and poles c. 100 - foot radius around dead-end tower legs, H-Frames, and poles d. 25 feet from anchors/guy wires, poles and wood poles 5. Storage of materials not to exceed a maximum height of 15 feet 6. No storage of gasoline, diesel or any other type of fuel will be permitted 7. Any fencing around the storage areas must have Licensor’s prior written approval . . . Item 9 Page 18 of 19 SCE Doc. 23563 Att. Contract No. 9.2324 (Formerly Contract No. L2845) Initial (_______)/(_______) Licensor/Licensee - 5 - Rev9 2023-03-08 JR-KB A D D E N D U M PARKING A. Vehicles parked on the Property are limited to those owned by Licensee and its employees, invitees, customers and visitors. Licensee will not allow the storage, repairing or refueling of any vehicles on the property. B. Licensor only allows overflow parking. No portion of the Property will be used to satisfy the minimum parking requirements of any government agency. C. Licensee must obtain prior written approval from Licensor for any vehicle parking improvements and/or subsequent modification. Licensee will maintain parking improvements at all times in a safe condition satisfactory to Licensor. D. At any time, Licensor may require removal, modification, or relocation of any portion of the parking improvements. At Licensee’s sole expense, Licensee will remove, modify, or relocate same to a location satisfactory to Licensor, within sixty (60) days after receiving notice to remove, modify, or relocate from Licensor. E. Parking will be permitted in designated areas only. Unless prior written approval is received from Licensor, no parking will be permitted under or within ten (10) feet of the “drip line” of Licensor's overhead electrical conductors. F. All parking spaces and parking improvements are to be identified on a site plan and submitted to Licensor to obtain prior written approval from Licensor. G. Bollards, K-rails, or “No Parking” striping may be required to protect Licensor’s structures or in areas where additional clearance is required. H. The Licensee’s parking area shall not interfere with the Licensor’s minimum access road requirements. . . Item 9 Page 19 of 19 City Council Agenda Report Meeting Date:March 19, 2024 From:Daniel S. Wall, P.E., Director of Public Works Department:Public Works Submitted by:Carlos Velazquez, Engineering Aid Subject Contract with Western Allied Corporation for City Hall HVAC System Improvements - Contract No. 20240089 Recommendation A. Find that the proposed action is categorically exempt from California Environmental Quality Act (CEQA) review, in accordance with CEQA Guidelines § 15301, because the project consists of the maintenance and minor alteration of the existing City Hall HVAC controls and system and involves negligible or no expansion of an existing use; B. Accept the bid proposal from Western Allied Corporation as the lowest responsive and responsible bidder and reject all other bids; C. Approve and authorize the City Administrator to execute a contract with Western Allied Corporation, in substantially the same form as submitted, for the City Hall HVAC System Improvements Project in an amount not-to-exceed $429,245; and D. Authorize a contingency amount of ten percent (10%) or $42,924.50 in the event of an unexpected changed condition in the project and grant authority to the City Administrator to issue change orders for an amount up to the contingency amount, if necessary. Background The existing HVAC system for City Hall was installed in the 1970’s and has not been replaced or modified. As a result, the air temperature does not circulate throughout the building, preventing the HVAC system from performing at its maximum capacity. In order to address this issue, the Public Works Department has solicited bids to make necessary HVAC system improvements that will include modifying the design and building a new retrofitted mixing box controller from the existing HVAC system. A total of 40 pneumatic mixing box controllers will be modified. Redesigning the existing HVAC controllers will monitor the temperature more efficiently and effectively by using the outside air to condition the entire building. Along with other minor modifications, new software floorplan graphics will be constructed to match the existing graphics in the HVAC system, making everything work as one. On October 6, 2023, staff advertised the Notice Inviting Bids (NIB) for Contract No. 20240089 City Hall HVAC System Improvements Project in accordance with Vernon Municipal Code Section 3.32.070 (A) for competitive bidding. The NIB was posted on the City’s Planet Bids website. The Department has utilized the template Notice Inviting Bids, Bid form and Project Specifications, Instruction to Bidders, and Specifications and Contract approved by City Council. The bids for Contract No. 20240089 City Hall HVAC System Improvements were received and opened on November 01, 2023. The calculated results were as follows: 1. Western Allied Corporation $429,245 2. F.M. Thomas, Air Conditioning Inc. $557,435 Staff reviewed the bids and deemed that the bid received by Western Allied Corporation was the lowest responsive and responsible bid. Based on a thorough bid evaluation, staff recommends the award of the proposed Purchase Contract to Western Allied Corporation. . . Item 10 Page 1 of 2 The proposed contract has been reviewed and approved as to form by the City Attorney’s Office. Fiscal Impact The fiscal impact is not-to-exceed $472,169.50, including a contingency amount of ten percent. Sufficient funds are available in the General Fund, Public Works Department, Facilities Maintenance Division, Capital Outlay Account No. 011-040-415-660000 for the current fiscal year. Attachments 1. Contract with Western Allied Corporation . . Item 10 Page 2 of 2 67$1'$5')2502) &216758&7,21&2175$&7%(7:((1 &,7<$1'&2175$&725 7KLV$JUHHPHQWLVPDGHDQGHQWHUHGLQWRDW9HUQRQ&DOLIRUQLDWKLV GD\RI E\ DQGEHWZHHQWKH&,7<2)9(5121D&DOLIRUQLDFKDUWHU&LW\DQGPXQLFLSDOFRUSRUDWLRQ KHUHLQDIWHU&LW\ DQG :HVWHUQ$OOLHG&RUSRUDWLRQ&DOLIRUQLD&RUSRUDWLRQ KHUHLQDIWHU &RQWUDFWRU IRUFRQVWUXFWLRQRI&LW\+DOO+9$&6\VWHP ,PSURYHPHQWV&RQWUDFW1R 7+(3$57,(6+(5(72$*5(($6)2//2:6 &2175$&7'2&80(176 7KH³&RQWUDFW'RFXPHQWV´H[FHSWIRUPRGLILFDWLRQVLVVXHGDIWHUH[HFXWLRQRIWKLV$JUHHPHQWVKDOOFRQVLVWRIWKH IROORZLQJGRFXPHQWVZKLFKDUHHLWKHUDWWDFKHGKHUHWRDVH[KLELWVRUDUHLQFRUSRUDWHGLQWRWKLV$JUHHPHQWE\WKLV UHIHUHQFHZLWKWKHVDPHIRUFHDQGHIIHFWDVLIVHWIRUWKDWOHQJWKKHUHLQ $ *RYHUQPHQWDO$SSURYDOVLQFOXGLQJEXWQRWOLPLWHGWRSHUPLWVUHTXLUHGIRUWKH:RUN % 7KLV$JUHHPHQW & ([KLELW$±*HQHUDO&RQGLWLRQV ' ([KLELW±3HUIRUPDQFH%RQG ( ([KLELW±3D\PHQW%RQG ) ([KLELW±0DLQWHQDQFH%RQG * ([KLELW±,QVXUDQFH5HTXLUHPHQW + ([KLELW±6WRUPZDWHURI,QWHQWWR&RPSO\ZLWK0LQLPXP5HTXLUHPHQWVRI6WRUPZDWHU3HUPLW , ([KLELW%±6SHFLDO3URYLVLRQV6SHFLILFIRUWKLV3URMHFW - ([KLELW&±(TXDO(PSOR\PHQW2SSRUWXQLW\3UDFWLFHV3URYLVLRQV . ([KLELW'±&LW\6WDQGDUG3ODQV / 1RWLFH,QYLWLQJ%LGV 0 ,QVWUXFWLRQVWR%LGGHUV 1 %LG)RUPV 2 'HVLJQDWLRQRI6XEFRQWUDFWRUV WK 0DUFK Western Allied Corporation Page 1 of 221 . . Item 10 Page 1 of 221 * +0(D #1 D 4;D D D )#D'.-4A+0(D#%$7#1 #D 4 >/#0<;D 7#D04=D 41;* #7# D 41=8 =D4 >/#0<;D 1!DA#7#D674@,"# D<4D=)#D 40<7 <47D%47D +1&57/ <*40 -D6>964;#;D 42<9 <49D/ BD:#.BD>641D=)#D=# )0* -D < D 40= *0# D+1D;? )D 4 >/#1=;D >=D14<D>640D041C =# )1* .D < D*1<#967#= =*40;D46*3+40;D47D674@*;+40 .D;< <#/#1<;D 41= +0# D<)#7#*0D * 0Nu NKTnVKGa=Nyu~LG NL9* + >NN~AVaW ;aGn9* >,:;.:/D:=5 DVTVnTN,un}GK ?VhNGnLOu}TNG NL,un }GK>hH_NK uGL^hNnTN~Nu GnLy}Gn uTN,un }GK -uKhNn TN,un ~GK u}TGbbyN}Ou}hGnLyuWLNGcbnNKNG} aGHu~"N}XKN" yN}WVun#hG N}VGa$ uub% N{WyhNn& GyyG}G & OGKVbV \N' yyaVN' uuc'yN}hV VnyNKVun ybGnKTNK` GnLVhWaG~ 0uN}nhNn Gd *yy}uGb( Niyu~G} WbW VN)VaWKunnNK Yun&GnL ~Gnyu}GVunnNKNG~ uKuhyfNNTNDu}`Wo}VKKvpOw}hV WT TN,un }GK -uKhNn Ox}! ,3?E1*662B*,>F>?.747;=:C.7.9?> ,:9?=*,?9u ?38./:=<.=/:=7*9,. ,un }GK?VhN ,un}GKu}TGagGKTWNN>H Gn WGa,uhybNVunuOTNDu}`V TVnTV}KGaNtMG~MG O}uhTN -GN uO,uhhNnKNhNnNGHbVTNLWn,V}V Nn9u WKNu;~uKNNM ,un }GK ?VhN H_NK u GL^hNnVnGKKu}LGnKNV TTN,un}GK -uKhNn,un }GKu}TGdbGKUWNN/VnGb,ujyaN VunuOTNDu~`VTVn TN VhNNGHaWTNLHTN,N} VOVKG NuP>H Gn VGb,uhyaN VunWNLH TN,W ?TN,un }GK?VhNhGunaHN GL^ NLGzN}hWNLHTV,un ~K Vun,un~GKGnLTN0NnN}Gb,unLWWun ?WhNWuOTNNNnKNuOTV*R}NNhNn .KNy TNnTN,un ~GK-uKhNn GNuTN}WN WhNVuO TNNNnKNWn TNyNOu~hGqKNuOTNDu~`,un ~GKu}GK`nubNLRNTG TN VhNbWhVGnLMNGLeZnNNOu}TWr TN,un}GK-uKhNnG}NNGunGINOx},un}GK u~uyN}Ou~kGnLKuhybN N TNDu~` V{VLG NL-GlGRN 3O,un ~GK u~OGVf uGKTWNN>H Gn VGb,uhyaNVunuOTNNnW~NDu~`VTVn TN ,un~GK?VmNOu}>H Gn VGc,ujybNVun,un ~GK u}TGaayG,VGbV|[LGNLMGhGSNTNGhun uOuTnL~NL GnLO]QLuabG~ yN}LGOw}NGKTKGbNnLG}LGuKK}}VnRGO N} TNNyV~GVunuO TN,un~GK@VhNOu} >J GnWGb,uhybNVunnWb,un}GKu}GKTVNN>HGnVGb,uhyaNVunuOTNNn V}NDu~` G}N{WNLH*} VKbNuO TN0NnN~Gb,unLV VusuO,un}GK ,un ~GK u}3nW WGaTN}N Western Allied Corporation Page 2 of 221 . . Item 10 Page 2 of 221 "2?>EB/2ECG= ;nOrn|PQxJ}rnrT}ZQ2rn}xJO}rx|Tjf OrlufQ}Q }^lQf JnPTJ_}ZTfuQxTrxkJnOQrT}ZQIrxdxQwxQPM }ZQ 2rn}xJO}3rOlQn}| 2} |ZJfiuJ 2ro}yJO}rx}ZQ|lrTTrxZnPxQP}Qn} n_nQ}Zr|JnP}r[nPxQP JnPTrx T_QPrffJx|nrOQn}| ! ' !" uJJMgQJ||Q}TtxZn}ZQ9QnQxJh2rnP`}_rn|2rn}xJO}ClE\QJO}JiPaxQO}Or|}rTJff@Qxl} 5QQ|_|QOiPQPTxrl}ZQ2rn}xJO}Cm ZrQQx2rn}xJO}rx|Or|}rTJPlna|}xJ}rnJnPOrrzPnJ}_rnrTJif 9rQxqlQn}Ji/uuxrJi|JnPH}ai} 6QQ|a|nOfPQPn}ZQ2rn}xJO}Cl # @4B=;E544B4;=1GBC4=4> ;nJOOrxPJnOQ} @JxJ WxJuZ rT}ZQ9QnQxJf2rnP }_rn| }ZQ2 } |ZJfixQalMx|Q2rn}xJO}rxVrx }ZQPrOlRn}QPJO}JiPxQO}Or|}rT@Qxla}7QQ| }]r}0 ifrJNfQ=Jxeu anJPP_}rn}ruJ lQn}rT}ZQ2rn}xJO} Cl <>I<E>4CCI:4B4?7 }ZQuJx}`Q|ZJQOJ|QP}Z|2rn}xJO}}rMQQQO}QP}ZQPJ}QJnP QJxTax|} JMrQxa}Qn 4QO}QPJ}DKp~K8QDv{bnX| 2JfaTrxnJ 2rn}xJO}rx|2rxurxJ}QCQJi 1 ( 0n/.-}ZrxQCWn @x_n}QP>JlQ( F}fQ) 3J}Q* @x_n}QP>J E }cQ+ 3J}Q, Western Allied Corporation Page 3 of 221 . . Item 10 Page 3 of 221 ! ! ! 6 <<< $-% < < '3,%< $3%< < < ! 6<! !"<#< $-%<(2$</0%< (3+% <)47<+%1*< !!! ! 6 ; $-% <$8.$&<</522$< (3+% <'49< 33/1.%:< ! ! ! ! ! Carlos Fandino &LW\$GPLQLVWUDWRU Western Allied Corporation Page 4 of 221 . . Item 10 Page 4 of 221 ! $)# T #$/ "#+. T%TQT &?&- ą A2ąà8µąą ą/R@ ąZá @Wą È$ąO É?O ąC A@R $ąX2ą ą+ 2ą/ą ą-ý +øąa ą$W× +ąÅ ą+8Z ą ąa ą $ą A^VÍ ą$ąö -gą +ąą ą`Æ?8Y $$hą ù 2ią ąC Y + ^2ą¾ąÇ ą-úÒ ñą ,ą 1Qąą#ąą ą"ąTą(S ] ą1 ąą"ąą % ą , ą #% ą3ą" "ą ąą, ą(][ą ą*Î,Ïąą#ą ą 33 ąbPą ą#ą ą Ê3 Bv ą Bþą¶ % Dą0ą ą" ą w âx (ãąB% ąą ą 0 _Óòąąä% jąåą ą ą _ą"XTą¿ą, *ąó ą f ą QDąb ąô ąËæ#0Hą #M"$ "M!$ M =G%CM I'20(M &3-+@91M >FM,4)MA:HLM M >56-DE.=;MM M LM?78MK/B*MJ<M M M -V7H EV.V 48?VI 1=V9UV ą ë Ãą ą<; 9ą&Lą)ą<;4 4Lą ą ą ,ąÀąą!ą/ą(/ąąą/ß ą ąąą.ą º rą ¡& ;!!ą# ąąąÂ Ðą ÑHą '(,'# :2>/J'5#VK$(FV)5"@2 L*:5V 5V M DV 0K AK(:5V: VK& V ;Q25NV:AV B QR0 5KV C PJ %3 6KV; VO%+GV!<D3VK:V 5VS5,5K 5 V:T25MV 6I4G:EL;DATD7T NL04965T D4O@6BMT RST &(ą ą & ąÁą:P\ą 55ąs·¢Ăt³uăĄk qeEm FFEn :*\Øą:õ}ąM=666£ą [" ąÛUąJą55¤ą¥ą ! Ä0ç% ą) ą& ą #ą9"1~ą¦>§''''>>¨6ą©ą 1F24<NP=6JT>0;@65T3PT*;8C6HK ! cą ÔIą Mąªą 7 ą)U? ąo ÿî ąą« ìèąG ąÕą . 1 .û 9÷ ąą * & ï»8 - ą ąKÙ$ í ) ą ¬''=ą ! ą ą4 Iąą® !( dą #ą ¯ąNą ą)SV*7ąG %ĀJą=°ąNą Üą < ąp Ö ¹ą Ú7 ą .1Ì.ü ą ą ą 0ą*ą &`´ - ąąKð C é )¼7 ! ąą4 ½ą±'ą² ā{yz|ą ą Ýê ą¸(Þą Western Allied Corporation Page 5 of 221 . . Item 10 Page 5 of 221 (;+,%,7$ *(1(5$/&21',7,216 ARTICLE 1 - PRELIMINARY PROVISIONS '(),1,7,216 7KHIROORZLQJZRUGVVKDOOKDYHWKHIROORZLQJPHDQLQJV $ $OORZDQFH$OLQHLWHPFRVWHVWLPDWHHVWDEOLVKHGE\WKH&LW\WREHFDUULHGLQWKH%DVH%LGVXP&RQWUDFW 6XPDQG6FKHGXOHRI9DOXHVIRU3D\PHQWIRUDSDUWLFXODULWHPRI:RUNZKLFKFDQQRWEHVXIILFLHQWO\ GHILQHGVRDVWRDOORZWKH&RQWUDFWRUWRDGHTXDWHO\GHWHUPLQHIDLUYDOXHEHIRUHWKH%LG'HDGOLQH $OORZDQFHVLQFOXGHHVWLPDWHGDPRXQWVHVWDEOLVKHGE\WKH&LW\IRUFHUWDLQFRQVWUXFWLRQHOHPHQWVWKDW KDYHQRW\HWEHHQIXOO\GHVLJQHGRUDXWKRUL]HGIRULQFOXVLRQLQWKH:RUNRUWRSHUPLWGHIHUUHGDSSURYDO RUVHOHFWLRQRIDFWXDOPDWHULDOVDQGHTXLSPHQWWRDODWHUGDWHZKHQDGGLWLRQDOLQIRUPDWLRQLVDYDLODEOH IRUHYDOXDWLRQ % $V%XLOWV 7KHGRFXPHQWVSUHSDUHGE\&RQWUDFWRUVKRZLQJWKHFRQGLWLRQRIWKH:RUNDVDFWXDOO\ EXLOWLQFOXGLQJZLWKRXWOLPLWDWLRQDOOFKDQJHVDQGWKHH[DFWORFDWLRQVRIDOOPHFKDQLFDOHOHFWULFDO SOXPELQJ+9$&RURWKHUSRUWLRQVRIWKH:RUNWKDWDUHVKRZQGLDJUDPPDWLFDOO\LQWKH&RQWUDFW 'RFXPHQWV & %DVH%LG7KHWRWDOVXPVWDWHGLQWKH%LG)RUPIRUZKLFKWKH%LGGHURIIHUVWRSHUIRUP:RUNGHVFULEHG LQWKH&RQWUDFW'RFXPHQWVDVWKHEDVH&RQWUDFW:RUN HJQRWGHVLJQDWHGDVSDUWRID%LG$OWHUQDWH ' %LG $FRPSOHWHDQGSURSHUO\H[HFXWHGRIIHUE\WKH%LGGHURQ&LW\SUHVFULEHGIRUPVWRSHUIRUPWKH :RUNIRUWKHSULFHVVWDWHGLQUHVSRQVHWRWKH1RWLFH,QYLWLQJ%LGV ( %LG$OWHUQDWH $QLWHPRI:RUNGHVFULEHGLQWKH&RQWUDFW'RFXPHQWVDVDQ$OWHUQDWH%LGWKDWZLOOEH DGGHGWRRUGHGXFWHGIURPWKH%DVH%LGDQGWKH&RQWUDFWRU¶VUHVSRQVLELOLW\RQO\LIWKH&LW\DFFHSWV WKH%LG$OWHUQDWH ) %LG)RUPV 7KH&LW\SUHVFULEHGIRUPVZKLFKWKH%LGGHUVKDOOFRPSOHWHDQGXVHWRVXEPLWD%LG7KH %LG)RUPVLQFOXGH %LGGHU¶V3URSRVDO 6FKHGXOHRI%LG3ULFHV ,QFXPEHQF\&HUWLILFDWH %LG%RQG %LGGHU¶V6WDWHPHQWRI4XDOLILFDWLRQV ([SHULHQFH)RUP 7UDGHV([SHULHQFH )RUP &RQWUDFWRU6DIHW\4XHVWLRQQDLUH 'HVLJQDWLRQRI6XEFRQWUDFWRUV $IILGDYLWRI1RQ &ROOXVLRQ ,QVXUDQFH 5HTXLUHPHQWV $IILGDYLW DQG IRUPV LQFOXGHG LQ WKH 6SHFLILFDWLRQ UHTXLUHGE\WKHW\SHRISURMHFWIXQGLQJ HJIHGHUDO$55$+8'HWF * %LGGHU 7KHLQGLYLGXDOSDUWQHUVKLSILUPFRUSRUDWLRQMRLQWYHQWXUHRURWKHUOHJDOHQWLW\VXEPLWWLQJDELG RQWKHVH&RQWUDFW'RFXPHQWVRUDQ\SDUWWKHUHRI + %LGGLQJ'RFXPHQWV%LGGLQJ'RFXPHQWVLQFOXGHWKH%LGGLQJ5HTXLUHPHQWVDQGWKHSURSRVHG&RQWUDFW 'RFXPHQWV7KH%LGGLQJ5HTXLUHPHQWVFRQVLVWRI 1RWLFH,QYLWLQJ%LGV ,QVWUXFWLRQVWR%LGGHUV DQG %LG)RUPV 7KHSURSRVHG&RQWUDFW'RFXPHQWVFRQVLVWRI WKH%LGGLQJ5HTXLUHPHQWV WKH&RQVWUXFWLRQ&RQWUDFW%HWZHHQ&LW\DQG&RQWUDFWRU WKH&RQGLWLRQVRIWKH&RQWUDFW *HQHUDO 6XSSOHPHQWDU\DQG6SHFLDOLIDSSOLFDEOH DOO([KLELWVWRWKH&RQWUDFW WKH'UDZLQJV WKH 6SHFLILFDWLRQV DOO$GGHQGDLVVXHGSULRUWRWKHH[HFXWLRQRIWKH&RQVWUXFWLRQ&RQWUDFW DOO 0RGLILFDWLRQVLVVXHGDIWHUWKHH[HFXWLRQRIWKH&RQVWUXFWLRQ&RQWUDFW DQG *RYHUQPHQWDO$SSURYDOV LIDQ\LQFOXGLQJEXWQRWOLPLWHGWRSHUPLWV Western Allied Corporation Page 6 of 221 . . Item 10 Page 6 of 221 , &KDQJH2UGHU$&KDQJH2UGHULVDZULWWHQGRFXPHQWSUHSDUHGE\WKH&LW\UHIOHFWLQJWKHDJUHHPHQW EHWZHHQWKH&LW\DQG&RQWUDFWRUIRU DFKDQJHLQWKHWHUPVRUFRQGLWLRQVRIWKH&RQWUDFWLIDQ\ D VSHFLILF6FRSH&KDQJHLQWKH:RUN WKHDPRXQWRIWKHDGMXVWPHQWLIDQ\LQWKH&RQWUDFW6XP DQG WKHH[WHQWRIWKHDGMXVWPHQWLIDQ\LQWKH&RQWUDFW7LPH - &KDQJH2UGHU5HTXHVW &25 $&KDQJH2UGHU5HTXHVWLVDZULWWHQGRFXPHQWRULJLQDWHGE\WKH &RQWUDFWRUZKLFKGHVFULEHVDQLQVWUXFWLRQLVVXHGE\WKH&LW\DIWHUWKHHIIHFWLYHGDWHRIWKH&RQWUDFW ZKLFK&RQWUDFWRUEHOLHYHVWREHDVFRSHFKDQJHWKDWPD\UHVXOWLQFKDQJHVWRWKH&RQWUDFW6XPRU &RQWUDFW7LPHRUZKLFKGHVFULEHVWKHQHHGIRURUGHVLUDELOLW\RIDFKDQJHLQWKH:RUNSURSRVHGE\ &RQWUDFWRU . &LW\RU2ZQHU 7KH&LW\RI9HUQRQ&DOLIRUQLDDFWLQJWKURXJKLWV&LW\&RXQFLORURWKHU&LW\RIILFLDOV DXWKRUL]HGWRDFWIRUWKH&LW\DFWLQJLQLWVSURSULHWDU\UDWKHUWKDQUHJXODWRU\FDSDFLW\LQFRQQHFWLRQZLWK WKH3URMHFW / &RQVWUXFWLRQ&KDQJH'LUHFWLYH$ZULWWHQRUGHUSUHSDUHGDQGVLJQHGE\WKH&LW\GLUHFWLQJDFKDQJHLQ :RUNSULRUWRDJUHHPHQWRQDGMXVWPHQWLIDQ\LQWKH&RQWUDFW6XPRU&RQWUDFW7LPHRUERWK 0 &RQWUDFW 'RFXPHQWV 7KH &RQWUDFW 'RFXPHQWV DUH HQXPHUDWHG LQWKH &RQVWUXFWLRQ &RQWUDFW EHWZHHQ&LW\DQG&RQWUDFWRUDQGFRQVLVWRI WKH%LGGLQJ5HTXLUHPHQWV WKH&RQVWUXFWLRQ &RQWUDFW WKH&RQGLWLRQVRIWKH&RQWUDFW *HQHUDO6XSSOHPHQWDU\DQG6SHFLDOLIDSSOLFDEOH DOO([KLELWVWRWKH&RQWUDFW WKH'UDZLQJV WKH6SHFLILFDWLRQV DOO$GGHQGDLVVXHGSULRUWRWKH H[HFXWLRQRIWKH&RQWUDFW DOO0RGLILFDWLRQVLVVXHGDIWHUWKHH[HFXWLRQRIWKH&RQWUDFW DQG *RYHUQPHQWDO$SSURYDOVLQFOXGLQJEXWQRWOLPLWHGWRSHUPLWV7KHLQWHQWRIWKH&RQWUDFW'RFXPHQWV LVWRLQFOXGHDOOLWHPVQHFHVVDU\IRUWKHSURSHUH[HFXWLRQDQGFRPSOHWLRQRIWKH:RUNE\WKH &RQWUDFWRU 7KH&RQWUDFW'RFXPHQWVDUHFRPSOHPHQWDU\DQGZKDWLVUHTXLUHGE\RQHVKDOOEHDV ELQGLQJDVLIUHTXLUHGE\DOO SHUIRUPDQFHE\WKH&RQWUDFWRUVKDOOEHUHTXLUHGWRWKHH[WHQWFRQVLVWHQW ZLWKWKH&RQWUDFW'RFXPHQWVDQGUHDVRQDEO\LQIHUDEOHIURPWKHPDVEHLQJQHFHVVDU\WRSURGXFHWKH LQGLFDWHGUHVXOWV 1 &RQWUDFW 7KH&RQWUDFW'RFXPHQWVIRUPWKH&RQWUDFWIRU&RQVWUXFWLRQ 7KH&RQWUDFW5HSUHVHQWV WKHHQWLUHDQGLQWHJUDWHGDJUHHPHQWEHWZHHQWKHSDUWLHVKHUHWRDQGVXSHUVHGHVSULRUQHJRWLDWLRQV UHSUHVHQWDWLRQVRUDJUHHPHQWVHLWKHUZULWWHQRURUDO 7KH&RQWUDFWPD\EHDPHQGHGRUPRGLILHG RQE\D0RGLILFDWLRQ 7KH&RQWUDFW'RFXPHQWVVKDOOQRWEHFRQVWUXHGWRFUHDWHDFRQWUDFWXDO UHODWLRQVKLSRIDQ\NLQGEHWZHHQDQ\SHUVRQVRUHQWLWLHVRWKHUWKDQWKH2ZQHUDQGWKH&RQWUDFWRU 7KHUHVKDOOEHQRWKLUGSDUW\EHQHILFLDULHVRIWKH&RQWUDFW'RFXPHQWV 2 &RQWUDFW6XP7KHWRWDODPRXQWRIFRPSHQVDWLRQVWDWHGLQWKH&RQVWUXFWLRQ&RQWUDFWWKDWLVSD\DEOH WR&RQWUDFWRUIRUWKHFRPSOHWHSHUIRUPDQFHRIWKH:RUNLQDFFRUGDQFHZLWKWKH&RQWUDFW'RFXPHQWV 3 &RQWUDFW 7LPH 7KH WRWDO QXPEHU RI GD\V VHW IRUWK LQ WKH &RQVWUXFWLRQ &RQWDFW ZLWKLQ ZKLFK 6XEVWDQWLDO&RPSOHWLRQRIWKH:RUNPXVWEHDFKLHYHGEHJLQQLQJZLWKWKH'DWHRI&RPPHQFHPHQW HVWDEOLVKHGLQWKH1RWLFHWR3URFHHGVXEMHFWWRDGMXVWPHQWVLQDFFRUGDQFHZLWKWKHWHUPVRIWKH &RQWUDFW'RFXPHQWV 7KH&RQWUDFW7LPHIRU&RQWUDFWRU VSHUIRUPDQFHRIWKH:RUNLVPHDVXUHGLQ FDOHQGDUGD\V QRWZRUNGD\V 4 &RQWUDFWRU7KHLQGLYLGXDOSDUWQHUVKLSILUPFRUSRUDWLRQMRLQWYHQWXUHRURWKHUOHJDOHQWLW\ZLWKZKRP WKH&RQWUDFWLVPDGHE\&LW\RUWKHDJHQWRUOHJDOUHSUHVHQWDWLYHZKRPD\EHDSSRLQWHGWRUHSUHVHQW VXFKLQGLYLGXDOSDUWQHUVKLSILUPFRUSRUDWLRQMRLQWYHQWXUHRURWKHUOHJDOHQWLW\LQWKHH[HFXWLRQRIWKH &RQWUDFWDVJHQHUDOFRQWUDFWRUIRUFRQVWUXFWLRQRIWKH:RUN Western Allied Corporation Page 7 of 221 . . Item 10 Page 7 of 221 5 &RUUHFWLRQ3HULRG &RUUHFWLRQ3HULRGLVV\QRQ\PRXVZLWKWKHWHUPVRIWKHFRUUHFWLRQJXDUDQWHHSHULRG XVHGLQWKH&RQWUDFW'RFXPHQWV 6 'DWHRI&RPPHQFHPHQW 7KHGDWHIRUFRPPHQFHPHQWRIWKH:RUNIL[HGE\&LW\LQD1RWLFHWR 3URFHHGWR&RQWUDFWRU 7 'D\ 7KHWHUPV³GD\´RU³GD\V´PHDQFDOHQGDUGD\VXQOHVVRWKHUZLVHVSHFLILFDOO\GHVLJQDWHGLQWKH &RQWUDFW'RFXPHQWV 7KHWHUP³:RUN'D\´RU³:RUNLQJ'D\´VKDOOPHDQDQ\FDOHQGDUGD\H[FHSW 6DWXUGD\V6XQGD\VDQG&LW\UHFRJQL]HGOHJDOKROLGD\V&LW\+ROLGD\VDUHDVIROORZV -DQXDU\VW±1HZ<HDU¶V'D\ 7KHUG0RQGD\LQ-DQXDU\±0DUWLQ/XWKHU.LQJ-U'D\ 7KHUG0RQGD\LQ)HEUXDU\±3UHVLGHQWV'D\ 0DUFKVW±&HVDU&KDYH]'D\ 7KHODVW0RQGD\LQ0D\±0HPRULDO'D\ -XO\WK±,QGHSHQGHQFH'D\ 7KHILUVW0RQGD\LQ6HSWHPEHU±/DERU'D\ 7KHVHFRQG0RQGD\LQ2FWREHU±,QGLJHQRXV3HRSOHV¶'D\ 1RYHPEHUWK±9HWHUDQV'D\ 7KHWK7KXUVGD\LQ1RYHPEHU±7KDQNVJLYLQJ'D\ 'HFHPEHUWK±&KULVWPDV(YH 'HFHPEHUWK±&KULVWPDV'D\ 'HFHPEHUVW±1HZ<HDU¶V(YH 8 'LUHFWRU7KH'LUHFWRURIWKH3XEOLF:RUNV'HSDUWPHQWRIWKH&LW\RI9HUQRQRUKLVKHUGXO\DSSRLQWHG UHSUHVHQWDWLYH 9 'UDZLQJV7KH'UDZLQJVDUHWKHJUDSKLFDQGSLFWRULDOSRUWLRQVRIWKH&RQWUDFW'RFXPHQWVVKRZLQJWKH GHVLJQORFDWLRQDQGGLPHQVLRQVRIWKH:RUNJHQHUDOO\LQFOXGLQJSODQVHOHYDWLRQVVHFWLRQVGHWDLOV VFKHGXOHVDQGGLDJUDPV : ([WUD:RUN 1HZRUXQIRUHVHHQZRUNZLOOEHFODVVLILHGDV([WUD:RUNZKHQGHWHUPLQHGE\WKH&LW\ WKDWWKHZRUNLVQRWGHVFULEHGLQRUUHDVRQDEO\LQIHUDEOHIURPWKH&RQWUDFW'RFXPHQWVWKHZRUNLV QRWFRYHUHGE\DQ\%LGOLQHLWHPRU$OORZDQFHDQGWKHZRUNFDXVHV&RQWUDFWRUWRLQFXUDGGLWLRQDO DQGXQIRUHVHHQFRVWV ; )LHOG'LUHFWLYH6HH³:RUN'LUHFWLYH´ < )LQDO&RPSOHWLRQ )LQDO&RPSOHWLRQLVWKHVWDJHRISHUIRUPDQFHRIWKH:RUNZKHQ DOO:RUN UHTXLUHGE\WKH&RQWUDFW'RFXPHQWVKDVEHHQIXOO\FRPSOHWHGLQFRPSOLDQFHZLWKWKH&RQWUDFW 'RFXPHQWVDQGDOODSSOLFDEOHODZVLQFOXGLQJEXWQRWOLPLWHGWRFRUUHFWLRQRUFRPSOHWLRQRIDOOSXQFK OLVW LWHPV QRWHG E\ &LW\ XSRQ 6XEVWDQWLDO &RPSOHWLRQ &RQWUDFWRU KDV GHOLYHUHG WR &LW\ DQ $SSOLFDWLRQIRU)LQDO3D\PHQWDQGDOOFORVHRXWGRFXPHQWDWLRQUHTXLUHGE\WKH&RQWUDFW'RFXPHQWV DQG GRFXPHQWDWLRQRIDOOILQDO*RYHUQPHQWDO$SSURYDOVKDVEHHQVXEPLWWHGWR&LW\LQFOXGLQJEXW QRWOLPLWHGWRDILQDO&HUWLILFDWHRI2FFXSDQF\RUHTXLYDOHQW%XLOGLQJ'HSDUWPHQWVLJQRIIKDVEHHQ LVVXHGFRYHULQJWKHHQWLUH3URMHFWVLWHZLWKRXWH[FHSWLRQRUFRQGLWLRQV = )RUFH0DMHXUH ³)RUFH0DMHXUH´LQFOXGHVEXWLVQRWOLPLWHGWRGHFODUHGRUXQGHFODUHGZDUVDERWDJH LQVXUUHFWLRQ ULRW RU RWKHU DFWV RI FLYLO GLVREHGLHQFH ODERUGLVSXWHV ILUHV H[SORVLRQV IORRGV HDUWKTXDNHVRURWKHUDFWVRI*RG Western Allied Corporation Page 8 of 221 . . Item 10 Page 8 of 221 $$ )UDJQHW7KHVHTXHQFHRIQHZDFWLYLWLHVWKDWDUHSURSRVHGWREHDGGHGWRDQH[LVWLQJVFKHGXOH %% *RYHUQPHQWDO$SSURYDO $Q\DSSURYDODXWKRUL]DWLRQLQVSHFWLRQFHUWLILFDWLRQFRQVHQWH[HPSWLRQ ILOLQJSHUPLWUHJLVWUDWLRQSODQFKHFNUXOLQJRUVLPLODUDXWKRUL]DWLRQUHTXLUHGE\DQ\IHGHUDOVWDWHRU ORFDOODZUHJXODWLRQRUSURFHGXUHVLQRUGHUIRU&RQWUDFWRUWRSHUIRUPWKH:RUN && *XDUDQWHH $VVXUDQFHWR&LW\E\&RQWUDFWRURUSURGXFWPDQXIDFWXUHURURWKHUVSHFLILHGSDUW\DV JXDUDQWRUWKDWWKHVSHFLILHGZDUUDQW\ZLOOEHIXOILOOHGE\WKHJXDUDQWRULQWKHHYHQWRIGHIDXOWE\WKH ZDUUDQWRU '' 0RGLILFDWLRQ $0RGLILFDWLRQLV DZULWWHQDPHQGPHQWWR&RQWUDFWVLJQHGE\ERWKSDUWLHV D &KDQJH2UGHU RU D&RQVWUXFWLRQ&KDQJH'LUHFWLYH (( 1RWLFHWR3URFHHG 7KH1RWLFHWR3URFHHGLVDGRFXPHQWLVVXHGE\WKH&LW\IL[LQJWKHGDWHIRU &RPPHQFHPHQWIRUWKH:RUN )) 3DUWLHV 7KH&LW\DQG&RQWUDFWRUPD\EHUHIHUUHGWRLQWKH&RQWUDFW'RFXPHQWVIURPWLPHWRWLPHDV WKH3DUWLHV ** 3HUPLW)HHV 7KHDFWXDOGLUHFWFRVWVSDLGE\&RQWUDFWRUIRU*RYHUQPHQWDO$SSURYDOVDQG8WLOLW\)HHV ++ 3HUPLW)HHV5HLPEXUVHPHQW$SD\PHQWPDGHWRWKH&RQWUDFWRUE\WKH&LW\LQDGGLWLRQWRWKH&RQWUDFW 6XPWRFRPSHQVDWH&RQWUDFWRUIRUWKHDFWXDOGLUHFWFRVWRIDOO3HUPLW)HHV ,, 3URMHFW 7KH3URMHFWLVWKHWRWDOFRQVWUXFWLRQRIZKLFKWKH:RUNSHUIRUPHGXQGHUWKH&RQWUDFW 'RFXPHQWVPD\EHWKHZKROHRUDSDUWDQGZKLFKPD\LQFOXGHFRQVWUXFWLRQE\WKH&LW\RUE\VHSDUDWH FRQWUDFWRUV -- 3URMHFW0DQXDO&RQWUDFW3DFNDJH 7KHYROXPHVRI&RQWUDFW'RFXPHQWVDQGUHIHUHQFHGRFXPHQWV DVVHPEOHGIRUWKH:RUNPDGHDYDLODEOHWR%LGGHUV .. 5HFRUG'RFXPHQWV 7KH'UDZLQJV6SHFLILFDWLRQVDGGHQGDUHTXHVWVIRULQIRUPDWLRQEXOOHWLQV &KDQJH2UGHUVDQGRWKHUPRGLILFDWLRQVWRWKH&RQWUDFW'RFXPHQWVDSSURYHGVKRSGUDZLQJV SURGXFWGDWDVDPSOHVPRFNXSVSHUPLWVLQVSHFWLRQUHSRUWVWHVWUHVXOWVGDLO\ORJVVFKHGXOHV VXEFRQWUDFWVDQGSXUFKDVHRUGHUV 5HFRUGV'RFXPHQWVVKDOOLQFOXGHDVHWRI³$V%XLOW´'UDZLQJV DQG6SHFLILFDWLRQVZKLFKVKDOOEHFRQWLQXRXVO\XSGDWHGGXULQJWKHSURVHFXWLRQRIWKH:RUN // 6LWH 7KHSK\VLFDODUHDGHVLJQDWHGLQWKH&RQWUDFW'RFXPHQWVIRU&RQWUDFWRU VSHUIRUPDQFHRIWKH :RUN 00 6SHFLILFDWLRQV 7KH6SHFLILFDWLRQVDUHWKHYROXPH V DVVHPEOHGIRUWKH:RUNWKDWLQFOXGHVZLWKRXW OLPLWDWLRQWKH%LGGLQJ'RFXPHQWVWKH&RQVWUXFWLRQ&RQWUDFWDQG([KLELWVWKH*HQHUDO&RQGLWLRQV 6XSSOHPHQWDU\ DQGRU 6SHFLDO &RQGLWLRQV LI DQ\ WKH ³*5((1%22.´ 67$1'$5' 63(&,),&$7,216)2538%/,&:25.6&216758&7,21 (GLWLRQ WKH6WDQGDUG3ODQVIRU 3XEOLF:RUNV&RQVWUXFWLRQ (GLWLRQ 6WDWHRI&DOLIRUQLD'HSDUWPHQWRI7UDQVSRUWDWLRQ6WDQGDUG 3ODQV (GLWLRQ DQG6WDWHRI&DOLIRUQLD'HSDUWPHQWRI7UDQVSRUWDWLRQ6WDQGDUG6SHFLILFDWLRQV (GLWLRQ DQGWKH&LW\RI9HUQRQ6WDQGDUG3ODQV 11 6SHFLILFDWLRQV 7KH6SHFLILFDWLRQVDUHWKDWSRUWLRQRIWKH&RQWUDFW'RFXPHQWVFRQVLVWLQJRIWKH ZULWWHQUHTXLUHPHQWVIRUPDWHULDOVHTXLSPHQWV\VWHPVVWDQGDUGVDQGZRUNPDQVKLSIRUWKH:RUN Western Allied Corporation Page 9 of 221 . . Item 10 Page 9 of 221 DQG SHUIRUPDQFH RI UHODWHG VHUYLFHV LQFOXGLQJ EXW QRW OLPLWHGWRWKH3URMHFW7HFKQLFDO 6SHFLILFDWLRQV6WDQGDUG6SHFLILFDWLRQVLIDQ\DQGDQ\DSSOLFDEOH7UDGH$VVRFLDWLRQ6SHFLILFDWLRQV 22 6XEVWDQWLDO&RPSOHWLRQ 6XEVWDQWLDO&RPSOHWLRQLVGHILQHGWRPHDQWKHVWDJHLQWKHSURJUHVVRIWKH :RUN ZKHQ WKH :RUN LVVXIILFLHQWO\ FRPSOHWH LQ DFFRUGDQFH ZLWKWKH &RQWUDFW 'RFXPHQWV DV GHWHUPLQHGE\WKH&LW\VRWKDWWKH&LW\FDQRFFXS\DQGXWLOL]HWKH:RUNIRULWVLQWHQGHGXVHDQGDV IXUWKHUGHILQHGLQWKH&RQWUDFW'RFXPHQWV 33 8QLODWHUDO&KDQJH2UGHU 6HH³:RUN'LUHFWLYH´ 44 8WLOLW\)HHV7KHIHHVFKDUJHGE\DQ\SXEOLFSULYDWHFRRSHUDWLYHPXQLFLSDODQGRUJRYHUQPHQWOLQH IDFLOLW\RUV\VWHPXVHGIRUWKHFDUULDJHWUDQVPLVVLRQDQGRUGLVWULEXWLRQRIFDEOHWHOHYLVLRQHOHFWULF SRZHUWHOHSKRQHZDWHUJDVRLOSHWUROHXPVWHDPFKHPLFDOVVHZDJHVWRUPZDWHURUVLPLODU FRPPRGLW\LQFOXGLQJEXWQRWOLPLWHGWRIHHVIRUWHPSRUDU\XWLOLWLHVDQGUHIXVHKDXOLQJ 55 :DUUDQW\$VVXUDQFHWR&LW\E\FRQWUDFWRULQVWDOOHUVXSSOLHUPDQXIDFWXUHURURWKHUSDUW\UHVSRQVLEOH DVZDUUDQWRUIRUWKHTXDQWLW\TXDOLW\SHUIRUPDQFHDQGRWKHUUHSUHVHQWDWLRQVRIDSURGXFWV\VWHP VHUYLFHRIWKH:RUN 66 :RUN 7KHWHUP:RUNPHDQVWKHFRQVWUXFWLRQDQGRWKHUVHUYLFHVUHTXLUHGE\DQGUHDVRQDEO\ LQIHUDEOHIURPWKH&RQWUDFW'RFXPHQWVZKHWKHUFRPSOHWHGRUSDUWLDOO\FRPSOHWHGDQGLQFOXGHVDOO RWKHUODERUPDWHULDOVHTXLSPHQWDQGVHUYLFHVSURYLGHGRUWREHSURYLGHGE\WKH&RQWUDFWRUWRIXOILOO WKH&RQWUDFWRU VREOLJDWLRQV7KH:RUNPD\FRQVWLWXWHWKHZKROHRUDSDUWRIWKH3URMHFW 77 :RUN'LUHFWLYH $:RUN'LUHFWLYHLVDXQLODWHUDOZULWWHQRUGHULVVXHGE\WKH&LW\GLUHFWLQJ&RQWUDFWRU WRFRQWLQXHSHUIRUPDQFHRIWKH:RUNRUWRSHUIRUPDGLVSXWHGFKDQJHLQWKH:RUNSULRUWRDJUHHPHQW RUDGMXVWPHQWLIDQ\LQWKH&RQWUDFW6XP&RQWUDFW7LPHRUERWK 5(35(6(17$7,9(6 $ 7KH'LUHFWRUVKDOOEHWKHUHSUHVHQWDWLYHRIWKH&LW\DQGH[FHSWDVRWKHUZLVHH[SUHVVO\SURYLGHG KHUHLQVKDOOPDNHDOOGHFLVLRQVDQGLQWHUSUHWDWLRQVWREHPDGHE\WKH&LW\XQGHUWKHSURYLVLRQVRIWKH &RQWUDFW'RFXPHQWV % 7KH&RQWUDFWRUVKDOODWDOOWLPHVEHUHSUHVHQWHGRQWKH:RUNLQSHUVRQRUE\DGXO\GHVLJQDWHGDJHQW ,QVWUXFWLRQVDQGLQIRUPDWLRQJLYHQE\WKH'LUHFWRUWRWKH&RQWUDFWRU VDJHQWRQWKH:RUNVKDOOEH FRQVLGHUHGDVKDYLQJEHHQJLYHQWRWKH&RQWUDFWRU 3(50,76 ,163(&7,216 3/$1 &+(&.6 $1' 6,0,/$5 *29(510(17$/ $33529$/6 $1' 87,/,7,(6 $ ([FHSWDVRWKHUZLVHSURYLGHGLQWKH1RWLFH,QYLWLQJ%LGVWKH&RQWUDFWRUVKDOODSSO\IRUREWDLQDQGSD\ IRUDOOSHUPLWV LQFOXGLQJEXWQRWOLPLWHGWREXLOGLQJRUVWUXFWXUHSHUPLWVSOXPELQJV\VWHPSHUPLWV PHFKDQLFDOV\VWHPSHUPLWVHOHFWULFDOV\VWHPSHUPLWVVWUXFWXUDOV\VWHPSHUPLWVGHPROLWLRQSHUPLWV H[FDYDWLRQSHUPLWVVWUHHWXVHSHUPLWVGULYHZD\SHUPLWVVLGHZDONFXUEVHZHUJXWWHUFURVVZDON SDYLQJRURWKHUVWUHHWZRUNJUDGLQJSHUPLWVVWUHHWXWLOLW\XVHSHUPLWV26+$SHUPLWVILUHVSULQNOHU SHUPLWVIHQFHSHUPLWVEODVWLQJSHUPLWVODQGVFDSLQJLUULJDWLRQSHUPLWVDQGSHUPLWVWRGHPROLVK UHPRYHRUPDNHPDMRUDOWHUDWLRQVWRDQ\GHVLJQDWHGKLVWRULFUHVRXUFH LQVSHFWLRQV DQGSODQFKHFNV REWDLQHGDIWHUWKH'DWHRI&RPPHQFHPHQWRIWKH:RUN 7KH1RWLFH,QYLWLQJ%LGVFRQWDLQVDOLVWRI SHUPLWVDQGRWKHU*RYHUQPHQWDO$SSURYDOVDQG8WLOLW\)HHVREWDLQHGDQGSDLGIRUE\WKH&LW\SULRUWR WKH'DWHRI&RPPHQFHPHQW &RQWUDFWRULVUHVSRQVLEOHIRUREWDLQLQJDOO*RYHUQPHQWDO$SSURYDOVDQG Western Allied Corporation Page 10 of 221 . . Item 10 Page 10 of 221 8WLOLW\)HHVQRWOLVWHGLQWKH1RWLFH,QYLWLQJ%LGV % &RQWUDFWRUVKDOOREWDLQDQRIHHHQFURDFKPHQWSHUPLWIURPWKH&LW\RI9HUQRQ¶V3XEOLF:RUNV 'HSDUWPHQW & $OOGRFXPHQWVHYLGHQFLQJ&RQWUDFWRU¶VVDWLVIDFWLRQZLWKDOO*RYHUQPHQWDO$SSURYDOVDQG8WLOLW\)HHV PXVWEHVXEPLWWHGWRWKH&LW\SULRUWRVXEPLVVLRQRIWKH$SSOLFDWLRQIRU)LQDO3D\PHQW ' :KHUH UHTXLUHPHQWV RI WKH *RYHUQPHQWDO $SSURYDOV GLIIHU IURPWKRVH RI WKH 'UDZLQJV DQG 6SHFLILFDWLRQVWKHPRUHVWULQJHQWUHTXLUHPHQWVVKDOODSSO\ ( 8QOHVVRWKHUZLVHVSHFLILHGLQWKH&RQWUDFW'RFXPHQWV&RQWUDFWRUVKDOOEHUHVSRQVLEOHIRUSD\PHQWV RIDOO8WLOLW\)HHVIURPWKH'DWHRI&RPPHQFHPHQWXQWLO&LW\¶V)LQDO$FFHSWDQFHRIWKH:RUN /,&(16(6 7KH&RQWUDFWRUVKDOODSSO\IRUREWDLQDQGSD\IRUDOOOLFHQVHVUHTXLUHGE\JRYHUQLQJDXWKRULWLHVIRUWKH:RUN &RQWUDFWRUVKDOODSSO\DQGSD\IRUD&LW\RI9HUQRQEXVLQHVVOLFHQVH $//2:$1&(6 $ &RQWUDFWRUVKDOOLQFOXGHLQWKH&RQWUDFW6XPDQG6FKHGXOHRI9DOXHVIRU3D\PHQWWKH&LW\¶VHVWLPDWHG FRVWHVWDEOLVKHGIRUHDFK:RUNLWHPFRYHUHGE\DQ$OORZDQFHVWD WHGLQWKH&RQWUDFW'RFXPHQWV6HH 3DUDJUDSKIRUGHILQLWLRQRI$OORZDQFH % 7KHOLQHLWHPFRVWHVWLPDWHHVWDEOLVKHGE\WKH&LW\IRU:RUNFRYHUHGE\DQ$OORZDQFHLQFOXGHVWKHFRVW WR&RQWUDFWRURI DOOPDWHULDOVDQGHTXLSPHQWSUHSDUDWLRQRIVXEPLWWDOV ODERU WUDQVSRUWDWLRQ GHOLYHU\ KDQGOLQJ LQVWDOODWLRQ VXSHUYLVLRQ RYHUKHDG SURILW OLFHQVHV ERQGV LQVXUDQFH DOOVDOHVXVHDQGRWKHU WD[HVOHJDOO\FKDUJHDEOH DQGDOORWKHUFRVWVDQGH[SHQVHVLQFLGHQWDOWRVXFK:RUN & :RUNLWHPVFRYHUHGE\$OORZDQFHVVKDOOEHVXSSOLHGZLWKVXFKPDWHULDOVDQGHTXLSPHQWDQGIRUVXFK SULFHVDSSURYHGLQDGYDQFHE\&LW\ &RQWUDFWRUVKDOOQRWLI\DQGUHTXHVW&LW\¶VDSSURYDORIPDWHULDO HTXLSPHQWDQGSULFLQJLQIRUPDWLRQIRU:RUNFRYHUHGE\DQ$OORZDQFHEHIRUHRUGHULQJWKHPDWHULDORU HTXLSPHQWDQGLQVXIILFLHQWWLPHWRDYRLGGHOD\WRWKH:RUN &LW\VKDOOSURYLGHDSSURYDORIPDWHULDOV HTXLSPHQWDQGSULFHVZLWKUHDVRQDEOHSURPSWQHVV7KHPDWHULDOHTXLSPHQWDQGSULFLQJLQIRUPDWLRQ VXEPLWWHGE\WKH&RQWUDFWRUWRWKH&LW\¶V3URMHFW0DQDJHUVKDOODWDPLQLPXPLQFOXGHSURGXFWGDWD DQGGHWDLOHGFRVWVRIPDWHULDOHTXLSPHQWDQGODERUWRFRPSOHWHVXFK:RUNLWHPL]HGE\FRVWVLQFXUUHG E\&RQWUDFWRUDQGHDFKVXEFRQWUDFWRUDVVRFLDWHGZLWKWKHSHUIRUPDQFHRIVXFK:RUN &RQWUDFWRUVKDOO QRWRUGHUPDWHULDOVRUHTXLSPHQWRUSURFHHGZLWK:RUNFRYHUHGE\DQ$OORZDQFHXQWLOWKHPDWHULDO HTXLSPHQWDQGSULFLQJLQIRUPDWLRQIRUVXFK:RUNLWHPVKDYHEHHQVXEPLWWHGWRWKH&LW\¶V3URMHFW 5HSUHVHQWDWLYHIRUUHYLHZDQGWKH&RQWUDFWRUKDVUHFHLYHG&LW\¶VDSSURYDOWRSURFHHGZLWKD:RUNLWHP FRYHUHGE\DQ$OORZDQFH ' $OOH[SHQGLWXUHVIRU$OORZDQFH:RUNVKDOOEHVHSDUDWHO\LWHPL]HGLQHDFK$SSOLFDWLRQIRU3D\PHQW ( 7RWKHH[WHQWWKDWWKHFRVWRI:RUNLWHPVFRYHUHGE\DQ$OORZDQFHLVOHVVWKDQWKH$OORZDQFHFRVW HVWLPDWHHVWDEOLVKHGE\WKH&LW\WKH&RQWDFW6XPVKDOOEHUHGXFHGE\&KDQJH2UGHURU&RQVWUXFWLRQ &KDQJH'LUHFWLYHWRUHIOHFWWKHDFWXDOFRVWRIWKH$OORZDQFHLWHP 6LPLODUO\WRWKHH[WHQWWKHFRVWRI :RUNLWHPVFRYHUHGE\DQ$OORZDQFHLVJUHDWHUWKDQWKH$OORZDQFHFRVWHVWLPDWHWKH&RQWUDFW6XP VKDOOEHLQFUHDVHGE\&KDQJH2UGHURU&RQVWUXFWLRQ&KDQJH'LUHFWLYHWRUHIOHFWWKHDFWXDOFRVWRIWKH $OORZDQFHLWHP,I:RUNLWHPVFRYHUHGE\DQ$OORZDQFHDUHQRWSHUIRUPHGRUWKH&LW\GHOHWHVVXFK Western Allied Corporation Page 11 of 221 . . Item 10 Page 11 of 221 :$,9(5 LWHPVIURPWKH6FRSHRI:RUNWKH&RQWUDFW6XPVKDOOEHUHGXFHGE\&KDQJH2UGHURU&RQVWUXFWLRQ &KDQJH'LUHFWLYHWRGHGXFWWKH&RVWRIWKHXQXVHG$OORZDQFHLWHP $ZDLYHUE\&LW\RIDQ\EUHDFKRIDQ\WHUPFRYHQDQWRUFRQGLWLRQFRQWDLQHGLQWKH&RQWUDFW'RFXPHQWVVKDOO QRWEHGHHPHGWREHDZDLYHURIDQ\VXEVHTXHQWEUHDFKRIWKHVDPHRUDQ\RWKHUWHUPFRYHQDQWRUFRQGLWLRQ FRQWDLQHGWKHUHLQZKHWKHURIWKHVDPHRUDGLIIHUHQWFKDUDFWHU '$7$72%()851,6+('%<7+(&2175$&725 7KH&RQWUDFWRUVKDOOIXUQLVKWKH'LUHFWRUZLWKVXFKLQIRUPDWLRQDVWKH'LUHFWRUPD\GHVLUHUHVSHFWLQJWKH FKDUDFWHURIWKHPDWHULDOVDQGWKHSURJUHVVDQGPDQQHURIWKH:RUNLQFOXGLQJDOOLQIRUPDWLRQQHFHVVDU\WR GHWHUPLQHWKH&RQWUDFWRU¶VFRVWVVXFKDVWKHQXPEHURISHUVRQVHPSOR\HGWKHLUSD\WKHWLPHGXULQJZKLFK WKH\ZRUNHGRQWKHYDULRXVFODVVHVRIFRQVWUXFWLRQDQGRWKHUSHUWLQHQWGDWD &2175$&7'5$:,1*6 7KH&LW\ZLOODFFHSWQRUHVSRQVLELOLW\IRUHUURUVUHVXOWLQJIURPPLVLQWHUSUHWDWLRQRUVFDOLQJRIWKH'UDZLQJV 63(&,),&$7,216$1''5$:,1*6 $ 7KH&RQWUDFWRUVKDOONHHSRQWKH:RUN6LWHDFRS\RIDOO6SHFLILFDWLRQV'UDZLQJVDQG&KDQJH 2UGHUVSHUWDLQLQJWRWKH:RUNDQGVKDOODWDOOWLPHVJLYHWKH'LUHFWRUDFFHVVWKHUHWR $Q\WKLQJ PHQWLRQHGLQWKH6SHFLILFDWLRQVDQGQRWVKRZQRQWKH'UDZLQJVRUVKRZQRQWKH'UDZLQJVDQGQRW PHQWLRQHGLQWKH6SHFLILFDWLRQVVKDOOEHRIOLNHHIIHFWDVWKRXJKVKRZQRUPHQWLRQHGLQERWK % ,Q JHQHUDO WKH 'UDZLQJV ZLOO VKRZ GLPHQVLRQV SRVLWLRQV DQGNLQGRIFRQVWUXFWLRQ DQGWKH 6SHFLILFDWLRQVZLOOGHILQHPDWHULDOVTXDOLW\DQGVWDQGDUGV $Q\:RUNQRWSDUWLFXODUO\GHWDLOHG PDUNHGRUVSHFLILHGVKDOOEHWKHVDPHDVVLPLODUSDUWVWKDWDUHGHWDLOHGPDUNHGRUVSHFLILHG & 7KH'UDZLQJVVKDOOQRWEHVFDOHGWRGHWHUPLQHGLPHQVLRQVDQGLQDOOFDVHVVKDOOEHFDOFXODWHGIURP ILJXUHVVKRZQRQWKH'UDZLQJV $Q\GLVFUHSDQFLHVEHWZHHQVFDOHDQGILJXUHGGLPHQVLRQVQRW PDUNHG³QRWWRVFDOH´PXVWEHEURXJKWWRWKH'LUHFWRU¶VDWWHQWLRQEHIRUHSURFHHGLQJZLWKWKH:RUN DIIHFWHGE\WKHGLVFUHSDQF\ ' 2PLVVLRQV IURP WKH 'UDZLQJV DQGRU 6SHFLILFDWLRQV VKDOO QRW UHOLHYH WKH &RQWUDFWRU IURP WKH UHVSRQVLELOLW\ RI IXUQLVKLQJ PDNLQJ RU LQVWDOOLQJ DOO LWHPV UHTXLUHG E\ ODZ RU FRGH RU XVXDOO\ IXUQLVKHGPDGHRULQVWDOOHGLQDSURMHFWRIWKHVFRSHDQGJHQHUDOFKDUDFWHULQGLFDWHGE\WKH'UDZLQJV DQG6SHFLILFDWLRQV ( )RUFRQYHQLHQFHWKH'UDZLQJVDQG6SHFLILFDWLRQVPD\EHDUUDQJHGLQYDULRXVWUDGHVXESDUDJUDSKV EXWVXFKVHJUHJDWLRQVKDOOQRWEHFRQVLGHUHGDVOLPLWLQJWKH:RUNRIDQ\VXEFRQWUDFWRUWUDGH7KH &RQWUDFWRUVKDOOEHVROHO\UHVSRQVLEOHIRUDOOVXEFRQWUDFWDUUDQJHPHQWVRIWKH:RUNUHJDUGOHVVRIWKH ORFDWLRQRUSURYLVLRQLQWKH'UDZLQJVDQG6SHFLILFDWLRQV ) 7KH&LW\ZLOOIXUQLVKIUHHRIFKDUJHWRWKH&RQWUDFWRUDPD[LPXPRIVL[ VHWVRI&RQWUDFW'UDZLQJV DQG6SHFLILFDWLRQV 7KH&RQWUDFWRUVKDOOSD\IRUWKHFRVWVRIDQ\DGGLWLRQDOVHWVRUSRUWLRQVWKHUHRI 7KH&RQWUDFWRUVKDOOEHUHVSRQVLEOHWRVHHWKDWDOOVHWVDUHWKHVDPHDVWKHXSWRGDWHDSSURYHGVHW Western Allied Corporation Page 12 of 221 . . Item 10 Page 12 of 221 35(&('(1&(2)&2175$&7'2&80(176 $ ,QWKHHYHQWRIFRQIOLFWEHWZHHQDQ\RIWKH&RQWUDFW'RFXPHQWVWKHSURYLVLRQVSODFLQJDPRUH VWULQJHQWUHTXLUHPHQWRQWKH&RQWUDFWRUVKDOOSUHYDLO7KH&RQWUDFWRUVKDOOSURYLGHWKHEHWWHUTXDOLW\ RUJUHDWHUTXDQWLW\RI:RUNDQGRUPDWHULDOVXQOHVVRWKHUZLVHGLUHFWHGE\&LW\LQZULWLQJ,QWKHHYHQW QRQHRIWKH&RQWUDFW'RFXPHQWVSODFHDPRUHVWULQJHQWUHTXLUHPHQWRUJUHDWHUEXUGHQRQWKH &RQWUDFWRUWKHFRQWUROOLQJSURYLVLRQVKDOOEHWKDWZKLFKLVIRXQGLQWKHGRFXPHQWZLWKKLJKHU SUHFHGHQFHLQDFFRUGDQFHZLWKWKHIROORZLQJRUGHURISUHFHGHQFH *RYHUQPHQWDO$SSURYDOVLQFOXGLQJEXWQRWOLPLWHGWRSHUPLWVUHTXLUHGIRUWKH:RUN 0RGLILFDWLRQVLVVXHGDIWHUH[HFXWLRQRIWKH&RQWUDFW LQFOXGLQJPRGLILFDWLRQVWR'UDZLQJV DQG6SHFLILFDWLRQV 7KH&RQWUDFWLQFOXGLQJDOOH[KLELWVDWWDFKPHQWVDSSHQGLFHVDQG$GGHQGDZLWKODWHU $GGHQGDKDYLQJSUHFHGHQFHRYHUHDUOLHU$GGHQGD 6SHFLDO&RQGLWLRQVLIDQ\ *HQHUDO&RQGLWLRQV 6SHFLILFDWLRQV 'UDZLQJV %LGGLQJ5HTXLUHPHQWV % :LWKUHIHUHQFHWRWKH'UDZLQJVWKHRUGHURISUHFHGHQFHLVDVIROORZV &KDQJH2UGHU'UDZLQJV $GGHQGD'UDZLQJV &RQWUDFW'UDZLQJV 3URMHFW'UDZLQJV 6WDQGDUG'UDZLQJV 'HWDLO'UDZLQJV *HQHUDO'UDZLQJV )LJXUHV 6FDOHGGLPHQVLRQV & :LWKLQWKH6SHFLILFDWLRQVWKHRUGHURISUHFHGHQFHLVDVIROORZV &KDQJH2UGHUV 6SHFLDO&RQGLWLRQV 3URMHFW7HFKQLFDO6SHFLILFDWLRQV 6WDQGDUG6SHFLILFDWLRQVLIDQ\ $SSOLFDEOH7UDGH$VVRFLDWLRQ6SHFLILFDWLRQV 127,&(2)&21)/,&76 ,IWKH&RQWUDFWRULQWKHFRXUVHRIWKH:RUNEHFRPHVDZDUHRIDQ\FODLPHGFRQIOLFWVHUURUVRURPLVVLRQVLQ WKH&RQWUDFW'RFXPHQWVRULQWKH&LW\ VILHOGZRUNRUZRUNRI&LW\ VVHSDUDWHFRQWUDFWRUVWKH&RQWUDFWRUVKDOO LPPHGLDWHO\QRWLI\WKH'LUHFWRULQZULWLQJ7KH'LUHFWRUVKDOOSURPSWO\UHYLHZWKHPDWWHUDQGLIWKH'LUHFWRU ILQGVDFRQIOLFWHUURURURPLVVLRQWKH'LUHFWRUVKDOOGHWHUPLQHWKHFRUUHFWLYHDFWLRQVDQGDGYLVHWKH&RQWUDFWRU DFFRUGLQJO\,IWKHFRUUHFWLRQDVVRFLDWHGZLWKDFRQIOLFWHUURURURPLVVLRQLQFUHDVHVRUGHFUHDVHVWKHDPRXQW RI:RUNFDOOHGIRULQWKH&RQWUDFWWKH&LW\VKDOOLVVXHDQDSSURSULDWH&KDQJH2UGHULQDFFRUGDQFHZLWKWKH &RQWUDFW'RFXPHQWV$IWHUGLVFRYHU\RIDQHUURURURPLVVLRQE\WKH&RQWUDFWRUDQ\UHODWHGDGGLWLRQDOZRUN SHUIRUPHGE\WKH&RQWUDFWRUVKDOOEHGRQHDWWKH&RQWUDFWRU VULVNXQOHVVDXWKRUL]HGE\WKH'LUHFWRU Western Allied Corporation Page 13 of 221 . . Item 10 Page 13 of 221 5(32576 $ 'DLO\&RQVWUXFWLRQ5HSRUWV 7KH&RQWUDFWRUVKDOOSUHSDUHDGDLO\FRQVWUXFWLRQUHSRUWUHFRUGLQJWKH IROORZLQJLQIRUPDWLRQFRQFHUQLQJHYHQWVDW3URMHFWVLWH /LVWRI6XEFRQWUDFWRUVDW3URMHFWVLWH /LVWRIRWKHUFRQWUDFWRUVDW3URMHFWVLWH $SSUR[LPDWHFRXQWRISHUVRQQHODW3URMHFWVLWH (TXLSPHQWDW3URMHFWVLWH 0DWHULDOGHOLYHULHV +LJKDQGORZWHPSHUDWXUHVDQGJHQHUDOZHDWKHUFRQGLWLRQVLQFOXGLQJSUHVHQFHRIUDLQRU VQRZ $FFLGHQWV 0HHWLQJVDQGVLJQLILFDQWGHFLVLRQV 8QXVXDOHYHQWV 6WRSSDJHVGHOD\VVKRUWDJHVDQGORVVHV 0HWHUUHDGLQJVDQGVLPLODUUHFRUGLQJV (PHUJHQF\SURFHGXUHV 2UGHUVDQGUHTXHVWVRIDXWKRULWLHVKDYLQJMXULVGLFWLRQ &KDQJH2UGHUVUHFHLYHGDQGLPSOHPHQWHG &RQVWUXFWLRQ&KDQJH'LUHFWLYHVUHFHLYHGDQGLPSOHPHQWHG 6HUYLFHVFRQQHFWHGDQGGLVFRQQHFWHG (TXLSPHQWRUV\VWHPWHVWVDQGVWDUWXSV 3DUWLDOFRPSOHWLRQVDQGRFFXSDQFLHV 6XEVWDQWLDO&RPSOHWLRQVDXWKRUL]HG /LVWRIYLVLWRUVWR3URMHFW6LWH /LVWRISHUVRQQHODW3URMHFW6LWHLQFOXGLQJQDPHVDQGMREFODVVLILFDWLRQV 'HVFULSWLRQRI:RUNIRUWKHGD\LQFOXGLQJORFDWLRQVTXDQWLWLHVDQGUHODWHGELGLWHPV ,PPHGLDWHO\XSRQGLVFRYHU\RIDGLIIHUHQFHEHWZHHQILHOGFRQGLWLRQVDQGWKH&RQWUDFW'RFXPHQWVWKH &RQWUDFWRUVKDOOSUHSDUHDQGVXEPLWDGHWDLOHGUHSRUWWKURXJKD5HTXHVWIRU,QIRUPDWLRQ 5), ,QFOXGHD GHWDLOHGGHVFULSWLRQRIWKHGLIIHULQJFRQGLWLRQVWRJHWKHUZLWKUHFRPPHQGDWLRQVIRUDUHPHG\ 7KH'DLO\&RQVWUXFWLRQ5HSRUWPXVWEH VLJQHGE\&RQWUDFWRU¶V6XSHULQWHQGHQWVXEPLWWHGZLWKLQKRXUV QH[W:RUNLQJ'D\ WRWKH'LUHFWRUDQGVKDOOEHPDGHDYDLODEOHWRRWKHUVDVGLUHFWHGE\&LW\ /,1(6*5$'(6$1'0($685(0(176 $ $OOOLQHVDQGJUDGHVZLOOEHHVWDEOLVKHGE\WKH&RQWUDFWRU7KH&RQWUDFWRUVVKDOOFDUHIXOO\SUHVHUYHDOO VXUYH\VWDNHVDQGUHIHUHQFHSRLQWVDVIDUDVSRVVLEOH 6KRXOGDQ\VWDNHVRUSRLQWVEHUHPRYHGRU GHVWUR\HGXQQHFHVVDULO\E\DQ\DFWRIWKH&RQWUDFWRURUKLVKHUHPSOR\HHVWKH\PXVWEHUHVHWWRWKH VDWLVIDFWLRQRIWKH'LUHFWRUDWWKH&RQWUDFWRU VH[SHQVH % 7KH&RQWUDFWRUVKDOOLQIRUPWKH'LUHFWRUKRXUV WZR:RUN'D\V LQDGYDQFHRIWKHWLPHVDQGSODFHV DWZKLFKKHVKHLQWHQGVWR:RUNLQRUGHUWKDWLQVSHFWLRQPD\EHSURYLGHGDQGWKDWQHFHVVDU\ PHDVXUHPHQWVIRUUHFRUGVDQGSD\PHQWVPD\EHPDGHZLWKPLQLPXPLQFRQYHQLHQFH & 1RGLUHFWSD\PHQWZLOOEHPDGHIRUWKHFRVWWRWKH&RQWUDFWRURIDQ\RIWKH:RUNRUGHOD\RFFDVLRQHG E\JLYLQJOLQHVDQGJUDGHVE\PDNLQJRWKHUQHFHVVDU\PHDVXUHPHQWVRUE\LQVSHFWLRQ Western Allied Corporation Page 14 of 221 . . Item 10 Page 14 of 221 5,*+72):$< $ 7KHVLWHIRUWKHLQVWDOODWLRQRIHTXLSPHQWRUWKHULJKWRIZD\IRUWKH:RUNWREHFRQVWUXFWHGXQGHUWKLV &RQWUDFWZLOOEHSURYLGHGE\WKH&LW\ % 7KH&LW\ZLOOSURYLGHWKHDSSURSULDWHULJKWVRIZD\DQGSURSHUW\IRUSLSHOLQHVDQGVWUXFWXUHV 8SRQ DSSURYDOE\WKH'LUHFWRUWKH&RQWUDFWRUPD\ZLWKRXWFRVWXVHSRUWLRQVRIDQ\RIWKH&LW\ VULJKWVRI ZD\RUSURSHUW\ZKLFKPD\EHVXLWDEOHIRUZRUNLQJVSDFHDQGIRUVWRUDJHRIHTXLSPHQWDQGPDWHULDOV 7KH&RQWUDFWRUZLOOEHKHOGUHVSRQVLEOHIRUDQ\GDPDJHWRVWUXFWXUHVVWUHHWVDQGURDGVWUHHVDQG ODQGVFDSLQJDQGIRUDQ\GDPDJHWKDWPD\UHVXOWIURPKLVKHUXVHRI&LW\SURSHUW\ & ,QFDVHDUHDVDGGLWLRQDOWRWKRVHDYDLODEOHRQWKH&LW\ VULJKWVRIZD\RUSURSHUW\DUHUHTXLUHGE\WKH &RQWUDFWRUIRUKLVKHURSHUDWLRQVKHVKHVKDOOPDNHDUUDQJHPHQWVZLWKWKHSURSHUW\RZQHUVIRUWKHXVH RIVXFKDGGLWLRQDODUHDVDWKLVKHURZQH[SHQVH &2175$&725¶623(5$7,2166725$*(<$5' ,QWKHHYHQWWKH&RQWUDFWRUUHTXLUHVVSDFHIRUWKHVWRUDJHDQGRUVWDJLQJRIFRQVWUXFWLRQPDWHULDOVVXSSOLHV HTXLSPHQWVWRFNSLOLQJRIGHEULVRUDQ\RWKHUQHHGVUHTXLUHGIRUFRQVWUXFWLRQRSHUDWLRQVKHVKHVKDOODFTXLUHDW KLVKHURZQH[SHQVHVXFKDUHDVDVKHVKHPD\GHVLUH )RUSURSHUWLHVZLWKLQWKH&LW\RI9HUQRQWKHVWDJLQJ DUHDPXVWEHHQFORVHGDW&RQWUDFWRU¶VH[SHQVHZLWKFRQVWUXFWLRQIHQFLQJFRYHUHGZLWKDPHVKVFUHHQWROLPLW YLVLELOLW\WRWKHVLWH3ULYDWHSURSHUW\XVHGIRUVWRUDJHRIFRQVWUXFWLRQPDWHULDORUGHEULVVKDOOEHUHVWRUHGWRDOHJDO FRQGLWLRQZLWKUHJDUGWRDSSHDUDQFHDQGPDLQWHQDQFHXSRQFRQFOXVLRQRIWKHSURMHFW3URSHUW\VKRXOGEHJUDGHG DQGIUHHRIZHHGVDQGGHEULVZKHQSURMHFWLVFRPSOHWHG >(1'2)$57,&/(@ Western Allied Corporation Page 15 of 221 . . Item 10 Page 15 of 221 ARTICLE 2 - PERFORMANCE OF THE WORK 3(5)250$1&(2):25.*(1(5$/ &RQWUDFWRUVKDOODWLWVRZQFRVWDQGH[SHQVHIXUQLVKDOOQHFHVVDU\PDWHULDOVODERUWUDQVSRUWDWLRQDQG HTXLSPHQWIRUGRLQJDQGSHUIRUPLQJVDLG:RUNDQGWKHPDWHULDOVXVHGVKDOOFRPSO\ZLWKWKHUHTXLUHPHQWVRIWKH &RQWUDFW'RFXPHQWV$OO:RUNVKDOOEHSHUIRUPHGDQGFRPSOHWHGDVUHTXLUHGLQWKH&RQWUDFW'RFXPHQWVDQG VXEMHFWWRWKHDSSURYDORIWKH'LUHFWRURUKLVKHUGHVLJQDWHGDVVLVWDQW 12$66,*10(1725'(/(*$7,21 &RQWUDFWRUVKDOOQRWDVVLJQRUGHOHJDWHWKHGXWLHVRUREOLJDWLRQVXQGHUWKLV&RQWUDFWRUKLVKHULQWHUHVWWKHUHLQLQ ZKROHRULQSDUWZLWKRXWWKHSULRUZULWWHQFRQVHQWRIWKH&LW\ZKLFKPD\EHZLWKKHOGDWWKH&LW\ VVROHGLVFUHWLRQ 67$1'$5'2)3(5)250$1&( &RQWUDFWRUDJUHHVWKDWDOOVHUYLFHVSHUIRUPHGKHUHXQGHUVKDOOEHSURYLGHGLQDPDQQHUFRPPHQVXUDWHZLWKWKH KLJKHVWSURIHVVLRQDOVWDQGDUGVDQGVKDOOEHSHUIRUPHGE\TXDOLILHGDQGH[SHULHQFHGSHUVRQQHO WKDWDQ\:RUN SHUIRUPHGE\&RQWUDFWRUXQGHUWKH&RQWUDFWZLOOEHSHUIRUPHGLQWKHEHVWPDQQHU WKDWDQ\PDWHULDOIXUQLVKHG VKDOOEHVXEMHFWWRWKHDSSURYDORIWKH'LUHFWRU DQGWKDWERWK:RUNDQGPDWHULDOVZLOOPHHWIXOO\WKHUHTXLUHPHQWV RIWKH&RQWUDFW'RFXPHQWV$Q\ZRUNGHHPHGXQDFFHSWDEOHE\WKH'LUHFWRUZKHWKHUDFDXVHLVGHWHUPLQHGRU QRWVKDOOEHUHSDLUHGRUUHSODFHGE\&RQWUDFWRUDW&RQWUDFWRU¶VH[SHQVH 7KH&RQWUDFWRUVKDOOEHUHVSRQVLEOHIRUWKHILQDOSURGXFWDQGVKDOOPDNHDQ\TXDOLW\FRQWURODGMXVWPHQWVDQG FRUUHFWLRQVQHFHVVDU\WRREWDLQWKHILQDOSURGXFWDFFHSWHGE\WKH&LW\(QJLQHHU7KH&RQWUDFWRUVKDOOSHUIRUP SURFHVVDQGTXDOLW\FRQWUROVDPSOLQJDQGWHVWLQJDQGH[HUFLVHPDQDJHPHQWFRQWUROWKHZRUNRIKLVKHU VXEFRQWUDFWRUV WHFKQLFLDQV DQG ZRUNHUV WR HQVXUH WKDW WKH PLOOLQJ WUDQVSRUWLQJ UHF\FOLQJ VSUHDGLQJ FRPSDFWLRQDQGILQLVKLQJSURFHVVHVFRQIRUPWRWKHVH6SHFLILFDWLRQV 7KHSURILFLHQF\RIWHVWLQJODERUDWRULHV DQGVDPSOLQJDQGWHVWLQJSHUVRQQHOVKDOOEHUHYLHZHGDQGDSSURYHGE\WKH&LW\(QJLQHHUSULRUWRSURYLGLQJ VHUYLFHVWRWKHSURMHFW7KH&LW\(QJLQHHUVKDOOKDYHXQUHVWULFWHGDFFHVVWRWKHODERUDWRU\VDPSOLQJWHVWLQJ VLWHVDQGDOOLQIRUPDWLRQUHVXOWLQJIURPPL[GHVLJQDQGTXDOLW\FRQWURODFWLYLWLHV $OO4XDOLW\&RQWUROWHVWLQJ UHVXOWVVKDOOEHVXEPLWWHGWRWKH&LW\(QJLQHHURQDGDLO\EDVLV '()(&7,9(:25. :LWKLQWKHWLPHSHULRGVWKDWWKH&LW\VSHFLILHVWKH&RQWUDFWRUVKDOOFRUUHFWDOOGHILFLHQWLPSURSHUO\H[HFXWHGRU XQVDWLVIDFWRU\:RUNGHWHUPLQHGE\WKH&LW\ 7KH&RQWUDFWRUVKDOOUHPRYHDQGVKDOOUHSDLURUUHSODFHDWKLVKHURZQH[SHQVHDQ\SDUWRIWKH:RUNWKDWLV GHILFLHQWLPSURSHUO\H[HFXWHGRUXQVDWLVIDFWRULO\H[HFXWHGHYHQWKRXJKLWKDVEHHQLQFOXGHGLQWKHPRQWKO\ HVWLPDWHV ,IKHVKHUHIXVHVRUQHJOHFWVWRUHPRYHUHSDLURUUHSODFHVXFKGHIHFWLYH:RUNSULRUWRWKH&LW\¶V DFFHSWDQFHRIWKH:RUNLWPD\EHUHSODFHGE\WKH&LW\DWWKHH[SHQVHRIWKH&RQWUDFWRUSOXVIRURYHUKHDG H[SHQVHVDQGKLVKHUVXUHWLHVVKDOOEHOLDEOHWKHUHIRU 6HH3DUDJUDSKIRUFXULQJGHIHFWVDIWHUDFFHSWDQFH RIWKH:RUN &,7<¶65,*+772&$55<2877+(:25. $ 1RWZLWKVWDQGLQJRWKHUUHPHGLHVDYDLODEOHWRWKH&LW\LIWKH&RQWUDFWRUGHIDXOWVIDLOVWRSHUIRUP:RUN UHTXLUHGE\WKH&RQWUDFW'RFXPHQWVRURWKHUZLVHQHJOHFWVWRFDUU\RXWWKH:RUNLQDFFRUGDQFHZLWK WKH&RQWUDFW'RFXPHQWVDQGIDLOVZLWKLQDKRXUSHULRGDIWHUUHFHLSWRIZULWWHQQRWLFHIURPWKH&LW\WR FRPPHQFHDQGFRUUHFWVXFKGHIDXOWIDLOXUHWRSHUIRUPRUQHJOHFWZLWKGLOLJHQFHDQGSURPSWQHVVWKH Western Allied Corporation Page 16 of 221 . . Item 10 Page 16 of 221 &LW\DWLWVVROHGLVFUHWLRQDQGZLWKRXWREOLJDWLRQPD\ZLWKLWVRZQRURXWVLGHIRUFHVSHUIRUPWKH:RUN &RQWUDFWRUKDVIDLOHGWRSHUIRUPDQGRUUHSODFHRUFRUUHFWGHILFLHQFLHVLQWKH:RUN ,QVXFKFDVHD &KDQJH2UGHURU&RQVWUXFWLRQ&KDQJH'LUHFWLYHVKDOOEHLVVXHGGHGXFWLQJIURPSD\PHQWVWKHQRU WKHUHDIWHUGXHWRWKH&RQWUDFWRUWKHFRVWRIFRPSOHWLRQUHSODFHPHQWRUFRUUHFWLRQRIVXFKGHILFLHQFLHV LQFOXGLQJFRPSHQVDWLRQIRUDGGLWLRQDOVHUYLFHVE\WKH&LW\¶VSURMHFWPDQDJHPHQWVWDIIWKH$UFKLWHFW DQGWKHLUUHVSHFWLYHFRQVXOWDQWVPDGHQHFHVVDU\E\VXFKGHIDXOWIDLOXUHWRSHUIRUPRUQHJOHFWSOXV IRU&LW\¶VRYHUKHDGH[SHQVHV ,ISD\PHQWVWKHQRUWKHUHDIWHUGXHWKH&RQWUDFWRUDUHQRWVXIILFLHQW WRFRYHUVXFKDPRXQWVWKH&RQWUDFWRUVKDOOSD\WKHGLIIHUHQFHWRWKH&LW\LPPHGLDWHO\7KLVUHPHG\LV FXPXODWLYH % 7KH&LW\DOVRKDVWKHULJKWEXWQRWWKHREOLJDWLRQWRVHOISHUIRUPRUKDYHRXWVLGHIRUFHVSHUIRUPSRUWLRQV RIWKH:RUNSUHYLRXVO\DVVLJQHGWR&RQWUDFWRU,QVXFKFDVHD&KDQJH2UGHURU&RQVWUXFWLRQ&KDQJH 'LUHFWLYHVKDOOEHLVVXHGUHGXFLQJWKH&RQWUDFW6XPE\WKH8QLW3ULFH V DSSOLFDEOHWRVXFKGHOHWHG :RUNRULQWKHDEVHQFHRI8QLW3ULFHVDQDPRXQWWKDWUHIOHFWVWKHUHDVRQDEOHFRVWRISHUIRUPLQJVXFK GHOHWHG:RUNDQGWKH$OORZDEOH0DUN8SDSSOLFDEOHWRVXFKGHOHWHG:RUN &20081,&$7,216$1'127,&(65(*$5',1*7+(:25. $ 1RWLFHVXQGHUWKH&RQWUDFW'RFXPHQWVVKDOOEHVXEPLWWHGLQZULWLQJYLDHPDLOWR NMDFNVRQ#FLW\RIYHUQRQRUJRU D GHOLYHUHGSHUVRQDOO\ E VHQWE\FHUWLILHGPDLOUHWXUQUHFHLSWUHTXHVWHGRU F VHQWE\DUHFRJQL]HGRYHUQLJKWPDLORUFRXULHUVHUYLFHZLWKGHOLYHU\UHFHLSWUHTXHVWHGWRWKHIROORZLQJ DGGUHVVHV RUWRVXFKRWKHUDGGUHVVDVPD\IURPWLPHWRWLPHEHVSHFLILHGLQZULWLQJE\VXFK3HUVRQ $OOFRUUHVSRQGHQFHZLWK&RQWUDFWRUVKDOOEHVHQWWRWKHIROORZLQJDGGUHVV :HVWHUQ$OOLHG&RUSRUDWLRQ )ORUHQFH$YH 6DQWD)H6SULQJV&$ $WWHQWLRQ 0LNH*DOODJKHU3UHVLGHQW 3KRQH (562) 944-6341 (PDLO 0*DOODJKHU#ZDVRFDOFRP $OOFRPPXQLFDWLRQVVKDOOEHFRSLHGWR&LW\DQGVKDOOEHGHOLYHUHGWR&LW\¶V'LUHFWRUDWWKHDGGUHVV VHWIRUWKEHORZZLWKFRSLHVWRVXFKDGGLWLRQDOSHUVRQVDVPD\EHGLUHFWHGE\&LW\¶V'LUHFWRU &LW\RI9HUQRQ 3XEOLF:RUNV'HSDUWPHQW 6DQWD)H$YHQXH 9HUQRQ&$ $WWHQWLRQ .HQQHWK-DFNVRQ)DFLOLWLHV6XSHUYLVRU 3KRQH H[W (PDLO NMDFNVRQ#FLW\RIYHUQRQRUJ % 1RWLFHVVKDOOEHGHHPHGUHFHLYHGZKHQDFWXDOO\UHFHLYHGLQWKHRIILFHRIWKHDGGUHVVHH RUE\WKH DGGUHVVHHLISHUVRQDOO\GHOLYHUHG RUZKHQGHOLYHU\LVUHIXVHGDVVKRZQRQWKHUHFHLSWRIWKH86 3RVWDO6HUYLFHSULYDWHFDUULHURURWKHU3HUVRQPDNLQJWKHGHOLYHU\$OOQRWLFHVUHFHLYHGDIWHU SPVKDOOEHGHHPHGUHFHLYHGRQWKHILUVWEXVLQHVVGD\IROORZLQJGHOLYHU\$Q\WHFKQLFDORURWKHU FRPPXQLFDWLRQVSHUWDLQLQJWRWKH:RUNVKDOOEHFRQGXFWHGE\&RQWUDFWRU V3URMHFW0DQDJHUDQG WHFKQLFDOUHSUHVHQWDWLYHVGHVLJQDWHGE\&LW\&RQWUDFWRU VUHSUHVHQWDWLYHVVKDOOEHDYDLODEOHDWDOO Western Allied Corporation Page 17 of 221 . . Item 10 Page 17 of 221 UHDVRQDEOHWLPHVIRUFRQVXOWDWLRQDQGVKDOOEHDXWKRUL]HGWRDFWRQEHKDOIRI&RQWUDFWRULQPDWWHUV FRQFHUQLQJWKH:RUN & &RQWUDFWRU VKDOO FRS\ &LW\ RQ DOO ZULWWHQ FRUUHVSRQGHQFH SHUWDLQLQJ WR WKH &RQWUDFW EHWZHHQ &RQWUDFWRUDQGDQ\3HUVRQRWKHUWKDQ&RQWUDFWRU V6XEFRQWUDFWRUVFRQVXOWDQWVDQGDWWRUQH\V ' 1RWLILFDWLRQRI$IIHFWHG5HVLGHQWV%XVLQHVVHV7KH&RQWUDFWRUVKDOOEHUHVSRQVLEOHIRUGLVWULEXWLRQRI WKHJHQHUDOLQIRUPDWLRQOHWWHURIWKHSURMHFWWRDOODIIHFWHGUHVLGHQWVDQGEXVLQHVVHV$SURMHFWJHQHUDO LQIRUPDWLRQOHWWHUDQGVXIILFLHQWFRSLHVWKHUHRIZLOOEHSUHSDUHGE\&LW\VWDIIIRU&RQWUDFWRUGLVWULEXWLRQ WRDOOUHVLGHQWVEXVLQHVVHVWDEOLVKPHQWVDQGLQVWLWXWLRQVIURQWLQJRQRUGLUHFWO\DIIHFWHGE\WKHSURMHFW 7KH&RQWUDFWRUVKDOOEHUHVSRQVLEOHIRUGLVWULEXWLRQRIVDLGOHWWHULQKDQGRXWIRUPWRDOOWKHDSSURSULDWH UHVLGHQFHV DQG EXLOGLQJV LQ WKH VXEMHFW DUHD 'LVWULEXWLRQ VKDOO EH DFFRPSOLVKHG LQ D PDQQHU DFFHSWDEOHWRWKH&LW\(QJLQHHUDQGVKDOOEHILYH ZRUNLQJGD\VSULRUWRWKHEHJLQQLQJRIFRQVWUXFWLRQ RSHUDWLRQVLQWKHLPPHGLDWHYLFLQLW\,QDGGLWLRQWRWKHDERYHWKH&RQWUDFWRUVKDOOEHIXOO\UHVSRQVLEOH IRUVXFKRWKHUQRWLILFDWLRQVDVPD\EHUHTXLUHGUHODWHGWRQHFHVVDU\FORVXUHVRIVWUHHWVDOOH\V GULYHZD\VHWFRUWRXQDYRLGDEOHDFFHVVRUSDUNLQJUHVWULFWLRQV7KHVHQRWLILFDWLRQVVKDOODSSO\ZKHUH WKHFORVXUHVDQGDFFHVVRUSDUNLQJUHVWULFWLRQVUHTXLUHGLQWKHSHUIRUPDQFHRIDQ\ZRUNXQGHUWKLV FRQWUDFWSUHFOXGHDQ\UHVLGHQWWHQDQWRUSURSHUW\RZQHUIURPXWLOL]LQJWKHSUHPLVHVRUFRQGXFWLQJ EXVLQHVVWKHUHRQLQDUHDVRQDEOHDQGFXVWRPDU\PDQQHU $GGLWLRQDOQRWLILFDWLRQWRWKHDIIHFWHGEXVLQHVVHVDQGUHVLGHQWVVKDOOEHSUHSDUHGE\WKH&LW\DQG GLVWULEXWHGE\WKH&RQWUDFWRUIRUURDGZD\DQGGULYHZD\FORVXUHVILYH ZRUNLQJGD\VLQDGYDQFHRI DQ\FRQVWUXFWLRQZRUN1RUHPRYDORUH[FDYDWLRQZRUNLVDOORZHGXQWLOWKHDGGLWLRQDOQRWLILFDWLRQKDV EHHQGLVWULEXWHGWRWKHDIIHFWHGUHVLGHQWVDQGEXVLQHVVHV ,ID&RQWUDFWRULVXQDEOHWRDGKHUHWRKLVVFKHGXOHDVLQGLFDWHGRQKLVZULWWHQQRWLILFDWLRQWKHQDOOWKH DIIHFWHGUHVLGHQWVDQGSODFHVRIEXVLQHVVVKDOOEHUHQRWLILHGRIWKHUHYLVHGVFKHGXOHLQZULWLQJDV LQGLFDWHGDERYH &RQWUDFWRUFRVWVIRUDOORIWKHDERYHQRWLILFDWLRQVVKDOOEHFRQVLGHUHGDVLQFOXGHGLQWKHDSSURSULDWH LWHPVRIWKH%LG3URSRVDO ( 1RWLILFDWLRQRI8WLOLWLHV±7KHSURYLVLRQVRI6HFWLRQHQWLWOHG8WLOLWLHVRIWKH³*UHHQERRN´6WDQGDUG 6SHFLILFDWLRQVVKDOODSSO\7KH&RQWUDFWRUVKDOOFRQWDFWWKH8QGHUJURXQG6HUYLFH$OHUWRI6RXWKHUQ &DOLIRUQLD 86$ DWOHDVWWZRZRUNLQJGD\VLQDGYDQFHRIWKHFRQVWUXFWLRQZRUN ,1'(3(1'(17&2175$&725 7KH&RQWUDFWRULQWKHSHUIRUPDQFHRIWKH:RUNKHUHXQGHUZLOOEHDFWLQJLQDQLQGHSHQGHQWFDSDFLW\DQGQRW DVDQDJHQWHPSOR\HHSDUWQHURUMRLQWYHQWXUHRIWKH&LW\ (0(5*(1&<:25. $ 'XULQJ:RUNLQJ+RXUV ,QFDVHRIDQHPHUJHQF\ZKLFKWKUHDWHQVORVVRULQMXU\RISURSHUW\DQGRUVDIHW\RIOLIHGXULQJZRUNLQJ KRXUVWKH&RQWUDFWRUVKDOODFWZLWKRXWSUHYLRXVLQVWUXFWLRQVIURPWKH&LW\DVWKHVLWXDWLRQPD\ZDUUDQW +HVKHVKDOOQRWLI\WKH'LUHFWRURIWKHHPHUJHQF\DQGWKHDFWLRQWDNHQLPPHGLDWHO\WKHUHDIWHU $Q\FRPSHQVDWLRQFODLPHGE\WKH&RQWUDFWRUWRJHWKHUZLWKVXEVWDQWLDWLQJGRFXPHQWVLQUHJDUGWR Western Allied Corporation Page 18 of 221 . . Item 10 Page 18 of 221 H[SHQVH VKDOO EH VXEPLWWHG WR WKH 'LUHFWRU ZLWKLQ FDOHQGDUGD\V DIWHU WKH HPHUJHQF\ &RPSHQVDWLRQLIDOORZHGZLOOEHSDLGIRUDV([WUD:RUN % 2XWVLGHRI:RUNLQJ+RXUV :KHQHYHULQWKHRSLQLRQRIWKH&LW\WKHUHVKDOODULVHRXWVLGHRIWKHUHJXODU:RUNLQJKRXUVRQWKH &RQWUDFW:RUNRIDQHPHUJHQF\QDWXUHZKLFKWKUHDWHQVORVVRULQMXU\RISURSHUW\RUGDQJHUWRSXEOLF VDIHW\WKH&RQWUDFWRUVKDOODFWZLWKRXWSUHYLRXVLQVWUXFWLRQVIURPWKH&LW\DVWKHVLWXDWLRQPD\ ZDUUDQW +HVKH VKDOO QRWLI\ WKH 'LUHFWRU RI WKH HPHUJHQF\ DQGWKH DFWLRQ WDNHQ LPPHGLDWHO\ WKHUHDIWHU $Q\FRPSHQVDWLRQFODLPHGE\WKH&RQWUDFWRUWRJHWKHUZLWKVXEVWDQWLDWLQJGRFXPHQWVLQ UHJDUGWRH[SHQVHVKDOOEHVXEPLWWHGWRWKH'LUHFWRUZLWKLQFDOHQGDUGD\VDIWHUWKHHPHUJHQF\ &RPSHQVDWLRQLIDOORZHGZLOOEHSDLGIRUDV([WUD:RUN ,QWKHHYHQWWKH&RQWUDFWRULVQRWDEOHWR UHVSRQGWRDQHPHUJHQF\RXWVLGHRIUHJXODUZRUNLQJKRXUVWKH&LW\ VIRUFHVZLOOKDQGOHVXFK HPHUJHQF\:RUN,IVXFKHPHUJHQF\DULVHVRXWRIRULVWKHUHVXOWRIRSHUDWLRQVE\WKH&RQWUDFWRUWKH FRVWRIWKHFRUUHFWLYHPHDVXUHVZLOOEHELOOHGWRWKH&RQWUDFWRUDQGGHGXFWHGIURPKLVKHUSD\PHQWDV SURYLGHGLQWKH&RQWUDFW'RFXPHQWV 7KHSHUIRUPDQFHRIHPHUJHQF\:RUNE\&LW\IRUFHVZLOOQRW UHOLHYHWKH&RQWUDFWRURIDQ\RIKLVKHUUHVSRQVLELOLWLHVREOLJDWLRQVRUOLDELOLWLHVXQGHUWKH&RQWUDFW 68%&2175$&7256 $ (DFKVXEFRQWUDFWVKDOOFRQWDLQDUHIHUHQFHWRWKH&RQWUDFWEHWZHHQWKH&LW\DQGWKHSULQFLSDO &RQWUDFWRUDQGWKHWHUPVRIWKH&RQWUDFWDQGDOOSDUWVWKHUHRIVKDOOEHPDGHSDUWRIHDFKVXEFRQWUDFW LQVRIDUDVDSSOLFDEOHWRWKH:RUNFRYHUHGWKHUHE\,ILQWKH'LUHFWRU¶VRSLQLRQWKH6XEFRQWUDFWRUIDLOV WRFRPSO\ZLWKWKHUHTXLUHPHQWVRIWKHSULQFLSDO&RQWUDFWLQVRIDUDVWKHVDPHPD\EHDSSOLFDEOHWRWKH 6XEFRQWUDFWRU¶V:RUNWKH'LUHFWRUPD\GLVTXDOLI\WKH6XEFRQWUDFWRU % 1RWKLQJFRQWDLQHGLQWKHVH&RQWUDFW'RFXPHQWVVKDOOEHFRQVWUXHGDVFUHDWLQJDQ\FRQWUDFWXDO UHODWLRQVKLSEHWZHHQDQ\6XEFRQWUDFWRUDQGWKH&LW\ & 7KH&RQWUDFWRUVKDOOEHFRQVLGHUHGWKHHPSOR\HURIWKH6XEFRQWUDFWRUVDQGVKDOOEHIXOO\UHVSRQVLEOH WRWKH&LW\IRUWKHDFWVDQGRPLVVLRQVRI6XEFRQWUDFWRUVDQGRISHUVRQVHPSOR\HGE\WKHPDVWKH &RQWUDFWRULVIRUWKHDFWVDQGRPLVVLRQVRISHUVRQVGLUHFWO\HPSOR\HGE\KLPKHU ' 7KH&RQWUDFWRUVKDOOEHUHVSRQVLEOHIRUWKHFRRUGLQDWLRQRIWKHWUDGHV6XEFRQWUDFWRUVDQGPDWHULDO VXSSOLHUVHQJDJHGXSRQWKH:RUN,WVKDOOEHWKH&RQWUDFWRU¶VGXW\WRVHHWKDWDOORIKLVKHU 6XEFRQWUDFWRUVFRPPHQFHWKHLU:RUNDWWKHSURSHUWLPHDQGFDUU\LWRQZLWKGXHGLOLJHQFHVRWKDW WKH\GRQRWGHOD\RULQMXUHHLWKHUWKH:RUNRUPDWHULDOV DQGWKDWDOOGDPDJHFDXVHGE\WKHPRUWKHLU ZRUNHUVLVPDGHJRRGDWKLVKHUH[SHQVH ( 7KH&LW\ZLOOQRWXQGHUWDNHWRVHWWOHGLIIHUHQFHVEHWZHHQWKH&RQWUDFWRUDQGKLVKHU6XEFRQWUDFWRUVRU EHWZHHQVXEFRQWUDFWRUV ) 7KH&RQWUDFWRUVKDOOXWLOL]HWKHVHUYLFHVRIVSHFLDOW\6XEFRQWUDFWRUVZLWKRXWDGGLWLRQDOH[SHQVHWRWKH &LW\RQWKRVHSDUWVRIWKH:RUNZKLFKDUHVSHFLILHGWREHSHUIRUPHGE\VSHFLDOW\FRQWUDFWRUV 86(2))$&,/,7,(635,2572&203/(7,212)&2175$&7 $ :KHQHYHULQWKHRSLQLRQRIWKH'LUHFWRUDQ\:RUNXQGHUWKH&RQWUDFWRUDQ\SRUWLRQ V WKHUHRILVLQD FRQGLWLRQVXLWDEOHIRUXVHE\WKH&LW\WKH&LW\PD\DIWHUZULWWHQQRWLFHDQGGHVLJQDWLRQIURPWKH 'LUHFWRUWRWKH&RQWUDFWRUXVH ZKLFKLQFOXGHVEXWLVQRWOLPLWHGWRWDNLQJRYHURUSODFLQJLQWR Western Allied Corporation Page 19 of 221 . . Item 10 Page 19 of 221 VHUYLFH DQ\SRUWLRQ V GHVLJQDWHGE\WKH'LUHFWRU % 7KHXVHRIDQ\SRUWLRQ V E\WKH&LW\VKDOOQRWEHFRQVWUXHGDVDQGZLOOQRWFRQVWLWXWHDFFHSWDQFHLQ DQ\VHQVHRIDQ\SRUWLRQ V RIWKH:RUNRIWKH&RQWUDFWRUQRUZLOOVXFKXVHWULJJHUWKHUXQQLQJRIDQ\ ZDUUDQW\DQGRUJXDUDQWHHSHULRGV & $OOQHFHVVDU\UHSDLUVUHQHZDOVFKDQJHVRUPRGLILFDWLRQVLQWKH:RUNRUDQ\SRUWLRQWKHUHRIVRXVHG QRWGXHWRRUGLQDU\ZHDUDQGWHDUEXWGXHWRGHIHFWLYHPDWHULDOVRUZRUNPDQVKLSWKHRSHUDWLRQVRI WKH&RQWUDFWRURUDQ\RWKHUFDXVHVKDOOEHPDGHDWWKHH[SHQVHRIWKH&RQWUDFWRU ' 7KHXVHRIDQ\SRUWLRQ V E\WKH&LW\VKDOOQRWUHOLHYHWKH&RQWUDFWRURIDQ\RIKLVKHUUHVSRQVLELOLWLHV RUOLDELOLWLHVXQGHUWKH&RQWUDFWQRUFRQVWLWXWHDZDLYHUE\WKH&LW\RIDQ\RIWKHFRQGLWLRQVWKHUHRI 6DLGXVHVKDOOQRWFDQFHOOLTXLGDWHGGDPDJHVDVRIWKHILUVWGDWHRIXVHRUDQ\FRQWLQXDQFHWKHUHRI QRULPSDLUUHGXFHRUFKDQJHWKHDPRXQWRIOLTXLGDWHGGDPDJHV &223(5$7,21:,7+27+(5:25.)25&(6 $ 7KH&LW\UHVHUYHVWKHULJKWWRSHUIRUPRWKHU:RUNDWRUQHDUWKHVLWHDWDQ\WLPHE\WKHXVHRILWVRZQ IRUFHVRURWKHUFRQWUDFWRUV % 2WKHUFRQWUDFWRUVRWKHUXWLOLWLHVDQGSXEOLFDJHQFLHVRUWKHLUFRQWUDFWRUVRWKHU&LW\FRQWUDFWRUVDQG &LW\SHUVRQQHOPD\EHZRUNLQJLQWKHYLFLQLW\GXULQJWKHSURMHFWFRQVWUXFWLRQSHULRG 7KHUHPD\EH VRPHLQWHUIHUHQFHEHWZHHQWKHVHDFWLYLWLHVDQGWKH:RUNXQGHUWKH&RQWUDFW'RFXPHQWV 7KH &RQWUDFWRUVKDOOFRRSHUDWHDQGFRRUGLQDWHKLVKHU:RUNZLWKWKDWRIRWKHU:RUNIRUFHVWRDVVXUH WLPHO\&RQWUDFWFRPSOHWLRQ $*5((0(176:,7+3523(57<2:1(56 $JUHHPHQWVZLWKSURSHUW\RZQHUVIRUVWRULQJH[FDYDWHGPDWHULDOVWRULQJDQ\RWKHUPDWHULDOVRUIRUDQ\RWKHU SXUSRVHUHODWHGWRWKH:RUNVKDOOEHPDGHLQZULWLQJDQGDFRS\VXEPLWWHGWRWKH'LUHFWRUIRUKLVKHU LQIRUPDWLRQ$OOVWRUDJHFKDUJHVVKDOOEHDWWKH&RQWUDFWRU¶VVROHH[SHQVH 3527(&7,212)3523(57< $OOSXEOLFDQGSULYDWHSURSHUW\SDYHPHQWRULPSURYHPHQWVKDOOEHVDIHO\JXDUGHGIURPGDPDJHRUORVVLQ FRQQHFWLRQZLWKWKLV&RQWUDFWE\WKH&RQWUDFWRUDWDOOWLPHV 6KRXOGDQ\IDFLOLW\VWUXFWXUHRUSURSHUW\EHGDPDJHG GXULQJRSHUDWLRQVRIWKH&RQWUDFWRUKHVKHVKDOOLPPHGLDWHO\QRWLI\WKHSURSHUW\RZQHUVRUDXWKRULWLHV $OO GDPDJHVDQGORVVHVLQFXUUHGVKDOOEHSDLGE\WKH&RQWUDFWRU &2175$&725 65(63216,%,/,7,(6)25/266(625/,$%,/,7,(6 $ 5LVNRI/RVV ([FHSWDVRWKHUZLVHSURYLGHGLQWKH&RQWUDFW'RFXPHQWVDQGH[FHSWDVWRWKHFRVWRIUHSDLURU UHVWRUDWLRQRIGDPDJHWRWKH:RUNFDXVHGE\IRUFHPDMHXUHWKH&RQWUDFWRUVKDOOEHDUDOOORVVHV UHVXOWLQJWRKLPKHURQDFFRXQWRIWKHDPRXQWRUFKDUDFWHURIWKH:RUNRUIURPDQ\XQIRUHVHHQ REVWUXFWLRQVRUGLIILFXOWLHVZKLFKPD\EHHQFRXQWHUHGRUIURPDQ\HQFXPEUDQFHVRQWKHOLQHRIWKH :RUNRUEHFDXVHWKHQDWXUHRIWKHJURXQGLQRURQZKLFKWKH:RUNLVGRQHLVGLIIHUHQWIURPZKDWLV DVVXPHG7KH&RQWUDFWRUVKDOOEHDUWKHULVNIRUDQ\&LW\HTXLSPHQWPDWHULDORUVXSSOLHVZLWKZKLFK KHVKHKDVEHHQHQWUXVWHG Western Allied Corporation Page 20 of 221 . . Item 10 Page 20 of 221 % 0DWHULDOVDQG)DFLOLWLHV 7KH&RQWUDFWRUVKDOOEHUHVSRQVLEOHIRUPDWHULDOVDQGIDFLOLWLHVDVKHUHLQDIWHUSURYLGHGDQGLQWKH HYHQWRIKLVKHUIDLOXUHWRFDUU\RXWVDLGUHVSRQVLELOLWLHVWKHVDPHPD\EHFDUULHGRXWE\WKH&LW\DWWKH H[SHQVHRIWKH&RQWUDFWRU 7KH&RQWUDFWRUVKDOOEHUHVSRQVLEOHIRUDQ\PDWHULDOVVRIXUQLVKHGDQGIRUWKHFDUHRIDOO :RUNXQWLOLWVFRPSOHWLRQDQGILQDODFFHSWDQFHDQGKHVKHVKDOODWKLVKHURZQH[SHQVH UHSODFHGDPDJHGRUORVWPDWHULDOVDQGUHSDLUGDPDJHGSDUWVRIWKH:RUN 7KH&RQWUDFWRUVKDOOSURWHFW&LW\IDFLOLWLHVIURPGDPDJHUHVXOWLQJIURPKLVKHU:RUN&LW\ IDFLOLWLHVGDPDJHGE\RUDVDUHVXOWRIWKH&RQWUDFWRU V:RUNXQGHUWKLV&RQWUDFWVKDOOEH UHSDLUHGRUUHSODFHGDVGLUHFWHGE\WKH'LUHFWRUDWWKH&RQWUDFWRU VH[SHQVH 7KH&RQWUDFWRUVKDOOUHPRYHIURPWKHYLFLQLW\RIWKHFRPSOHWHG:RUNDOOEXLOGLQJVUXEELVK XQXVHGPDWHULDOFRQFUHWHIRUPVDQGRWKHUPDWHULDOVEHORQJLQJRUXVHGXQGHUKLVKHU GLUHFWLRQGXULQJFRQVWUXFWLRQ,I&RQWUDFWRUIDLOVWRFRPSOHWHO\UHPRYHVXFKLWHPVZLWKLQD UHDVRQDEOHWLPHWKH&LW\PD\GRVRDWWKH&RQWUDFWRU¶VH[SHQVH & /DZVDQG5HJXODWLRQV 7KH&RQWUDFWRUVKDOOREH\DOOODZVRUGLQDQFHVDQGUHJXODWLRQVLQDQ\PDQQHUDIIHFWLQJWKRVH HQJDJHGRUHPSOR\HGRQWKH:RUNRUWKHPDWHULDOVXVHGLQWKH:RUNRULQDQ\ZD\DIIHFWLQJ WKHFRQGXFWRIWKH:RUNDQGRIDOOFRXUWRUGHUVDQGGHFUHHVKDYLQJDQ\MXULVGLFWLRQRUDXWKRULW\ RYHUWKHVDPH ,IDQ\GLVFUHSDQF\RULQFRQVLVWHQF\VKRXOGEHGLVFRYHUHGLQWKLV&RQWUDFWRULQ WKH 'UDZLQJV RU 6SHFLILFDWLRQV KHUHLQ UHIHUUHG WR LQ UHODWLRQWRDQ\VXFKODZRUGLQDQFH UHJXODWLRQRUGHURUGHFUHHKHVKHVKDOOLPPHGLDWHO\UHSRUWWKHVDPHLQZULWLQJWRWKH'LUHFWRU &RQWUDFWRUVKDOODWDOOWLPHVFDXVHDOOKLVKHUDJHQWVDQGHPSOR\HHVWRREVHUYHDQGFRPSO\ZLWK DOOVXFKDSSOLFDEOHODZVRUGLQDQFHVUHJXODWLRQVRUGHUVDQGGHFUHHVLQHIIHFWRUZKLFKPD\ EHFRPHHIIHFWLYHEHIRUH)LQDO&RPSOHWLRQRIWKLV&RQWUDFW 1RWKLQJLQWKH&RQWUDFW'RFXPHQWVVKDOOEHFRQVWUXHGWRSHUPLW:RUNQRWFRQIRUPLQJWRVXFKODZV RUGLQDQFHVDQGUHJXODWLRQV,IWKH&RQWUDFWRUDVFHUWDLQVDWDQ\WLPHWKDWDQ\UHTXLUHPHQWRIWKLV &RQWUDFWLVDWYDULDQFHZLWKVXFKDSSOLFDEOHODZUHTXLUHPHQWKHVKHVKDOOLPPHGLDWHO\QRWLI\WKH 'LUHFWRU ,IVXFKDSSOLFDEOHODZUHTXLUHPHQWZDVQRWLQHIIHFWRQWKHGDWHRIVXEPLVVLRQRIELGVDQ\ QHFHVVDU\DGMXVWPHQWRIWKH&RQWUDFWSULFHVKDOOEHPDGHDVSURYLGHGLQ$UWLFOHKHUHLQ,IVXFK DSSOLFDEOHODZUHTXLUHPHQWZDVLQHIIHFWRQVDLGGDWHRIELGVXEPLVVLRQQRDGMXVWPHQWRI&RQWUDFW SULFHZLOOEHFRQVLGHUHG 7KH&RQWUDFWRUDWKLVKHURZQH[SHQVHVKDOOSD\DOOWD[HVSURSHUO\DVVHVVHGDJDLQVWKLVKHU HTXLSPHQWPDWHULDOVRUSURSHUW\XVHGRUUHTXLUHGLQFRQQHFWLRQZLWKWKH:RUN :$55$17<$1'&255(&7,216 $ :DUUDQW\ Warranty. 7KH&RQWUDFWRUZDUUDQWVWRWKH&LW\WKDW L PDWHULDOVDQGHTXLSPHQWIXUQLVKHG XQGHUWKH&RQWUDFWZLOOEHRIJRRGTXDOLW\DQGQHZXQOHVVRWKHUZLVHUHTXLUHGRUSHUPLWWHGE\ Western Allied Corporation Page 21 of 221 . . Item 10 Page 21 of 221 WKH&RQWUDFW'RFXPHQWV LL WKH:RUNZLOOEHRIJRRGTXDOLW\DQGIUHHIURPGHIHFWV LLL WKH :RUNZLOOFRQIRUPWRWKHUHTXLUHPHQWVRIWKH&RQWUDFW'RFXPHQWV DQG LY &RQWUDFWRUZLOO GHOLYHUWKH3URMHFWIUHHRIVWRSQRWLFHFODLPV:RUNQRWFRQIRUPLQJWRWKHVHUHTXLUHPHQWV LQFOXGLQJVXEVWLWXWLRQVQRWDFFHSWHGE\WKH&LW\ZLOOEHGHHPHGGHIHFWLYH7KH&RQWUDFWRU¶V ZDUUDQW\H[FOXGHVLPSURSHURULQVXIILFLHQWPDLQWHQDQFHLPSURSHURSHUDWLRQRUQRUPDOZHDU DQGWHDUDQGQRUPDOXVDJH,IUHTXLUHGE\WKH&LW\WKH&RQWUDFWRUVKDOOIXUQLVKVDWLVIDFWRU\ HYLGHQFHDVWRWKHNLQGDQGTXDOLW\RIPDWHULDOVDQGHTXLSPHQW7KLVZDUUDQW\LVQRWOLPLWHG E\WKHFRUUHFWLRQREOLJDWLRQRI3DUDJUDSKKHUHLQ Overlap. :KHUHDQ\ZDUUDQWLHVSURYLGHGXQGHUWKH&RQWUDFW'RFXPHQWVRYHUODSFRQIOLFWRU DUHGXSOLFDWLYH&RQWUDFWRUZLOOEHERXQGE\WKHPRUHVWULQJHQWUHTXLUHPHQWV Procurement and Assignment of Warranties: &RQWUDFWRUVKDOOREWDLQLQWKHQDPHRI&LW\RU WUDQVIHURUDVVLJQWR&LW\RU&LW\¶VGHVLJQHHSULRUWRWKHWLPHRI)LQDO&RPSOHWLRQRIWKH:RUN DQ\DQGDOOZDUUDQWLHVRUJXDUDQWHHVZKLFK&RQWUDFWRULVUHTXLUHGWRREWDLQSXUVXDQWWRWKH FRQWUDFW'RFXPHQWVDQGZKLFK&RQWUDFWRUREWDLQHGIURPDQ\RWKHUSHUVRQRUHQWLW\RWKHUWKDQ &RQWUDFWRULQFOXGLQJEXWQRWOLPLWHGWR6XEFRQWUDFWRUVDQGPDQXIDFWXUHUVDQGIXUWKHUDJUHHV WRSHUIRUPWKH:RUNLQVXFKDPDQQHUVRDVWRSUHVHUYHDQ\DQGDOOVXFKZDUUDQWLHV &RQWUDFWRU VKDOO VHFXUH ZULWWHQ ZDUUDQWLHV IURP DOO 6XEFRQWUDFWRUV &RQWUDFWRU DQG LWV 6XEFRQWUDFWRUV VKDOO RIIHU DQ\ ZDUUDQW\ XSJUDGHV RU H[WHQVLRQVWKDW DUH RIIHUHG E\ PDQXIDFWXUHUVRIDQ\HTXLSPHQWRUV\VWHPLQVWDOOHGLQWKH:RUNWRWKH&LW\&RQWUDFWRUVKDOO GHOLYHUWR&LW\DOOZDUUDQW\DQGJXDUDQWHHGRFXPHQWVDQGSROLFLHV Survival of Warranties: 7KHSURYLVLRQVRIWKLVSDUDJUDSKZLOOVXUYLYH&RQWUDFWRU¶V FRPSOHWLRQRIWKH:RUNRUWHUPLQDWLRQRI&RQWUDFWRU¶VSHUIRUPDQFHRIWKH:RUN % &RUUHFWLRQRI:RUN Before or After Final Completion 7KH&RQWUDFWRUVKDOOSURPSWO\FRUUHFW:RUNUHMHFWHGE\ WKH&LW\RU&LW\¶VGHVLJQHHDVIDLOLQJWRFRQIRUPWRWKHUHTXLUHPHQWVRIWKH&RQWUDFW 'RFXPHQWV ZKHWKHU GLVFRYHUHG EHIRUH RU DIWHU )LQDO &RPSOHWLRQDQG ZKHWKHU RU QRW IDEULFDWHG LQVWDOOHG RU FRPSOHWHG &RVWV RI FRUUHFWLQJ VXFK UHMHFWHG :RUN LQFOXGLQJ DGGLWLRQDOWHVWLQJLQVSHFWLRQVDQGFRPSHQVDWLRQIRUWKH&LW\¶VVHUYLFHVDQGH[SHQVHV PDGHQHFHVVDU\WKHUHE\ZLOOEHDWWKH&RQWUDFWRU¶VH[SHQVHZLWKLQWKH&RQWUDFW3ULFH 2. After Final Completion. D ,QDGGLWLRQWRWKH&RQWUDFWRU¶VZDUUDQW\REOLJDWLRQVXQGHU3DUDJUDSK$LI ZLWKLQRQH \HDUDIWHUWKHGDWHRI)LQDO&RPSOHWLRQRIWKH:RUNRUZLWKLQWKHWLPH SHULRGHVWDEOLVKHGE\DQ\DSSOLFDEOHVSHFLDOZDUUDQW\UHTXLUHGE\WKH&RQWUDFW 'RFXPHQWVDQ\RIWKH:RUNLVIRXQGWREHQRWLQDFFRUGDQFHZLWKWKHUHTXLUHPHQWV RI WKH &RQWUDFW 'RFXPHQWV WKH &RQWUDFWRU VKDOO FRPPHQFH FRUUHFWLRQ RU UHSODFHPHQWRIVXFK:RUNZLWKLQIRUW\HLJKW KRXUVDIWHUUHFHLSWRIZULWWHQ QRWLFHIURPWKH&LW\WRGRVR 7KH&RQWUDFWRUVKDOOSHUIRUPVXFKFRUUHFWLYHZRUN ZLWKRXWFKDUJHRUFRVWWRWKH&LW\DIWHU)LQDO&RPSOHWLRQRIWKH:RUN 7KH&LW\ VKDOOJLYHVXFKQRWLFHSURPSWO\DIWHUGLVFRYHU\RIWKHFRQGLWLRQ E ,IWKH&RQWUDFWRUIDLOVWRFRPPHQFHFRUUHFWLRQRUUHSODFHPHQWRIQRQFRQIRUPLQJ :RUNZLWKLQIRUW\HLJKW KRXUVDIWHUUHFHLSWRIZULWWHQQRWLFHWKH&LW\ZLOO SURFHHGWRKDYHGHIHFWVUHSDLUHGRUUHSODFHGDWWKHH[SHQVHRIWKH&RQWUDFWRUDQG LWV3HUIRUPDQFH%RQGVXUHW\SOXVILIWHHQSHUFHQW IRUWKH&LW\¶VRYHUKHDG Western Allied Corporation Page 22 of 221 . . Item 10 Page 22 of 221 DQGDGPLQLVWUDWLYHH[SHQVH7KH&LW\PD\FKDUJHVXFKFRVWVDJDLQVWDQ\SD\PHQW GXH&RQWUDFWRU ,ILQWKHRSLQLRQRIWKH&LW\GHIHFWLYHZRUNFUHDWHVDGDQJHURXV RUKD]DUGRXVFRQGLWLRQRUUHTXLUHVLPPHGLDWHFRUUHFWLRQRUDWWHQWLRQWRSUHYHQW IXUWKHUORVVWRWKH&LW\RUWRSUHYHQWLQWHUUXSWLRQRIRSHUDWLRQVRIWKH&LW\WKH&LW\ PD\WDNHLPPHGLDWHDFWLRQJLYHQRWLFHPDNHVXFKFRUUHFWLRQRUSURYLGHVXFK DWWHQWLRQDQGWKHFRVWRIVXFKFRUUHFWLRQRUDWWHQWLRQZLOOEHFKDUJHGDJDLQVWWKH &RQWUDFWRU6XFKDFWLRQE\WKH&LW\ZLOOQRWUHOLHYHWKH&RQWUDFWRURIWKHZDUUDQWLHV SURYLGHGLQWKLV$UWLFOHRUHOVHZKHUHLQWKH&RQWUDFW'RFXPHQWV Replacement or Removal of Defective or Unauthorized Work. 7KH&RQWUDFWRUVKDOOUHPRYH IURPWKH6LWHDQGUHSODFHWKRVHSRUWLRQVRIWKH:RUNZKLFKDUHQRWLQDFFRUGDQFHZLWKWKH UHTXLUHPHQWVRIWKH&RQWUDFW'RFXPHQWVLQDPDQQHUDFFHSWDEOHWRDQGDVRUGHUHGE\WKH 'LUHFWRU1RFRPSHQVDWLRQVKDOOEHDOORZHGIRUVXFKUHPRYDORUUHSODFHPHQW'LUHFWRUVKDOO KDYHDXWKRULW\WRFDXVHGHIHFWLYHZRUNWREHUHPHGLHGUHPRYHGRUUHSODFHGDQGWRGHGXFW WKHFRVWVIURPPRQLHVGXHRUWREHFRPHGXHWRWKH&RQWUDFWRU Destruction or Damage. ,QWKHHYHQWWKH&RQWUDFWRUGHVWUR\VRUGDPDJHVDQ\FRQVWUXFWLRQ RI WKH &LW\ RU DQRWKHU FRQWUDFWRU ZKLOH FRUUHFWLQJ RU UHPRYLQJ:RUNZKLFKLVQRWLQ DFFRUGDQFHZLWKWKHUHTXLUHPHQWVRIWKHVH&RQWUDFW'RFXPHQWVWKH&RQWUDFWRUVKDOOEHDU WKHFRVWRIUHSDLULQJRUUHFRQVWUXFWLQJWKDWRWKHUFRQVWUXFWLRQDVZHOO No Limitation1RWKLQJFRQWDLQHGLQ3DUDJUDSK%ZLOOEHFRQVWUXHGWRHVWDEOLVKDSHULRG RIOLPLWDWLRQZLWKUHVSHFWWRRWKHUREOLJDWLRQVZKLFKWKH&RQWUDFWRUPLJKWKDYHXQGHUWKH &RQWUDFW'RFXPHQWV (VWDEOLVKPHQWRIWKHRQH\HDUSHULRGIRUFRUUHFWLRQRI:RUNDV GHVFULEHGLQ3DUDJUDSK%UHODWHVRQO\WRWKHVSHFLILFREOLJDWLRQRIWKH&RQWUDFWRUWR FRUUHFWWKH:RUNDQGKDVQRUHODWLRQVKLSWRWKHOLPLWDWLRQVSHULRGVHVWDEOLVKHGE\VWDWXWH IRUDQ\FRQVWUXFWLRQGHIHFWRURWKHUFDXVHVRIDFWLRQ &/($1,1*$1'(19,5210(17$/&21752/6 7KH&RQWUDFWRU6XEFRQWUDFWRUVDQGHPSOR\HHVVKDOOFRPSO\ZLWKDOOOLWWHUDQGSROOXWLRQODZVDQGLWVKDOOEHWKH UHVSRQVLELOLW\RIWKH&RQWUDFWRUWRHQVXUHFRPSOLDQFH7KH&RQWUDFWRUVKDOOGRDOORIWKHIROORZLQJ $ 0DLQWDLQWKH6LWHIUHHRIZDVWHPDWHULDOVGHEULVDQGUXEELVKDQGLQDFOHDQDQGRUGHUO\FRQGLWLRQ DQG5HPRYHZDVWHPDWHULDOVGHEULVDQGUXEELVKIURPVLWHDQGGLVSRVHRIIVLWHOHJDOO\ % 7KH&RQWUDFWRUVKDOOPDLQWDLQDWKLVKHUGLVSRVDODQ\DQGDOOHTXLSPHQWQHFHVVDU\WRSUHYHQWDQG UHPHGLDWHDQ\VDQLWDU\VHZHURYHUIORZDULVLQJRXWRIWKH:RUN7KH&RQWUDFWRUVKDOOIXUQLVKDQGRSHUDWH DVHOIORDGLQJPRWRUVZHHSHUZLWKVSUD\QR]]OHVDVGLUHFWHGE\WKH'LUHFWRUWRPDLQWDLQWKHDIIHFWHG DUHDVLQDFRQGLWLRQRIFOHDQOLQHVVDFFHSWDEOHWRWKH&LW\DWDOOORFDWLRQVDIIHFWHGE\WKH&RQWUDFWRU¶V RSHUDWLRQV )RUSXUSRVHVRIWKLV3DUDJUDSKWKHDIIHFWHGDUHDVLQFOXGHWKHSURMHFW6LWHDVZHOODVDOO KDXOURXWHVWRDQGIURPWKHSURMHFW6LWHDQGDOODUHDVRIFRQVWUXFWLRQDQGUHVWRUDWLRQZKLFKKDYHQRW EHHQFRPSOHWHG & 7KH&RQWUDFWRUVKDOOWDNHDSSURSULDWHDFWLRQWRHQVXUHWKDWQRGXVWRULJLQDWHVIURPWKHSURMHFW6LWH ' $Q\HTXLSPHQWRUYHKLFOHVGULYHQDQGRURSHUDWHGZLWKLQRUDGMDFHQWWRDVWUHHWJXWWHUVWRUPGUDLQ UXQRIIFRQYH\DQFHRURFHDQVKDOOEHFKHFNHGDQGPDLQWDLQHGGDLO\WRSUHYHQWOHDNVRIPDWHULDOVWKDW LILQWURGXFHGWRZDWHUFRXOGEHGHOHWHULRXVWRDTXDWLFOLIH ( 1RGHEULVVRLOVLOWVDQGEDUNWUDVKVDZGXVWUXEELVKFHPHQWRUFRQFUHWHRUZDVKLQJVWKHUHRIRLORU Western Allied Corporation Page 23 of 221 . . Item 10 Page 23 of 221 SHWUROHXPSURGXFWVRURWKHURUJDQLFRUHDUWKHQPDWHULDOIURPDQ\FRQVWUXFWLRQRUDVVRFLDWHGDFWLYLW\RU ZKDWHYHUQDWXUHVKDOOEHDOORZHGWRHQWHULQWRRUSODFHGZKHUHVDPHPD\EHZDVKHGE\UDLQIDOORU UXQRIILQWRZDWHUVRIWKH6WDWH:KHQRSHUDWLRQVDUHFRPSOHWHGDQ\H[FHVVPDWHULDOVRUGHEULVVKDOO EHUHPRYHGIURPWKH:RUNDUHD :$7(532//87,21&21752/ $ 7KH&RQWUDFWRUVKDOOPHHWDOODSSOLFDEOH&LW\RI9HUQRQVWDWHDQGIHGHUDOFOHDQZDWHUODZVUXOHVDQG UHJXODWLRQVLQFOXGLQJEXWQRWOLPLWHGWRDOOFRQGLWLRQVVHWIRUWKLQWKH9HUQRQ0XQLFLSDO&RGH&KDSWHU $UWLFOHUHJDUGLQJVWRUPZDWHUDQGXUEDQUXQRIIFRQWUROVDVLWUHODWHVWRSXEOLFDJHQF\DFWLYLWLHV LQFOXGLQJ EXW QRW OLPLWHG WR VWRUP DQGRU VDQLWDU\ VHZHU V\VWHP LQVSHFWLRQ DQG UHSDLU VWUHHW VZHHSLQJWUDVKSLFNXSDQGGLVSRVDODQGVWUHHWDQGULJKWRIZD\FRQVWUXFWLRQ DQG UHSDLUDUH UHTXLUHGWRLPSOHPHQWDQGPDLQWDLQWKHDFWLYLW\VSHFLILF%HVW0DQDJHPHQW3UDFWLFHV %03V OLVWHG LQ7DEOHEHORZLQFRPSOLDQFHZLWKWKH1DWLRQDO3ROOXWDQW'LVFKDUJH(OLPLQDWLRQ6\VWHP 13'(6 UHTXLUHPHQWV &RQWUDFWRUVKDOOQRWGLVFKDUJHDQ\ZDWHUFRQWDLQLQJWUDVKGHEULVSROOXWDQWVIXHOV RLOVVRDSVRURWKHUQRQDOORZDEOHFRQVWLWXHQWVIURPLWVVZHHSLQJYHKLFOHVXSRQDQ\FLW\VWUHHWWR DQ\VWRUPGUDLQRUDQ\QRQSHUPLWWHGRXWOHW $VSDUWRILWVVXEPLVVLRQFRQWUDFWRUVKDOOGHVFULEHLWV PHWKRGVIRUSUHYHQWLQJ13'(6YLRODWLRQVGXULQJVZHHSLQJRSHUDWLRQVZLWKLQWKH&LW\ ,QDGGLWLRQ &RQWUDFWRUVKDOOFRPSO\ZLWKDOO13'(6UHTXLUHPHQWVDWLWVPDLQWHQDQFHIDFLOLWLHVVWRUDJH\DUGVDQG FRPSDQ\IDFLOLWLHV)DLOXUHWRFRPSO\ZLWKWKLVVHFWLRQPD\UHVXOWLQWHUPLQDWLRQIRUFDXVHE\WKH&LW\ RIDQ\FRQWUDFWUHVXOWLQJIURPWKLVVROLFLWDWLRQ 7DEOH%03VIRU3XEOLF$JHQF\)DFLOLWLHVDQG$FWLYLWLHV *HQHUDODQG$FWLYLW\6SHFLILF%03V *HQHUDO%03V 6FKHGXOLQJDQG3ODQQLQJ 6SLOO3UHYHQWLRQDQG&RQWURO 6DQLWDU\6HSWLF:DVWH0DQDJHPHQW 0DWHULDO8VH 6DIHU$OWHUQDWLYH3URGXFWV 9HKLFOH(TXLSPHQW&OHDQLQJ)XHOLQJDQG0DLQWHQDQFH ,OOLFLW&RQQHFWLRQ'HWHFWLRQ5HSRUWLQJDQG5HPRYDO ,OOHJDO6SLOO'LVFKDUJH&RQWURO 0DLQWHQDQFH)DFLOLW\+RXVHNHHSLQJ3UDFWLFHV )OH[LEOH3DYHPHQW $VSKDOW&HPHQW&UDFNDQG-RLQW*ULQGLQJ6HDOLQJ $VSKDOW3DYLQJ 6WUXFWXUDO3DYHPHQW)DLOXUH 'LJRXWV 3DYHPHQW*ULQGLQJDQG3DYLQJ (PHUJHQF\3RWKROH5HSDLUV 6HDOLQJ2SHUDWLRQV 5LJLG3DYHPHQW 3RUWODQG&HPHQW&UDFNDQG-RLQW6HDOLQJ 0XGMDFNLQJDQG'ULOOLQJ &RQFUHWH6ODEDQG6SDOO5HSDLU 6ORSH'UDLQV9HJHWDWLRQ 6KRXOGHU*UDGLQJ 1RQODQGVFDSHG&KHPLFDO9HJHWDWLRQ&RQWURO 1RQODQGVFDSHG0HFKDQLFDO9HJHWDWLRQ&RQWURO0RZLQJ 1RQODQGVFDSHG7UHHDQG6KUXE3UXQLQJ%UXVK&KLSSLQJ7UHHDQG6KUXE 5HPRYDO Western Allied Corporation Page 24 of 221 . . Item 10 Page 24 of 221 )HQFH5HSDLU 'UDLQDJH'LWFKDQG&KDQQHO0DLQWHQDQFH 'UDLQDQG&XOYHUW0DLQWHQDQFH &XUEDQG6LGHZDON5HSDLU /LWWHU'HEULV*UDIILWL 6ZHHSLQJ2SHUDWLRQV /LWWHUDQG'HEULV5HPRYDO (PHUJHQF\5HVSRQVHDQG&OHDQXS3UDFWLFHV *UDIILWL5HPRYDO /DQGVFDSLQJ &KHPLFDO9HJHWDWLRQ&RQWURO 0DQXDO9HJHWDWLRQ&RQWURO /DQGVFDSHG0HFKDQLFDO9HJHWDWLRQ&RQWURO0RZLQJ /DQGVFDSHG7UHHDQG6KUXE3UXQLQJ%UXVK&KLSSLQJ7UHHDQG6KUXE5HPRYDO ,UULJDWLRQ/LQH5HSDLUV ,UULJDWLRQ :DWHULQJ 3RWDEOHDQG1RQSRWDEOH (QYLURQPHQWDO 6WRUP'UDLQ6WHQFLOLQJ 5RDGVLGH6ORSH,QVSHFWLRQ 5RDGVLGH6WDELOL]DWLRQ 6WRUPZDWHU7UHDWPHQW'HYLFHV 7UDFWLRQ6DQG7UDS'HYLFHV %ULGJHV :HOGLQJDQG*ULQGLQJ 6DQGEODVWLQJ:HW%ODVWZLWK6DQG,QMHFWLRQDQG+\GUREODVWLQJ 3DLQWLQJ %ULGJH5HSDLUV 2WKHU6WUXFWXUHV 3XPS6WDWLRQ&OHDQLQJ 7XEHDQG7XQQHO0DLQWHQDQFHDQG5HSDLU 7RZ7UXFN2SHUDWLRQV 7ROO%RRWK/DQH6FUXEELQJ2SHUDWLRQV (OHFWULFDO 6DZFXWWLQJIRU/RRS,QVWDOODWLRQ 7UDIILF*XLGDQFH 7KHUPRSODVWLF6WULSLQJDQG0DUNLQJ 3DLQW6WULSLQJDQG0DUNLQJ 5DLVHG5HFHVVHG3DYHPHQW0DUNHU$SSOLFDWLRQDQG5HPRYDO 6LJQ5HSDLUDQG0DLQWHQDQFH 0HGLDQ%DUULHUDQG*XDUG5DLO5HSDLU (PHUJHQF\9HKLFOH(QHUJ\$WWHQXDWLRQ5HSDLU 6WRUP0DLQWHQDQFH0LQRU6OLGHVDQG6OLSRXWV&OHDQXS5HSDLU 0DQDJHPHQWDQG6XSSRUW %XLOGLQJDQG*URXQGV0DLQWHQDQFH 6WRUDJHRI+D]DUGRXV0DWHULDOV :RUNLQJ6WRFN 0DWHULDO6WRUDJH&RQWURO +D]DUGRXV:DVWH 2XWGRRU6WRUDJHRI5DZ0DWHULDOV 9HKLFOHDQG(TXLSPHQW)XHOLQJ 9HKLFOHDQG(TXLSPHQW&OHDQLQJ 9HKLFOHDQG(TXLSPHQW0DLQWHQDQFHDQG5HSDLU $ERYHJURXQGDQG8QGHUJURXQG7DQN/HDNDQG6SLOO&RQWURO Western Allied Corporation Page 25 of 221 . . Item 10 Page 25 of 221 % :DWHU4XDOLW\3URWHFWLRQ5HTXLUHPHQWVIRU&RQVWUXFWLRQ3URMHFWVZLWK/HVVWKDQ2QH $FUHRI 'LVWXUEHG6RLO $OOFRQVWUXFWLRQSURMHFWVUHJDUGOHVVRIVL]HZLOOEHUHTXLUHGWRLPSOHPHQWEHVWPDQDJHPHQWSUDFWLFHV %03V QHFHVVDU\WRUHGXFHSROOXWDQWVWRWKH0D[LPXP([WHQW3UDFWLFDEOH 0(3 WRPHHWWKH PLQLPXPZDWHUTXDOLW\SURWHFWLRQUHTXLUHPHQWVDQGLPSOHPHQWDOODSSOLFDEOHVHWRI%03VDVGHILQHG LQ7DEOH 7DEOH 0LQLPXP:DWHU4XDOLW\3URWHFWLRQ5HTXLUHPHQWVDQG$SSOLFDEOH6HWRI%03VIRU$OO&RQVWUXFWLRQ3URMHFWV &DWHJRU\ 0LQLPXP5HTXLUHPHQWV %03V 6HGLPHQW&RQWURO 6HGLPHQWVJHQHUDWHGRQWKHSURMHFWVLWHVKDOOEHUHWDLQHG XVLQJDGHTXDWH7UHDWPHQW&RQWURORU6WUXFWXUDO%03V 6HGLPHQW&RQWURO 1RQ6WRUPZDWHU 0DQDJHPHQW:DVWH 0DQDJHPHQWDQG 0DWHULDOV3ROOXWLRQ &RQWURO &RQVWUXFWLRQUHODWHGPDWHULDOVZDVWHVVSLOOVRUUHVLGXHV VKDOOEHUHWDLQHGDWWKHSURMHFWVLWHWRDYRLGGLVFKDUJHWR VWUHHWVGUDLQDJHIDFLOLWLHVUHFHLYLQJZDWHUVRUDGMDFHQW SURSHUWLHVE\ZLQGRUUXQRII 1RQVWRUPZDWHUUXQRIIIURPHTXLSPHQWDQGYHKLFOHZDVKLQJ DQGDQ\RWKHUDFWLYLW\VKDOOEHFRQWDLQHGDWWKHSURMHFWVLWHV 6WRUPZDWHU 0DQDJHPHQW :DVWH 0DQDJHPHQW (URVLRQ&RQWURO (URVLRQIURPVORSHVDQGFKDQQHOVVKDOOEHFRQWUROOHGE\ LPSOHPHQWLQJDQHIIHFWLYHFRPELQDWLRQRI%03VVXFKDVWKH OLPLWLQJRIJUDGLQJVFKHGXOHGGXULQJWKHZHWVHDVRQ LQVSHFWLQJJUDGHGDUHDVGXULQJUDLQHYHQWV SODQWLQJDQG PDLQWHQDQFHRIYHJHWDWLRQRQVORSHV DQGFRYHULQJHURVLRQ VXVFHSWLEOHVORSHV (URVLRQ&RQWURO 3OHDVHUHIHUWRWKH&DOLIRUQLD6WRUPZDWHU4XDOLW\$VVRFLDWLRQ¶V&RQVWUXFWLRQ+DQGERRN DYDLODEOHRQWKHLUZHEVLWH www.cabmphandbooks.com IRUIXUWKHULQIRUPDWLRQUHJDUGLQJWKH%03VOLVWHGLQ7DEOH $OOFRQVWUXFWLRQSURMHFWVZLWK/HVVWKDQ2QH $FUHRI'LVWXUEHG6RLOVKDOOVXEPLWWRWKH&LW\D VLJQHG6WDWHPHQWRI,QWHQWWR&RPSO\ZLWK0LQLPXP5HTXLUHPHQWVRIWKH6WRUPZDWHU3HUPLW ([KLELW 7KH&RQWUDFWRUPD\VHOIFHUWLI\WKDWWKHIROORZLQJWUDLQLQJZDVFRPSOHWHGRQDQDQQXDOEDVLV SURYLGLQJWKH\FHUWLI\WKH\KDYHUHFHLYHGDOODSSOLFDEOHWUDLQLQJ x 7KH&RQWUDFWRUVKDOOWUDLQDOORIWKHLUHPSOR\HHVLQWDUJHWHGSRVLWLRQV ZKRVHLQWHUDFWLRQV MREVDQGDFWLYLWLHVDIIHFWVWRUPZDWHUTXDOLW\ RQWKHUHTXLUHPHQWVRIWKHRYHUDOOVWRUPZDWHU PDQDJHPHQWSURJUDP x :KHQWKH:RUNLQFOXGHVWKHXVHRUKDYHWKHSRWHQWLDOWRXVHSHVWLFLGHVRUIHUWLOL]HUVWKH &RQWUDFWRUVKDOOWUDLQDOORIWKHLUHPSOR\HHV ZKHWKHURUQRWWKH\QRUPDOO\DSSO\SHVWLFLGHV RUIHUWLOL]HUVDVSDUWRIWKHLUZRUN 7UDLQLQJSURJUDPVVKDOODGGUHVV 7KHSRWHQWLDOIRUSHVWLFLGHUHODWHGVXUIDFHZDWHUWR[LFLW\ 3URSHUXVHKDQGOLQJDQGGLVSRVDORISHVWLFLGHV Western Allied Corporation Page 26 of 221 . . Item 10 Page 26 of 221 /HDVWWR[LFPHWKRGVRISHVWSUHYHQWLRQDQGFRQWUROLQFOXGLQJ,QWHJUDWHG3HVW 0DQDJHPHQW DQG 5HGXFWLRQRISHVWLFLGHXVH & :DWHU4XDOLW\3URWHFWLRQ5HTXLUHPHQWVIRU&RQVWUXFWLRQ3URMHFWVZLWK2QH $FUH RUJUHDWHU RI 'LVWXUEHG6RLO,QDGGLWLRQWRWKHPLQLPXP%03VUHTXLUHGLQ3DUDJUDSKV$DQG%DOOFRQVWUXFWLRQ SURMHFWVZKHUHDWOHDVWRQH DFUHRIVRLOZLOOEHGLVWXUEHGFRQVWUXFWLRQDFWLYLW\WKDWUHVXOWVLQODQG VXUIDFHGLVWXUEDQFHVRIOHVVWKDQRQHDFUHLIWKHDFWLYLW\LVSDUWRIDODUJHUFRPPRQSODQRIGHYHORSPHQW RUWKHVDOHRIRQHRUPRUHDFUHVRIGLVWXUEHGODQGVXUIDFHUHTXLUHVD&RQVWUXFWLRQ$FWLYLWLHV6WRUP :DWHU*HQHUDO3HUPLW ':43HUPLW 3ULRUWRFRPPHQFHPHQWRIFRQVWUXFWLRQDFWLYLWLHVWKH3HUPLW5HJLVWUDWLRQ'RFXPHQWV 35'V PXVW EHVXEPLWWHGHOHFWURQLFDOO\LQWKH6WRUP:DWHU0XOWL$SSOLFDWLRQ5HSRUW7UDFNLQJ6\VWHP 60$576 http://smarts.waterboards.ca.gov/smarts/faces/SwSmartsLogin.jsp 35'VFRQVLVWRIWKH 1RWLFHRI,QWHQW5LVN$VVHVVPHQW3RVW&RQVWUXFWLRQ&DOFXODWLRQVD6LWH0DSWKH6WRUP:DWHU 3ROOXWLRQ3UHYHQWLRQ3ODQ 6:333 DVLJQHGFHUWLILFDWLRQVWDWHPHQWE\WKH/HJDOO\5HVSRQVLEOH 3HUVRQ /53 DQGWKHILUVWDQQXDOIHH 6HH http://www.swrcb.ca.gov/water_issues/programs/stormwater/construction.shtml IRUPRUH LQIRUPDWLRQ$:DVWH'LVFKDUJHU,GHQWLILFDWLRQ :',' ZLOOEHHPDLOHGWRWKH/53DIWHUWKH35'V KDYHEHHQVXEPLWWHGDQGDUHGHHPHGFRPSOHWH&RQVWUXFWLRQDFWLYLWLHVFDQQRWEHJLQXQWLOD:','LV LVVXHGE\WKH6WDWH:DWHU5HVRXUFHV&RQWURO%RDUG&RQWUDFWRUVKDOOEHDUWKHFRVWVRIDQ\GHOD\VWR WKH3URMHFWFDXVHGE\DGHOD\LQREWDLQLQJLWV:',' 7KH6:333VKDOOLQFOXGH 7KHQDPHORFDWLRQSHULRGRIFRQVWUXFWLRQDQGDEULHIGHVFULSWLRQRIWKHSURMHFW &RQWDFWLQIRUPDWLRQIRUWKHRZQHUDQGFRQWUDFWRU 7KHEXLOGLQJSHUPLWQXPEHUIRUWKHSURMHFW 7KHJUDGLQJSHUPLWQXPEHUIRUWKHSURMHFW ZKHUHDSSOLFDEOH $OLVWRIPDMRUFRQVWUXFWLRQPDWHULDOVZDVWHVDQGDFWLYLWLHVDWWKHSURMHFWVLWH $OLVWRIEHVWPDQDJHPHQWSUDFWLFHVWREHXVHGWRFRQWUROSROOXWDQWGLVFKDUJHVIURPPDMRU FRQVWUXFWLRQPDWHULDOVZDVWHVDQGDFWLYLWLHV $VLWHSODQ FRQVWUXFWLRQSODQVPD\EHXVHG LQGLFDWLQJWKHVHOHFWLRQRI%03VDQGWKHLU ORFDWLRQZKHUHDSSURSULDWH 1RQVWRUPZDWHUGLVFKDUJHVWKHLUORFDWLRQVDQGWKH%03VQHFHVVDU\WRSUHYHQWWKH GLVFKDUJH $PDLQWHQDQFHDQGVHOILQVSHFWLRQVFKHGXOHRIWKH%03VWRGHWHUPLQHWKHHIIHFWLYHQHVV DQGQHFHVVDU\UHSDLUVRIWKH%03V DQG $ FHUWLILFDWLRQ VWDWHPHQW WKDW DOO UHTXLUHG DQG VHOHFWHG %03V ZLOO EH HIIHFWLYHO\ LPSOHPHQWHG :LWKLQVHYHQ GD\VDIWHUWKH&LW\DZDUGVWKH&RQWUDFWWKH&RQWUDFWRUVKDOOVXEPLWRQH RULJLQDO KDUGFRS\DQGRQH HOHFWURQLFFRS\YLDHPDLOWRFYHOD]TXH]#FLW\RIYHUQRQRUJRIWKHSURSRVHG 6:333WRWKH&LW\ 7KH&LW\VKDOOUHYLHZWKH6:333ZLWKLQGD\VRIUHFHLSWRIWKHSODQ ,I UHYLVLRQVDUHUHTXLUHGWKH&RQWUDFWRUVKDOOUHYLVHDQGUHVXEPLWWKHGRFXPHQWZLWKLQVHYHQ GD\VRI LWVUHFHLSWRIWKH&LW\¶VFRPPHQWV 7KH&LW\VKDOOWKHQKDYHVHYHQ GD\VWRFRQVLGHUWKHUHYLVLRQV PDGHE\WKH&RQWUDFWRUDQGDSSURYHWKH6:333 7KH&RQWUDFWRUVKDOOPDLQWDLQDPLQLPXPRIWZR UHDGLO\DFFHVVLEOHFRSLHVRIWKH6:333DWWKH 3URMHFWVLWH7KH6:333VKDOOEHPDGHDYDLODEOHXSRQUHTXHVWRIDUHSUHVHQWDWLYHRIWKH/RV Western Allied Corporation Page 27 of 221 . . Item 10 Page 27 of 221 $QJHOHV5HJLRQDO:DWHU4XDOLW\&RQWURO%RDUG /$5:4&% RUWKH86(QYLURQPHQWDO3URWHFWLRQ $JHQF\ 86(3$ 5HTXHVWVE\HQYLURQPHQWDOJURXSVDQGWKHSXEOLFVKDOOEHGLUHFWHGWRWKH &LW\ ' %HVW0DQDJHPHQW3UDFWLFHV 7KHREMHFWLYHRIWKH6:333LVWRLGHQWLI\SRWHQWLDOVRXUFHVRISROOXWLRQWKDWPD\UHDVRQDEO\DIIHFW WKHTXDOLW\RIVWRUPZDWHUGLVFKDUJHDVVRFLDWHGZLWKFRQVWUXFWLRQDFWLYLWLHV 7KHSODQZLOOGHVFULEH DQGHQVXUHWKHLPSOHPHQWDWLRQRI%HVW0DQDJHPHQW3UDFWLFHV %03V ZKLFKZLOOEHXVHGWRUHGXFH SROOXWDQWVLQWKHVWRUPZDWHUGLVFKDUJHVIURPWKHFRQVWUXFWLRQVLWH$%HVW0DQDJHPHQW3UDFWLFHLV GHILQHGDVDQ\SURJUDPWHFKQRORJ\SURFHVVRSHUDWLQJPHWKRGPHDVXUHRUGHYLFHWKDWFRQWUROV SUHYHQWVUHPRYHVRUUHGXFHVSROOXWLRQ 7KH&RQWUDFWRUVKDOOVHOHFWDSSURSULDWH%03VIURPWKH &DOLIRUQLD6WRUPZDWHU%03+DQGERRN0XQLFLSDO,QGXVWULDO1HZ'HYHORSPHQW DQG&RQVWUXFWLRQ 9ROXPHV www.cabmphandbooks.com LQ FRQMXQFWLRQ ZLWK DOO DFWLYLWLHVDQGFRQVWUXFWLRQ RSHUDWLRQV&RSLHVRIWKH&DOLIRUQLD6WRUPZDWHU%03+DQGERRNVPD\EHREWDLQHGIURP &DOLIRUQLD6WRUPZDWHU4XDOLW\$VVRFLDWLRQ 32%R[ /LYHUPRUH&$ www.cabmphandbooks.com &DVKLHU /RV$QJHOHV&RXQW\'3: 6RXWK)UHPRQW$YHQXH $OKDPEUD&$ 7HO1R ( ,PSOHPHQWDWLRQ 7KH &RQWUDFWRU ZLOO EH UHVSRQVLEOH WKURXJKRXW WKH GXUDWLRQ RI WKH3URMHFWIRUWKHLQVWDOODWLRQ PRQLWRULQJLQVSHFWLRQDQGPDLQWHQDQFHRIWKH%03VLQFOXGHGLQWKH6:333DQGIRUUHPRYLQJDQG GLVSRVLQJRIWHPSRUDU\%03V 7KH&RQWUDFWRUPD\EHUHTXLUHGWRLPSOHPHQWDGGLWLRQDO%03VDVD UHVXOWRIFKDQJHVLQDFWXDOILHOGFRQGLWLRQVFRQWUDFWRU¶VDFWLYLWLHVRUFRQVWUXFWLRQRSHUDWLRQV 7KH&RQWUDFWRUVKDOOGHPRQVWUDWHWKHDELOLW\DQGSUHSDUHGQHVVWRIXOO\GHSOR\WKHVH6:333FRQWURO PHDVXUHVWRSURWHFWVRLOGLVWXUEHGDUHDVRIWKHSURMHFWVLWHEHIRUHWKHRQVHWRISUHFLSLWDWLRQDQGVKDOO PDLQWDLQDGHWDLOHGSODQIRUWKHPRELOL]DWLRQRIVXIILFLHQWODERUDQGHTXLSPHQWWRIXOO\GHSOR\WKHVH FRQWUROPHDVXUHV 7KURXJKRXWWKHZLQWHUVHDVRQDFWLYHVRLOGLVWXUEHGDUHDVRIWKHSURMHFWVLWHVKDOOEHIXOO\SURWHFWHG DWWKHHQGRIHDFKGD\ZLWKWKHVHFRQWUROPHDVXUHVXQOHVVIDLUZHDWKHULVSUHGLFWHGWKURXJKWKH IROORZLQJGD\7KH&RQWUDFWRUVKDOOPRQLWRUGDLO\ZHDWKHUIRUHFDVWV,ISUHFLSLWDWLRQLVSUHGLFWHG SULRU WRWKHHQGRIWKHIROORZLQJZRUNGD\FRQVWUXFWLRQVFKHGXOLQJVKDOOEHPRGLILHGDVUHTXLUHGDQGWKH &RQWUDFWRUVKDOOGHSOR\IXQFWLRQLQJFRQWUROPHDVXUHVSULRUWRWKHRQVHWRIWKHSUHFLSLWDWLRQ 7KH&LW\PD\RUGHUWKHVXVSHQVLRQRIFRQVWUXFWLRQRSHUDWLRQVZKLFKDUHFUHDWLQJZDWHUSROOXWLRQLI WKH&RQWUDFWRUIDLOVWRFRQIRUPWRWKHUHTXLUHPHQWVRIWKLV3DUDJUDSK8QOHVVRWKHUZLVHGLUHFWHG E\WKH&LW\WKH&RQWUDFWRU¶VUHVSRQVLELOLW\IRU6:333LPSOHPHQWDWLRQVKDOOFRQWLQXHWKURXJKRXWDQ\ WHPSRUDU\VXVSHQVLRQRIWKH:RUN ) 6HZDJH6SLOO3UHYHQWLRQ7KH&RQWUDFWRU¶VDWWHQWLRQLVGLUHFWHGWRWKHVHZHUE\SDVVRSHUDWLRQ UHTXLUHGGXULQJDQ\VHZHUFRQVWUXFWLRQSXUVXDQWWRWKHHGLWLRQRIWKH³*UHHQERRN´6WDQGDUG 6SHFLILFDWLRQVIRU3XEOLF:RUNV&RQVWUXFWLRQ6HFWLRQRUDVWKDWVHFWLRQLVVXEVHTXHQWO\ DPHQGHG 7KH&RQWUDFWRUVKDOOH[HUFLVHH[WUDRUGLQDU\FDUHWRSUHYHQWWKHFDXVHRIHYHQWVWKDWPD\OHDGWRD VHZDJHVSLOO,QWKHHYHQWRIDVHZDJHVSLOOWKH&RQWUDFWRUVKDOOPDNHDUUDQJHPHQWVIRUDQ Western Allied Corporation Page 28 of 221 . . Item 10 Page 28 of 221 HPHUJHQF\UHVSRQVHXQLWFRPSULVHGRIHPHUJHQF\UHVSRQVHHTXLSPHQWDQGWUDLQHGSHUVRQQHOWREH LPPHGLDWHO\GLVSDWFKHGWRWKHSURMHFWVLWH 7KH&RQWUDFWRUVKDOOEHIXOO\UHVSRQVLEOHIRUSUHYHQWLQJDQGFRQWDLQLQJVHZDJHVSLOOVDVZHOODV UHFRYHULQJDQGSURSHUO\GLVSRVLQJRIUDZVHZDJH ,QDGGLWLRQWKH&RQWUDFWRULVUHVSRQVLEOHIRUDQ\ ILQHVSHQDOWLHVDQGOLDELOLWLHVDULVLQJIURPQHJOLJHQWO\FDXVLQJDVHZDJHVSLOO $Q\XWLOLW\WKDWLV GDPDJHG E\ WKH FRQWUDFWRU VKDOO EH LPPHGLDWHO\ UHSDLUHG DW WKH&RQWUDFWRU¶V H[SHQVH 7KH &RQWUDFWRUVKDOOWDNHDOOPHDVXUHVQHFHVVDU\WRSUHYHQWIXUWKHUGDPDJHRUVHUYLFHLQWHUUXSWLRQDQG WRFRQWDLQDQGFOHDQXSWKHVHZDJHVSLOOV * 6HZDJH6SLOO7HOHSKRQH1RWLILFDWLRQ 6KRXOGDVHZDJHVSLOORFFXUWKH&RQWUDFWRUVKDOOLPPHGLDWHO\UHSRUWWKHLQFLGHQWWRERWKRIWKHVHWZR &LW\'HSDUWPHQWV 6HZHU0DLQWHQDQFH6HUYLFHV&LW\RI 9HUQRQ&RQWURO&HQWHU )LUH'HSDUWPHQW'LVSDWFK&HQWHU 7KH&RQWUDFWRULVHQFRXUDJHGWRREWDLQWHOHSKRQHQXPEHUVSDJHUQXPEHUVDQGFHOOXODUWHOHSKRQH QXPEHUVRI&LW\UHSUHVHQWDWLYHVVXFKDV3URMHFW0DQDJHUVDQG,QVSHFWRUV +RZHYHULIWKHVH&LW\ UHSUHVHQWDWLYHVDUHQRWDYDLODEOHWKHQWKH&RQWUDFWRUVKDOOLPPHGLDWHO\FDOO .HQQHWK-DFNVRQ)DFLOLWLHV6XSHUYLVRU + 6HZDJH6SLOO:ULWWHQ1RWLILFDWLRQ 7KH&RQWUDFWRUVKDOOSUHSDUHDQGVXEPLWDZULWWHQUHSRUWWRWKH'LUHFWRUZLWKLQWKUHH :RUNLQJ 'D\VIURPWKHRFFXUUHQFHRIDVSLOOWRWKH&LW\7KLVUHSRUWVKDOOGHVFULEHDOORIWKHIROORZLQJ 7KHH[DFWORFDWLRQRQWKH7KRPDV*XLGHPDS 7KHQDWXUHDQGYROXPH 7KHGDWHWLPHDQGGXUDWLRQ 7KHFDXVH 7KHW\SHRIUHPHGLDODQGRUFOHDQXSPHDVXUHVWDNHQDQGGDWHDQGWLPH LPSOHPHQWHG 7KHFRUUHFWLYHDQGSUHYHQWLYHDFWLRQWDNHQ 7KHZDWHUERG\LPSDFWHGDQGUHVXOWVRIQHFHVVDU\PRQLWRULQJ , (QIRUFHPHQW 7KH&LW\LVVXEMHFWWRHQIRUFHPHQWDFWLRQVE\WKH/$5:4&%86(3$HQYLURQPHQWDOJURXSVDQG SULYDWHFLWL]HQV7KH&RQWUDFWRUVKDOOLQGHPQLI\GHIHQGDQGKROG&LW\LWVRIILFHUVDJHQWVDQG HPSOR\HHVKDUPOHVVIURP&RQWUDFWRU¶VIDLOXUHWRFRPSO\DQGRUIXOILOOWKHUHTXLUHPHQWVVHWIRUWKLQ WKLV3DUDJUDSK &RQWUDFWRUVKDOOEHUHVSRQVLEOHIRUDOOFRVWVDQGOLDELOLWLHVLPSRVHGE\ODZDV UHVXOWRI&RQWUDFWRU¶VIDLOXUHWRFRPSO\DQGRUIXOILOOWKHUHTXLUHPHQWVVHWIRUWKLQWKLV3DUDJUDSK 7KH FRVWV DQG OLDELOLWLHV LQFOXGH EXW DUH QRW OLPLWHG WR ILQHV SHQDOWLHV DQG GDPDJHV ZKHWKHU DVVHVVHGDJDLQVWWKH&LW\RUWKH&RQWUDFWRU Western Allied Corporation Page 29 of 221 . . Item 10 Page 29 of 221 ,QDGGLWLRQWRDQ\UHPHG\DXWKRUL]HGE\ODZDQ\PRQH\GXHWRWKH&RQWUDFWRUXQGHUWKLVFRQWUDFW VKDOOEHUHWDLQHGE\WKH&LW\XQWLODOOFRVWVDQGOLDELOLWLHVLPSRVHGE\ODZDJDLQVWWKH&LW\RU&RQWUDFWRU KDYHEHHQVDWLVILHG - 0DLQWHQDQFH 7KH&RQWUDFWRUVKDOOHQVXUHWKHSURSHULPSOHPHQWDWLRQDQGIXQFWLRQLQJRI%03FRQWUROPHDVXUHV DQGVKDOOUHJXODUO\LQVSHFWDQGPDLQWDLQWKHFRQVWUXFWLRQVLWHIRUWKH%03VLGHQWLILHGLQWKH6:333 7KH&RQWUDFWRUVKDOOLGHQWLI\FRUUHFWLYHDFWLRQVDQGWLPHIUDPHVLQRUGHUWRSURSHUO\DGGUHVVDQ\ GDPDJHGPHDVXUHRUUHLQLWLDWHDQ\%03VWKDWKDYHEHHQGLVFRQWLQXHG ,IWKH&LW\LGHQWLILHVDGHILFLHQF\LQWKHGHSOR\PHQWRUIXQFWLRQLQJRILGHQWLILHGFRQWUROPHDVXUHVWKH GHILFLHQF\VKDOOEHFRUUHFWHGE\WKH&RQWUDFWRULPPHGLDWHO\RUE\DODWHUGDWHDQGWLPHLIDJUHHGWR E\'LUHFWRUDQGLIUHTXHVWHGLQZULWLQJEXWQRWODWHUWKDQWKHRQVHWRIWKHVXEVHTXHQWSUHFLSLWDWLRQ HYHQWV7KHFRUUHFWLRQRIGHILFLHQFLHVVKDOOEHDWQRDGGLWLRQDOFRVWWRWKH&LW\ . 3D\PHQW $OOFRVWVLQYROYHGLQWKHLPSOHPHQWDWLRQRIWKH6:333LQFOXGLQJIXUQLVKLQJDOOODERUPDWHULDOV WRROVHTXLSPHQWDQGDOOLQFLGHQWDOV DQGIRUGRLQJDOOWKHZRUNLQYROYHGLQLQVWDOOLQJFRQVWUXFWLQJ PDLQWDLQLQJUHPRYLQJDQGGLVSRVLQJRIFRQWUROPHDVXUHVH[FHSWWKRVHWKDWZHUHLQVWDOOHGDVD SDUWRIDQRWKHUVWUXFWXUHVKDOOEHLQFOXGHGLQWKHXQLWSULFHVELGIRUWKHYDULRXVUHODWHGLWHPVRI ZRUNDQGQRDGGLWLRQDOFRPSHQVDWLRQZLOOEHPDGHWKHUHIRU 62/,':$67(',6326$/$1'',9(56,21 7KH&RQWUDFWRUVKDOOVXEPLWWRWKH'LUHFWRUWKHIROORZLQJVXPPDU\RIVROLGZDVWHJHQHUDWHGE\WKH:RUN GLVSRVHGLQ &ODVV,,,ODQGILOOVRUGLYHUWHGIURP GLVSRVDOWKURXJKUHF\FOLQJ 5HSRUWGLVSRVDOLQLQHUWILOO VHSDUDWHO\ 7KLVIRUPPXVWEHDFFRPSDQLHGE\OHJLEOHFRSLHVRIZHLJKWWLFNHWVUHFHLSWVRULQYRLFHVWKDW VSHFLILFDOO\LGHQWLI\WKHSURMHFWJHQHUDWLQJWKHPDWHULDO 6DLGGRFXPHQWVPXVWEHIURPUHF\FOHUVDQGRU GLVSRVDOVLWHRSHUDWRUVWKDWDUHDFFHSWDEOHWRWKH'LUHFWRU )XUWKHUWKHGRFXPHQWVPXVWEHVXEPLWWHGWRWKH 'LUHFWRU ZLWK HDFK DSSOLFDWLRQ IRU SURJUHVV SD\PHQW )DLOXUH WR VXEPLW WKH IRUP DQG LWV VXSSRUWLQJ GRFXPHQWDWLRQZLOOUHQGHUWKHDSSOLFDWLRQIRUSURJUHVVSD\PHQWLQFRPSOHWHDQGGHOD\SURJUHVVSD\PHQWV Western Allied Corporation Page 30 of 221 . . Item 10 Page 30 of 221 6800$5<2)62/,':$67(',6326$/$1'',9(56,21 3URMHFW7LWOH 6SHFLILFDWLRQ1R 7\SHRI0DWHULDO D 'LVSRVHGLQ &ODVV,,,/DQGILOOV E 'LYHUWHGIURP &ODVV,,,/DQGILOOVE\ F >/HDYH7KLV &ROXPQ%ODQN@ G 'LVSRVHGLQ,QHUW )LOOV 7RQV&< 7RQV&<7RQV&< 7RQV&< $VSKDOW &RQFUHWH 0HWDO 2WKHU6HJUHJDWHG 0DWHULDOV 'HVFULEH 0LVFHOODQHRXV &RQVWUXFWLRQ:DVWH 7RWDO )RUPWREHVXEPLWWHGWRWKH&LW\ 5(&<&/('5(86$%/($1'5(&<&/$%/(352'8&76 7KH&RQWUDFWRULVHQFRXUDJHGWRSURSRVHUHF\FOHGUHXVDEOHDQGUHF\FODEOHSURGXFWVIRUXVHE\WKH&LW\ 7KRVHLWHPVVKRXOGEHFOHDUO\LGHQWLILHG 7KH&LW\PD\UHTXLUHIXUWKHULQIRUPDWLRQRUGRFXPHQWDWLRQWR DVFHUWDLQWKHVXLWDELOLW\DSSURSULDWHQHVVRIDSURSRVHGSURGXFW >(1'2)$57,&/(@ 6,*1$785( 7,7/( '$7( Western Allied Corporation Page 31 of 221 . . Item 10 Page 31 of 221 ARTICLE 3 - TIME OF COMMENCEMENT AND COMPLETION &200(1&(0(173526(&87,21$1'&203/(7,212):25. $ 1RWLFHWR3URFHHG 7KH&RQWUDFWRULVQRWDXWKRUL]HGWRSHUIRUPDQ\:RUNWKH&RQWUDFW'RFXPHQWVXQWLOKHVKHKDV UHFHLYHGIURPWKH&LW\DQRIILFLDOQRWLILFDWLRQWRFRPPHQFH:RUN7KHGDWHRQZKLFKWKHQRWLILFDWLRQLV UHFHLYHGE\WKH&RQWUDFWRULVKHUHLQUHIHUUHGWRDVWKH1RWLFHWR3URFHHG 7KH&RQWUDFWRUVKDOO FRPPHQFH:RUNRQWKH'DWHRI&RPPHQFHPHQWHVWDEOLVKHGLQWKH1RWLFHWR3URFHHGLVLVVXHG7KH 1RWLFHWR3URFHHGVKDOOEHLVVXHGDIWHUWKH&RQWUDFWLVSURSHUO\H[HFXWHGERQGVDUHIXUQLVKHGDQG DSSURYHGDQGLQVXUDQFHKDVEHHQVXEPLWWHGDQGDSSURYHG % 3URVHFXWLRQRIWKH:RUN :RUNVKDOOEHFRQWLQXHGDWDOOWLPHVZLWKVXFKIRUFHDQGHTXLSPHQWDVZLOOEHVXIILFLHQWWRFRPSOHWHLW ZLWKLQWKHVSHFLILHGWLPH7KH&RQWUDFWRUH[SUHVVO\SURSRVHVWKDWKHVKHKDVWDNHQLQWRFRQVLGHUDWLRQ DQGPDGHDOORZDQFHVIRUDOORUGLQDU\GHOD\VDQGKLQGUDQFHVWRWKH:RUNWREHSHUIRUPHGDQGWKDW KHVKHZLOOFRPSOHWHWKH:RUNZLWKLQWKHVSHFLILHGWLPH & 5HTXLUHG&RQWUDFW&RPSOHWLRQ 7LPHLVRIWKHHVVHQFHLQWKHFRPSOHWLRQRIWKLV&RQWUDFW7KH:RUNVKDOOEHFRPSOHWHGLQLWVHQWLUHW\ DQGPDGHUHDG\IRUVHUYLFHZLWKLQWKLUW\ FDOHQGDUGD\VIROORZLQJWKH'DWHRI&RPPHQFHPHQW HVWDEOLVKHGLQWKH1RWLFHWR3URFHHG ³&RQWUDFW7LPH´ %\H[HFXWLQJWKH&RQWUDFW&RQWUDFWRUFRQILUPV WKDWWKH&RQWUDFW7LPHLVDUHDVRQDEOHSHULRGIRUSHUIRUPLQJWKH:RUN &,7< 6',6&5(7,2172(;7(1'&2175$&77,0( ,QWKHHYHQWWKH:RUNUHTXLUHGKHUHXQGHULVQRWVDWLVIDFWRULO\FRPSOHWHGLQDOOSDUWVDQGLQFRPSOLDQFHZLWKWKH &RQWUDFW'RFXPHQWV&LW\VKDOOKDYHWKHULJKWLQLWVVROHGLVFUHWLRQWRLQFUHDVHWKHQXPEHURI:RUNLQJ'D\VRU QRWDVPD\VHHPEHVWWRVHUYHWKHLQWHUHVWRI&LW\ $FKDQJHRUGHUH[WHQGLQJWKH&RQWUDFW7LPHRQO\ZLOOEH LVVXHGE\WKH&LW\VKRXOGWKH&LW\GHFLGHWRLQFUHDVHWKHQXPEHURI:RUNLQJ'D\V 68%67$17,$/&203/(7,21 $ &RQWUDFWRU5HTXHVWIRU,QVSHFWLRQDQG3XQFK/LVW :KHQ WKH &RQWUDFWRU FRQVLGHUV WKDW LW KDV DFKLHYHG 6XEVWDQWLDO&RPSOHWLRQ RI WKH :RUN RU GHVLJQDWHG SRUWLRQ WKHUHRI &RQWUDFWRU VKDOO SUHSDUH DQG VXEPLW WR WKH 'LUHFWRU D UHTXHVW IRU LQVSHFWLRQDQGDFRPSUHKHQVLYHSXQFKOLVWRILWHPVWREHFRPSOHWHGRUFRUUHFWHGSULRUWR)LQDO 3D\PHQW )DLOXUHWRLQFOXGHDQLWHPRQVXFKSXQFKOLVWGRHVQRWDOWHUWKHUHVSRQVLELOLW\RIWKH &RQWUDFWRUWRFRPSOHWHDOO:RUNLQDFFRUGDQFHZLWKWKH&RQWUDFW'RFXPHQWV % &LW\,QVSHFWLRQ 8SRQUHFHLSWRIWKH&RQWUDFWRU VSXQFKOLVWWKH'LUHFWRUZLOOPDNHDQLQVSHFWLRQWRGHWHUPLQH ZKHWKHUWKH:RUNRUGHVLJQDWHGSRUWLRQWKHUHRILV6XEVWDQWLDOO\&RPSOHWH,IWKHLQVSHFWLRQ GLVFORVHVDQ\LWHPZKHWKHURUQRWLQFOXGHGRQWKH&RQWUDFWRU VSXQFKOLVWZKLFKLVQRWVXIILFLHQWO\ FRPSOHWHLQDFFRUGDQFHZLWKWKH&RQWUDFW'RFXPHQWVVRWKDWWKH&LW\FDQRFFXS\RUXWLOL]HWKH :RUNRUGHVLJQDWHGSRUWLRQWKHUHRIIRULWVLQWHQGHGXVHWKH&RQWUDFWRUVKDOOEHIRUH&LW\ VLVVXDQFH RIWKH&HUWLILFDWHRI6XEVWDQWLDO&RPSOHWLRQFRPSOHWHRUFRUUHFWVXFKLWHPXSRQQRWLILFDWLRQE\&LW\ Western Allied Corporation Page 32 of 221 . . Item 10 Page 32 of 221 7KH&RQWUDFWRUVKDOOWKHQVXEPLWDUHTXHVWIRUDQRWKHULQVSHFWLRQE\&LW\WRGHWHUPLQH6XEVWDQWLDO &RPSOHWLRQ & &HUWLILFDWHRI6XEVWDQWLDO&RPSOHWLRQ :KHQWKH:RUNRUGHVLJQDWHGSRUWLRQWKHUHRILVVXEVWDQWLDOO\FRPSOHWHWKH'LUHFWRUZLOOSUHSDUHD &HUWLILFDWHRI6XEVWDQWLDO&RPSOHWLRQZKLFKVKDOOHVWDEOLVKWKHGDWHRI6XEVWDQWLDO&RPSOHWLRQVKDOO HVWDEOLVKUHVSRQVLELOLWLHVRIWKH&LW\DQG&RQWUDFWRUIRUVHFXULW\PDLQWHQDQFHXWLOLWLHVGDPDJHWRWKH :RUNDQGLQVXUDQFHDQGVKDOOIL[WKHWLPHZLWKLQZKLFKWKH&RQWUDFWRUVKDOOILQLVKDOOLWHPVRQWKH &RQWUDFWRU¶V SXQFK OLVW DFFRPSDQ\LQJWKH&HUWLILFDWH :DUUDQWLHV UHTXLUHG E\ WKH &RQWUDFW 'RFXPHQWVVKDOOFRPPHQFHRQWKHGDWHRI6XEVWDQWLDO&RPSOHWLRQRIWKH:RUN &RQWUDFWRUVKDOO GHOLYHUWR&LW\DOOZDUUDQW\DQGJXDUDQWHHGRFXPHQWVDQGSROLFLHV '(/$<6$1'(;7(16,2162)7,0()25&2175$&725 $ 7KH&RQWUDFWRUVKDOOWDNHUHDVRQDEOHSUHFDXWLRQVWRIRUHVHHDQGSUHYHQWGHOD\VWRWKH:RUN ,QWKH HYHQWRIDQ\GHOD\WRWKH:RUNWKH&RQWUDFWRUVKDOOUHYLVHKLVKHUVHTXHQFHRIRSHUDWLRQVWRWKH H[WHQWSRVVLEOHXQGHUWKHWHUPVRIWKH&RQWUDFWWRRIIVHWWKHGHOD\ % ,IDQ\GHOD\WRWKH:RUNLVFDXVHGE\FLUFXPVWDQFHVZLWKLQWKH&RQWUDFWRU VFRQWUROLWLVQRWH[FXVDEOH DQGQRWFRPSHQVDEOHDQGWKH&RQWUDFWRUZLOOQRWEHHQWLWOHGWRDQ\H[WHQVLRQRIWLPHRUWRDQ\RWKHU FRPSHQVDWLRQIRUGDPDJHVUHVXOWLQJGLUHFWO\RULQGLUHFWO\WKHUHIURP & ,IDQ\GHOD\KDYLQJDGLUHFWHIIHFWRQWKH:RUNLVFDXVHGE\FLUFXPVWDQFHVEH\RQGWKHFRQWURORIWKH &RQWUDFWRUH[FHSWIRUFDXVHVRIGHOD\VSHFLILHGLQ3DUDJUDSK'VXFKGHOD\PD\EHH[FXVDEOH DQGPD\HQWLWOHWKH&RQWUDFWRUWRDQHTXLYDOHQWH[WHQVLRQRIWLPHEXWQRWWRDQ\RWKHUFRPSHQVDWLRQ ([FXVDEOHEXWQRWFRPSHQVDEOHFDXVHVLQFOXGHEXWDUHQRWOLPLWHGWRODERUGLVSXWHVZHDWKHU FRQGLWLRQVXQIDYRUDEOHIRUSURVHFXWLRQRIWKH:RUNDQGIRUFHPDMHXUH ' ,IDQ\GHOD\KDYLQJDGLUHFWHIIHFWRQWKH:RUNLVFDXVHGE\IDLOXUHRIWKH&LW\WRSURYLGHLQIRUPDWLRQ DVVSHFLILHGRUQHFHVVDU\LQVWUXFWLRQVIRUFDUU\LQJRQWKH:RUNRUWRSURYLGHWKHQHFHVVDU\ULJKWRI ZD\RUVLWHIRULQVWDOODWLRQRUIDLOXUHRIDXWLOLW\WRUHPRYHRUUHORFDWHDQH[LVWLQJIDFLOLW\VXFKGHOD\ PD\EHFRPSHQVDEOHDQGPD\HQWLWOHWKH&RQWUDFWRUWRDQHTXLYDOHQWH[WHQVLRQRIWLPHDQGWR FRPSHQVDWLRQIRUGDPDJHVUHVXOWLQJGLUHFWO\IURPDQ\RIWKHFDXVHVRIGHOD\VSHFLILHGLQWKLV SDUDJUDSK ( 7KH&RQWUDFWRUVKDOOQRWLI\WKH'LUHFWRULQZULWLQJRIDQ\GHOD\KDYLQJDGLUHFWHIIHFWRQWKH:RUNDQG WKHFDXVHVWKHUHRIZLWKLQGD\VIURPWKHEHJLQQLQJRIVXFKGHOD\ ) $Q\FODLPIRUDQH[WHQVLRQRIWLPHRUIRUFRPSHQVDWLRQIRUGDPDJHVUHVXOWLQJIURPGHOD\VKDOOEH PDGHLQZULWLQJWRWKH'LUHFWRUQRWPRUHWKDQGD\VDIWHUWKHHQGLQJRIVXFKGHOD\7KH&RQWUDFWRU VKDOOSURYLGHDZULWWHQUHSRUWHYDOXDWLQJWKHLPSDFWRIWKHGHOD\ZKLFKVKDOOLQFOXGHDWDPLQLPXP DOORIWKHIROORZLQJ DQDUUDWLYHGHVFULSWLRQRIWKHGHOD\DQGLWVLPSDFWRQWKHFULWLFDOSDWKWR6XEVWDQWLDO&RPSOHWLRQRI WKH:RUNRUDSRUWLRQRIWKH:RUNGHVLJQDWHGE\&LW\ DGHWDLOHGEUHDNGRZQRIWKH$OORZDEOH&RVWVLIDQ\VRXJKWE\&RQWUDFWRUGXHWRWKHGHOD\ WKHQXPEHURIGD\VRIH[WHQVLRQVRXJKWE\&RQWUDFWRUDVDQDGMXVWPHQWWRWKH&RQWUDFWWLPH DVWDWHPHQWWKDW&RQWUDFWRUKDVFRPSOLHGZLWKWKHUHTXLUHPHQWVRIWKH*HQHUDO&RQGLWLRQVIRU ZULWWHQQRWLFHRIGHOD\VDORQJZLWKWKHGDWHVDQGFRSLHVRIVXFKQRWLFHV WKHPHDVXUHVWDNHQE\&RQWUDFWRUDQG6XEFRQWUDFWRUVWRSUHYHQWRUPLQLPL]HWKHGHOD\ DQG Western Allied Corporation Page 33 of 221 . . Item 10 Page 33 of 221 WKH&RQWDFWRU¶VUHFRPPHQGDWLRQVIRUUHRUGHULQJRUUHVHTXHQFLQJWKH:RUNWRDYRLGRUPLQLPL]H IXUWKHUGHOD\ 1RH[WHQVLRQRIWLPHRUFRPSHQVDWLRQIRUGDPDJHVUHVXOWLQJIURPGHOD\ZLOOEHJUDQWHGXQOHVVWKH GHOD\DIIHFWVWKHWLPHO\FRPSOHWLRQRIWKHRYHUDOO:RUNXQGHUWKH&RQWUDFWRUWKHWLPHO\FRPSOHWLRQ RIDSRUWLRQRIWKH:RUNIRUZKLFKDWLPHRIFRPSOHWLRQLVVSHFLILHG * 7KH'LUHFWRUZLOOLQYHVWLJDWHWKHIDFWVDQGDVFHUWDLQWKHH[WHQWRIWKHGHOD\DQGKLVKHUILQGLQJV WKHUHRQVKDOOEHILQDODQGFRQFOXVLYH + )DLOXUHRIWKH&RQWUDFWRUWRJLYHZULWWHQQRWLFHRIDGHOD\RUWRVXEPLWRUGRFXPHQWDFODLPIRUDQ H[WHQVLRQRIWLPHRUIRUGDPDJHVUHVXOWLQJIURPGHOD\LQWKHPDQQHUDQGZLWKLQWKHWLPHVVWDWHG DERYHVKDOOFRQVWLWXWHDZDLYHURIDOOFODLPVWKHUHWR , :KHQD&RQWUDFWRUH[SHULHQFHVWZRFRQFXUUHQWGHOD\VRQHFRPSHQVDEOHDQGWKHRWKHUH[FXVDEOH QRFRPSHQVDWLRQRWKHUWKDQDQH[WHQVLRQRIWLPHZLOOEHDOORZHG - $QH[WHQVLRQRIWLPHPXVWEHDSSURYHGE\WKH'LUHFWRUWREHHIIHFWLYHEXWDQH[WHQVLRQRIWLPH ZKHWKHUZLWKRUZLWKRXWFRQVHQWRIWKHVXUHWLHVVKDOOQRWUHOHDVHWKHVXUHWLHVIURPWKHLUREOLJDWLRQV ZKLFKVKDOOUHPDLQLQIXOOIRUFHXQWLOWKHGLVFKDUJHRIWKH&RQWUDFW &/,0$7,&&21',7,216 $ 7KH'LUHFWRUPD\VXVSHQGWKH:RUNZKHQHYHUZHDWKHUFRQGLWLRQVRUFRQGLWLRQVUHVXOWLQJIURP LQFOHPHQWZHDWKHUDUHXQIDYRUDEOHIRUWKHSURVHFXWLRQRIWKH:RUN 7KHGHOD\FDXVHGE\VXFK VXVSHQVLRQPD\HQWLWOHWKH&RQWUDFWRUWRDQH[WHQVLRQRIWLPHEXWQRWWRDQ\RWKHUFRPSHQVDWLRQ % ,IWKH&RQWUDFWRUEHOLHYHVWKDW:RUNVKRXOGEHVXVSHQGHGXQGHUWKLV3DUDJUDSKKHVKHPD\ UHTXHVWVXFKVXVSHQVLRQ 7KHGHOD\FDXVHGE\VXFKVXVSHQVLRQPD\HQWLWOHWKH&RQWUDFWRUWRDQ H[WHQVLRQRIWLPHEXWQRWWRDQ\RWKHUFRPSHQVDWLRQ & 1RH[WHQVLRQRIWLPHZLOOEHJUDQWHGIRUVXVSHQVLRQRI:RUNXQOHVVWKHVXVSHQVLRQDIIHFWVWKHWLPHO\ FRPSOHWLRQRIDOO:RUNXQGHUWKH&RQWUDFWRUWKHWLPHO\FRPSOHWLRQRIDSRUWLRQRIWKH:RUNIRUZKLFK DWLPHRIFRPSOHWLRQLVVSHFLILHG'HWHUPLQDWLRQWKDWWKHVXVSHQVLRQIRULQFOHPHQWZHDWKHUFRQGLWLRQV RUFRQGLWLRQVUHVXOWLQJIURPLQFOHPHQWZHDWKHUDIIHFWVWLPHO\FRPSOHWLRQDQGHQWLWOHVWKH&RQWUDFWRU WRDQH[WHQVLRQRIWLPHVKDOOEHPDGHDQGDJUHHGWRLQZULWLQJE\WKH'LUHFWRUDQGWKH&RQWUDFWRURQ HDFKGD\WKDW:RUNLVVXVSHQGHG,QWKHHYHQWRIIDLOXUHWRDJUHHWKH&RQWUDFWRUPD\SURWHVWXQGHU WKHSURYLVLRQVRI3DUDJUDSK ' ,I:RUNLVVXVSHQGHGDQGDQH[WHQVLRQRIWLPHLVJUDQWHGXQGHUWKLV3DUDJUDSKWKH&RQWUDFWRU ZLOOEHHQWLWOHGWRDRQHGD\H[WHQVLRQRIWLPHIRUHDFKGD\WKDWKHVKHLVXQDEOHWR:RUNDWOHDVWRQH KDOIRIKLVKHUFXUUHQWQRUPDO:RUNGD\ DQGLIWKH:RUNLVVXVSHQGHGDWWKHUHJXODUVWDUWLQJWLPHRQ DQ\:RUNGD\DQGWKH&RQWUDFWRU V:RUNIRUFHLVGLVPLVVHGDVDUHVXOWWKHUHRIWKHQKHVKHZLOOEH HQWLWOHGWRDRQHGD\H[WHQVLRQRIWLPHZKHWKHURUQRWFRQGLWLRQVFKDQJHWKHUHDIWHUDQGWKHPDMRU SRUWLRQRIWKHGD\LVVXLWDEOHIRU:RUN &203/(7,21$1'$&&(37$1&( $ 8SRQUHTXHVWE\WKH&RQWUDFWRUWKH'LUHFWRUVKDOOFRQGXFWDILQDOLQVSHFWLRQRIWKH:RUN ,ILQWKH 'LUHFWRU¶VRSLQLRQ)LQDO&RPSOHWLRQKDVEHHQDFKLHYHGWKH'LUHFWRUZLOODFFHSWWKH:RUNE\LVVXLQJD ³1RWLFHRI&RPSOHWLRQ´RIWKH:RUNWRWKH&RQWUDFWRU8SRQWKHLVVXDQFHRIWKH1RWLFHRI&RPSOHWLRQ WKH&RQWUDFWRUZLOOEHUHOLHYHGIURPUHVSRQVLELOLW\WRSURWHFWWKH:RUN % :LWKLQFDOHQGDUGD\VDIWHULVVXLQJWKH1RWLFHRI&RPSOHWLRQWKH'LUHFWRUZLOOUHFRUGWKH1RWLFHRI Western Allied Corporation Page 34 of 221 . . Item 10 Page 34 of 221 &RPSOHWLRQZLWKWKH&RXQW\5HFRUGHU /,48,'$7(''$0$*(6 $ &RQWUDFWRUDQG&LW\DJUHHWROLTXLGDWHGDPDJHVLQWKHDPRXQWRIWZRKXQGUHGILIW\GROODUV SHU GD\ZLWKUHVSHFWWR&RQWUDFWRU¶VIDLOXUHWRDFKLHYH6XEVWDQWLDO&RPSOHWLRQRIWKH:RUNZLWKLQWKH &RQWUDFW7LPH7KH3DUWLHVLQWHQGIRUWKHOLTXLGDWHGGDPDJHVVHWIRUWKKHUHLQWRDSSO\WRWKLV&RQWUDFW DVVHWIRUWKLQ*RYHUQPHQW&RGH6HFWLRQ 7KH&RQWUDFWRUDFNQRZOHGJHVDQGDJUHHVWKDWWKH OLTXLGDWHGGDPDJHVDUHLQWHQGHGWRFRPSHQVDWH&LW\VROHO\IRUWKH&RQWUDFWRU¶VIDLOXUHWRPHHWWKH GHDGOLQHIRU6XEVWDQWLDO&RPSOHWLRQDQGVKDOOQRWH[FXVH&RQWUDFWRUIURPOLDELOLW\IURPDQ\RWKHU EUHDFKLQFOXGLQJDQ\IDLOXUHRIWKH:RUNWRFRQIRUPWRWKHUHTXLUHPHQWVRIWKH&RQWUDFW'RFXPHQWV % ,QWKHHYHQWWKDW&RQWUDFWRUIDLOVWRDFKLHYH6XEVWDQWLDO&RPSOHWLRQRIWKH:RUNZLWKLQWKH&RQWUDFW 7LPH&RQWUDFWRUDJUHHVWRSD\&LW\WKHDPRXQWVSHFLILHGLQWKH&RQWUDFWIRUPIRUHDFKFDOHQGDUGD\ WKDW6XEVWDQWLDO&RPSOHWLRQLVGHOD\HG & &RQWUDFWRUDQG&LW\DFNQRZOHGJHDQGDJUHHWKDWWKHIRUHJRLQJOLTXLGDWHGGDPDJHVKDYHEHHQVHW EDVHGRQDQHYDOXDWLRQRIGDPDJHVWKDWWKH&LW\ZLOOLQFXULQWKHHYHQWRIODWHFRPSOHWLRQRIWKH:RUN &RQWUDFWRUDQG&LW\DFNQRZOHGJHDQGDJUHHWKDWWKHDPRXQWRIVXFKGDPDJHVDUHLPSRVVLEOHWR DVFHUWDLQDVRIWKHHIIHFWLYHGDWHKHUHRIDQGKDYHDJUHHGWRVXFKOLTXLGDWHGGDPDJHVWRIL[&LW\¶V GDPDJHVDQGWRDYRLGODWHUGLVSXWHV ,WLVXQGHUVWRRGDQGDJUHHGE\&RQWUDFWRUWKDWOLTXLGDWHG GDPDJHVSD\DEOHSXUVXDQWWRWKLV$JUHHPHQWDUHQRWDSHQDOW\DQGWKDWVXFKDPRXQWDUHQRWPDQLIHVWO\ XQUHDVRQDEOHXQGHUWKHFLUFXPVWDQFHVH[LVWLQJDVRIWKHHIIHFWLYHGDWHRIWKLV$JUHHPHQW ' ,WLVIXUWKHUPXWXDOO\DJUHHGWKDW&LW\VKDOOKDYHWKHULJKWWRGHGXFWOLTXLGDWHGGDPDJHVDJDLQVWSURJUHVV SD\PHQWVRUUHWDLQDJHDQGWKDWWKH&LW\ZLOOLVVXHD&RQVWUXFWLRQ&KDQJH'LUHFWLYHDQGUHGXFHWKH &RQWUDFW6XPDFFRUGLQJO\,QWKHHYHQWWKHUHPDLQLQJXQSDLG&RQWUDFW6XPLVLQVXIILFLHQWWRFRYHUWKH IXOODPRXQWRIOLTXLGDWHGGDPDJHV&RQWUDFWRUVKDOOSD\WKHGLIIHUHQFHWR&LW\ >(1'2)$57,&/(@ Western Allied Corporation Page 35 of 221 . . Item 10 Page 35 of 221 ARTICLE 4 - CONSTRUCTION SCHEDULES %$6(/,1(352-(&76&+('8/( 7KH&RQWUDFWRUVKDOOVXEPLWKLVKHUZRUN%DVHOLQH3URMHFW6FKHGXOHLQHOHFWURQLFDVZHOODVKDUGFRS\IRUPDW WRWKH'LUHFWRUDWWKHSUHFRQVWUXFWLRQPHHWLQJVKRZLQJLQGHWDLOKRZWKH&RQWUDFWRUSODQVWRH[HFXWHDQG FRRUGLQDWHWKH:RUN7KHFRQVWUXFWLRQVFKHGXOHVKDOOVKRZWKHVHTXHQFHRIZRUNFULWLFDOSDWKDQGHVWLPDWHG WLPHIRUFRPSOHWLRQRIHDFKVHJPHQWRIZRUN7KLVVFKHGXOHPXVWEHUHYLHZHGDQGDFFHSWHGE\WKH'LUHFWRU EHIRUHWKH&RQWUDFWRUZLOOEHSHUPLWWHGWREHJLQZRUN,QDGGLWLRQWKH&RQWUDFWRUVKDOOVXEPLWDGHWDLOHGVFKHGXOH IRUHFDVWLQJWZR ZHHNVRIZRUNGHVFULELQJHDFKGD\¶VZRUN7KLVVFKHGXOHVKDOOEHXSGDWHGDQGVXEPLWWHGWR WKH&LW\HYHU\RWKHU0RQGD\GXULQJWKHFRQVWUXFWLRQSHULRG7KH&RQWUDFWRUVKDOOJLYHKRXUVQRWLFHWRWKH&LW\ (QJLQHHUSULRUWRWKHVWDUWRIWKHZRUN $ )RUPDW $WDPLQLPXPWKH%DVHOLQH3URMHFW6FKHGXOHDFWLYLWLHVVKDOOEHFRGHGRQDZRUNGLVFLSOLQHEDVLV DQGE\JHRJUDSKLFDUHDRUORFDWLRQRQWKH3URMHFW7KH%DVHOLQH3URMHFW6FKHGXOHVKDOOLQFOXGHD GHWDLOHGGHVFULSWLRQRIHDFKDFWLYLW\FRGH7KH%DVHOLQH3URMHFW6FKHGXOHVKDOOEHEDVHGRQDQG LQFRUSRUDWHFRQWUDFWPLOHVWRQHDQGFRPSOHWLRQGDWHVVSHFLILHGLQWKH&RQWUDFW'RFXPHQWV ,WVKDOO GHSLFWHYHQWVMREVDQGWKHLULQWHUUHODWLRQVKLSVDQGVKDOOUHFRJQL]HWKHSURJUHVVWKDWPXVWEHPDGH RQRQHWDVNEHIRUHVXEVHTXHQWWDVNVFDQEHJLQ7KHVFKHGXOHVKDOOEHFRPSUHKHQVLYHDQGVKDOO LQFOXGHDOOORJLFDOLQWHUGHSHQGHQFLHVDQGLQWHUDFWLRQVUHTXLUHGWRSHUIRUPWKH:RUNRIWKH3URMHFW 2YHUDOOWLPHRIFRPSOHWLRQDQGWLPHRIFRPSOHWLRQIRUHDFKPLOHVWRQHVKRZQRQWKH6FKHGXOHVKDOO DGKHUHWRWKHVSHFLILHG&RQWUDFW7LPHXQOHVVDQHDUOLHU DGYDQFHG WLPHRIFRPSOHWLRQLV UHTXHVWHGE\&RQWUDFWRUDJUHHGWRE\WKH&LW\DQGIRUPDOL]HGE\&KDQJH2UGHU &RQWUDFWRUVKDOOXVHWKHODWHVWYHUVLRQRI0LFURVRIW3URMHFWRUHTXLYDOHQWVRIWZDUHDJUHHGWRE\ WKHSDUWLHV 7KH &LW\ ZLOOUHYLHZWKH VXEPLWWHG%DVHOLQH3URMHFW6FKHGXOHIRU FRQIRUPDQFHZLWK WKHVH VFKHGXOLQJUHTXLUHPHQWV:LWKLQIRXUWHHQ FDOHQGDUGD\VDIWHUUHFHLSWWKH&LW\ZLOODFFHSWWKH SURSRVHG%DVHOLQH3URMHFW6FKHGXOHRUZLOOUHWXUQLWZLWKFRPPHQWV ,IWKHSURSRVHG%DVHOLQH 3URMHFW6FKHGXOHLVDFFHSWHGE\WKH&LW\LWVKDOOEHGHHPHGSDUWRIWKH&RQWUDFW'RFXPHQWV ,I WKH%DVHOLQH3URMHFW6FKHGXOHLVQRWDFFHSWHGE\&LW\&RQWUDFWRUVKDOOUHYLVHWKH%DVHOLQH3URMHFW 6FKHGXOH LQ DFFRUGDQFH ZLWK WKH UHFRPPHQGDWLRQV RI WKH &LW\ DQG UHVXEPLW VDPH IRU DFFHSWDQFHQRODWHUWKDQVHYHQ FDOHQGDUGD\VDIWHUUHFHLSWRIVDLGUHFRPPHQGDWLRQ $FFHSWDQFHRI%DVHOLQH3URMHFW6FKHGXOHE\&LW\IDLOXUHWRLQFOXGHDQHOHPHQWRIZRUNRU LQDFFXUDF\LQ%DVHOLQH3URMHFW6FKHGXOHVKDOOQRWUHOLHYH&RQWUDFWRUIURPWKHUHVSRQVLELOLW\IRU DFFRPSOLVKLQJWKH:RUNLQDFFRUGDQFHZLWKWKH&RQWUDFW'RFXPHQWV % )ORDW &ULWLFDO:RUNDFWLYLWLHVDUHGHILQHGDV:RUNDFWLYLWLHVZKLFKLIGHOD\HGRUH[WHQGHGZLOOGHOD\WKH VFKHGXOHGFRPSOHWLRQRIWKHPLOHVWRQHVDQGRUWLPHRIFRPSOHWLRQ $OORWKHU:RUNDFWLYLWLHVDUH GHILQHGDVQRQFULWLFDO:RUNDFWLYLWLHVDQGDUHFRQVLGHUHGWRKDYHIORDW )ORDWLVGHILQHGDVWKH WLPHWKDWDQRQFULWLFDO:RUNDFWLYLW\FDQEHGHOD\HGRUH[WHQGHGZLWKRXWGHOD\LQJWKHVFKHGXOHG FRPSOHWLRQRIWKHPLOHVWRQHVDQGRUWLPHRIFRPSOHWLRQ )ORDWLVFRQVLGHUHGD3URMHFWUHVRXUFH DYDLODEOHWRHLWKHUSDUW\RUERWKSDUWLHVDVQHHGHG 2QFHLGHQWLILHG&RQWUDFWRUVKDOOPRQLWRU DFFRXQWIRUDQGPDLQWDLQIORDWLQDFFRUGDQFHZLWK&ULWLFDO3DWK0HWKRGRORJ\ Western Allied Corporation Page 36 of 221 . . Item 10 Page 36 of 221 'HOD\VRIDQ\QRQFULWLFDO:RUNVKDOOQRWEHWKHEDVLVIRUDQH[WHQVLRQRI&RQWUDFW7LPHXQWLOWKH GHOD\VFRQVXPHDOOIORDWDVVRFLDWHGZLWKWKDWQRQFULWLFDO:RUNDFWLYLW\DQGFDXVHWKH:RUNDFWLYLW\ WREHFRPHFULWLFDO ,WLVDFNQRZOHGJHGWKDW&LW\FDXVHGWLPHVDYLQJV LHFULWLFDOSDWKVXEPLWWDOUHYLHZVUHWXUQHGLQ OHVVWLPHWKDQDOORZHGE\WKH&RQWUDFW'RFXPHQWVDSSURYDORIVXEVWLWXWLRQUHTXHVWVZKLFKUHVXOW LQDVDYLQJVRIWLPHIRU&RQWUDFWRUHWF FUHDWHVKDUHGIORDW $FFRUGLQJO\&LW\FDXVHGGHOD\VPD\ EHRIIVHWE\&LW\FDXVHGWLPHVDYLQJV & :HDWKHU 7KLVVHFWLRQDSSOLHVRQO\WRSURMHFWVRIRQH \HDUGXUDWLRQRUORQJHU 7KHFRPSOHWLRQWLPHFRQWHPSODWHGE\WKLV&RQWUDFWDQWLFLSDWHV]HUR ORVWGD\V :RUN'D\V GXHWR QRUPDOZHDWKHUFRQGLWLRQVDQQXDOO\DQGSURUDWHGIRUDQ\GXUDWLRQOHVVWKDQWZHOYHPRQWKV 2QO\ XQXVXDORUH[WUHPHZHDWKHUFRQGLWLRQVDVGHWHUPLQHGE\WKH1DWLRQDO2FHDQLFDQG$WPRVSKHULF $GPLQLVWUDWLRQIRUWKHWLPHRI\HDUZLOOEHFRQVLGHUHGDVMXVWLILFDWLRQIRUDQH[WHQVLRQRIWLPHWRFRPSOHWH WKH3URMHFWDQGRQO\DIWHUWKH]HUR ZHDWKHUGD\VKDYHEHHQXWLOL]HG$QQXDOZHDWKHUGD\VDUHQRW FXPXODWLYHDQGXQXVHGGD\VVKDOOEHFRPH³IORDW´IRUWKHEHQHILWRIWKHSURMHFWDQGWKHVFKHGXOH DGMXVWHGDFFRUGLQJO\7KHXVHRIZHDWKHUGD\VE\WKH&RQWUDFWRUVKDOOEHVXEMHFWWRDOOWKHFRQGLWLRQV RIFODLPIRUDQH[WHQVLRQRIWLPH7KH&RQWUDFWRUVKDOOQRWLI\WKH&LW\LQZULWLQJZLWKLQWHQ GD\VRI WKHFRPPHQFHPHQWRIHDFKUDLQHYHQW ' (DUO\&RPSOHWLRQ :KLOHWKH&RQWUDFWRUPD\VFKHGXOHFRPSOHWLRQRIWKH3URMHFWHDUOLHUWKDQWKHGDWHHVWDEOLVKHGE\WKH &RQWUDFW'RFXPHQWVQRDGGLWLRQDOFRPSHQVDWLRQVKDOOEHFRPHGXHWKH&RQWUDFWRUIRUWKHXVHRIIORDW WLPHEHWZHHQWKH&RQWUDFWRU¶VSURMHFWHGHDUO\FRPSOHWLRQGDWHDQGWKHGDWHIRU6XEVWDQWLDO&RPSOHWLRQ HVWDEOLVKHGE\WKH&RQWUDFW'RFXPHQWVXQOHVVDQHDUOLHU DGYDQFHG WLPHRIFRPSOHWLRQLVUHTXHVWHG E\&RQWUDFWRUDJUHHGWRE\WKH&LW\DQGIRUPDOL]HGE\&KDQJH2UGHU 6&+('8/(83'$7(6 $ :LWKHDFK$SSOLFDWLRQIRU3D\PHQWVXEPLWWHGE\&RQWUDFWRU RWKHUWKDQWKHILQDO$SSOLFDWLRQIRU 3D\PHQW WKH&RQWUDFWRUVKDOOVXEPLWWRWKH&LW\DQXSGDWHG3URMHFW6FKHGXOHUHYLVHGWRLQGLFDWHWKH :RUNFRPSOHWHGVWDWXVRI:RUNLQSURJUHVVDOOSURJUHVVVOLSSDJHVFRUUHFWLYHDFWLRQVWDNHQRU VOLSSDJHFDUU\RYHUIRUDOODQWLFLSDWHGGHOD\VRUGLIILFXOWLHVDQGDOORWKHULQIRUPDWLRQUHTXLUHGWR DFFXUDWHO\SUHVHQWWKHDFWXDOVWDWXVRIWKHSURJUHVVRIWKH:RUNDVRIWKHGDWHRIWKH$SSOLFDWLRQIRU 3D\PHQW ,IWKH&RQWUDFWRUGRHVQRWVXEPLWDQXSGDWHG3URMHFW6FKHGXOHZLWKDQ$SSOLFDWLRQIRU 3D\PHQW&LW\PD\ZLWKKROGSD\PHQWLQZKROHRULQSDUWXQWLOWKHXSGDWHG3URMHFW6FKHGXOHLV VXEPLWWHG,QWKHHYHQWWKDWDQXSGDWHWRWKH3URMHFW6FKHGXOHLQGLFDWHVDGHOD\WRWKH&RQWUDFW7LPH WKH&RQWUDFWRUVKDOOSURSRVHDQDIILUPDWLYHSODQWRFRUUHFWHDFKVXFKGHOD\LQFOXGLQJRYHUWLPHDQGRU DGGLWLRQDOODERULIQHFHVVDU\,QQRHYHQWVKDOODQ\3URMHFW6FKHGXOHXSGDWHFRQVWLWXWHDQDGMXVWPHQW LQWKH&RQWUDFW7LPHDQ\GHDGOLQHRUWKH&RQWUDFW6XPXQOHVVDQ\VXFKDGMXVWPHQWLVDJUHHGWRE\ WKH&LW\DQGDXWKRUL]HGSXUVXDQWWR&KDQJH2UGHURU:RUN'LUHFWLYH % $WQRWLPHVKDOOKLVWRULFDOGDWDFRQWDLQHGZLWKLQWKHXSGDWHG3URMHFW6FKHGXOH LHFRPSOHWHGDFWLYLWLHV EHUHPRYHGDQGRUDOWHUHGLQDQ\ZD\7KLVKLVWRULFDOGDWDLVW REHSUHVHUYHGZLWKLQHDFKRIWKHXSGDWHG 3URMHFW6FKHGXOHVDQGVXEPLWWHGZLWKWKHILQDOVFKHGXOHXSGDWHWRUHIOHFWWKHDFWXDOVWDUWDQGILQLVK GDWHVIRUHDFKDFWLYLW\ZLWKLQWKH6FKHGXOH & $Q\ZRUNVWRSSDJHVZLWKLQLQGLYLGXDOZRUNDFWLYLWLHVWKDWH[FHHGVHYHQ FDOHQGDUGD\VLQGXUDWLRQ VKDOOEHFOHDUO\LQGLFDWHGZLWKLQWKHXSGDWHG3URMHFW6FKHGXOH,QFDVHVZKHUHXQSODQQHGDFWLYLW\ZRUN Western Allied Corporation Page 37 of 221 . . Item 10 Page 37 of 221 VWRSSDJHVH[FHHGVHYHQ FDOHQGDUGD\VDFWLYLWLHVVKDOOEHDGGHGWRWKH3URMHFW6FKHGXOHWRFOHDUO\ LQGLFDWHWKHZRUNVWRSSDJHSHULRGDQGLGHQWLI\IRUHFDVWHGUHVXPSWLRQDQGFRPSOHWLRQRIWKHDFWLYLW\ ZKHUHZRUNKDVVWRSSHG&RQWUDFWRUVKDOOFOHDUO\QRWHDOOVFKHGXOHUHYLVLRQVZKHQ3URMHFW6FKHGXOH XSGDWHVDUHVXEPLWWHGDVUHTXLUHGLQWKLV3DUDJUDSKDERYH 121&203(16$%/((;75$25',1$5<0($685(6 $ 6KRXOGWKH&LW\GHWHUPLQHLQLWVVROHMXGJPHQWWKDWWKHSHUIRUPDQFHRIWKH:RUNKDVQRWSURJUHVVHG WRWKHOHYHORIFRPSOHWLRQUHTXLUHGE\WKH&RQWUDFW'RFXPHQWV&LW\VKDOOKDYHWKHULJKWWRRUGHUWKH &RQWUDFWRUWRWDNHFRUUHFWLYHPHDVXUHVWRH[SHGLWHWKHSURJUHVVRIFRQVWUXFWLRQDWQRDGGLWLRQDOFRVW WRWKH&LW\LQFOXGLQJZLWKRXWOLPLWDWLRQWKHIROORZLQJ :RUNLQJDGGLWLRQDOVKLIWVRIRYHUWLPH 6XSSO\LQJDGGLWLRQDOPDQSRZHUHTXLSPHQWDQGRUIDFLOLWLHV 5HVFKHGXOHDFWLYLWLHVWRPD[LPL]HSUDFWLFDOFRQFXUUHQFHRIDFFRPSOLVKPHQWRIDFWLYLWLHV 6XEPLWWLQJD5HFRYHU\6FKHGXOHGLVFXVVHGDERYHIRUUHVHTXHQFLQJSHUIRUPDQFHRIWKH:RUNRU RWKHUVLPLODUPHDVXUHV $Q\RWKHUDFWLRQVWKDWPD\EHQHFHVVDU\WRPLWLJDWHGHOD\V % 6XFK([WUDRUGLQDU\0HDVXUHVVKDOOFRQWLQXHXQWLOWKHSURJUHVVRIWKH:RUNLVQRORQJHUEHKLQGVFKHGXOH DQGRUUHDFKHVWKHVWDJHRIFRPSOHWLRQUHTXLUHGE\WKH&RQWUDFW'RFXPHQWV&RQWUDFWRUVKDOOQRWEH HQWLWOHGWRDQDGMXVWPHQWLQWKH&RQWUDFW6XPLQFRQQHFWLRQZLWKWKHSHUIRUPDQFHRIDQ\VXFK ([WUDRUGLQDU\0HDVXUHVUHTXLUHGE\WKH&LW\XQGHUWKLV3DUDJUDSK7KH&LW\PD\H[HUFLVHWKHULJKWV IXUQLVKHGWKH&LW\SXUVXDQWWRWKLV3DUDJUDSKDVIUHTXHQWO\DVWKH&LW\GHHPVQHFHVVDU\WRHQVXUHWKDW WKH&RQWUDFWRU¶VSHUIRUPDQFHRIWKH:RUNZLOOFRPSO\ZLWKWKH&RQWUDFW7LPHRULQWHULPFRPSOHWLRQ GDWHV VHWIRUWKLQWKH&RQWUDFW'RFXPHQWV ,I&RQWUDFWRURULWV6XEFRQWUDFWRUVIDLOWRLPSOHPHQWRU FRPPHQFH([WUDRUGLQDU\0HDVXUHVZLWKLQWHQ FDOHQGDUGD\VRI&LW\¶VZULWWHQGHPDQG&LW\PD\ ZLWKRXWSUHMXGLFHWRRWKHUUHPHGLHVWDNHFRUUHFWLYHDFWLRQDWWKHH[SHQVHRIWKH&RQWUDFWRUZKLFKVKDOO UHGXFHWKH&RQWUDFW6XPDFFRUGLQJO\ &21',7,212)3$<0(17 &RPSOLDQFH E\ &RQWUDFWRU ZLWK WKH UHTXLUHPHQWV RI WKH &RQWUDFW'RFXPHQWV SHUWDLQLQJ WR SUHSDUDWLRQ VXEPLVVLRQUHYLVLQJDQGXSGDWLQJRIWKH6FKHGXOHLVDFRQGLWLRQSUHFHGHQWWR&LW\¶VREOLJDWLRQWRPDNHSD\PHQW WR&RQWUDFWRURIDQ\RUDOOVXPVWKDWPLJKWRWKHUZLVHEHGXHWR&RQWUDFWRULQWKHDEVHQFHRIVXFKQRQFRPSOLDQFH 3D\PHQWE\&LW\XQGHUFLUFXPVWDQFHVLQZKLFK&LW\IRUDQ\UHDVRQIDLOVRUHOHFWVQRWWRDVVHUWLWVULJKWWRZLWKKROG SD\PHQWIRUQRQFRPSOLDQFHZLWKWKLV3DUDJUDSKVKDOOQRWEHFRQVWUXHGDVDZDLYHURIWKHULJKWWRZLWKKROGIXWXUH SD\PHQWVRQDFFRXQWRIVXFKQRQFRPSOLDQFHRUDQ\RWKHUQRQFRPSOLDQFH >(1'2)$57,&/(@ Western Allied Corporation Page 38 of 221 . . Item 10 Page 38 of 221 ARTICLE 5 - SUSPENSION OR TERMINATION OF CONTRACT 7(50,1$7,21%<7+(&2175$&725 $ &RQWUDFWRUVKDOOKDYHWKHULJKWWRWHUPLQDWHLWVSHUIRUPDQFHRIWKH&RQWUDFWRQO\XSRQWKHRFFXUUHQFH RIRQHRIWKHIROORZLQJ 7KH:RUNLVVWRSSHGIRUDSHULRGRIQLQHW\ FRQVHFXWLYHGD\VWKURXJKQRDFWRUIDXOWRIWKH &RQWUDFWRUDQ\6XEFRQWUDFWRU6XEVXEFRQWUDFWRUWKHLUDJHQWVRUHPSOR\HHVRUDQ\RWKHU SHUVRQVRUHQWLWLHVSHUIRUPLQJSRUWLRQVRIWKH:RUNXQGHUGLUHFWRULQGLUHFWFRQWUDFWZLWKWKH &RQWUDFWRUGXHWR D WKHLVVXDQFHRIDQRUGHURIDFRXUWRURWKHUSXEOLFDXWKRULW\KDYLQJMXULVGLFWLRQ RU E DQDFWRIJRYHUQPHQWVXFKDVDGHFODUDWLRQRIQDWLRQDOHPHUJHQF\PDNLQJPDWHULDO XQDYDLODEOH DQG&RQWUDFWRUKDVJLYHQ&LW\ZULWWHQQRWLFHZLWKLQWHQ GD\VRIWKHRFFXUUHQFHRIVXFKJURXQG IRUWHUPLQDWLRQWKHQWKH&RQWUDFWRUPD\XSRQWKLUW\ DGGLWLRQDOFDOHQGDUGD\VZULWWHQQRWLFHWR &LW\XQOHVVWKHUHDVRQKDVWKHUHWRIRUHEHHQFXUHGWHUPLQDWHLWVSHUIRUPDQFHRIWKH:RUN 7KH:RUNLVVWRSSHGIRUDSHULRGRIFRQVHFXWLYHGD\VWKURXJKQRDFWRUIDXOWRI&RQWUDFWRU DQ\6XEFRQWUDFWRU6XEVXEFRQWUDFWRUWKHLUDJHQWVRUHPSOR\HHVRUDQ\RWKHUSHUVRQVRUHQWLWLHV SHUIRUPLQJSRUWLRQVRIWKH:RUNXQGHUGLUHFWRULQGLUHFWFRQWUDFWZLWKWKH&RQWUDFWRUEHFDXVHWKH &LW\KDVSHUVLVWHQWO\IDLOHGWRSHUIRUPDQ\PDWHULDOREOLJDWLRQXQGHUWKH&RQWUDFW'RFXPHQWVDQG IDLOVWRFXUHVXFKGHIDXOWZLWKLQQLQHW\ GD\VDIWHUWKHUHFHLSWRIQRWLFHIURP&RQWUDFWRUVWDWLQJ WKHQDWXUHRIVXFKGHIDXOW % ,I&RQWUDFWRUWHUPLQDWHVLWVSHUIRUPDQFHRIWKH&RQWUDFWLQDFFRUGDQFHZLWKWKLV3DUDJUDSKWKH &LW\VKDOOSD\&RQWUDFWRUIRUWKH:RUNH[HFXWHGWKURXJKWKHGDWHRIWHUPLQDWLRQDVVHWIRUWKLQ3DUDJUDSK &EHORZ 7(50,1$7,21%<7+(&,7<)25&$86( $ *URXQGV 7KH&LW\VKDOOKDYHWKHULJKWWRWHUPLQDWHWKH&RQWUDFWRU¶VSHUIRUPDQFHRIWKH&RQWUDFWLQZKROHRULQ SDUWZLWKRXWOLDELOLW\WR&LW\LI &RQWUDFWRUIDLOVSURPSWO\WREHJLQWKH:RUNXQGHUWKH&RQWUDFW'RFXPHQWV RU &RQWUDFWRUUHIXVHVRUIDLOVWRVXSSO\HQRXJKSURSHUO\VNLOOHGZRUNHUVRUSURSHUPDWHULDOV RU &RQWUDFWRUIDLOVWRSHUIRUPWKH:RUNLQDFFRUGDQFHZLWKWKH&RQWUDFW'RFXPHQWVLQFOXGLQJ FRQIRUPLQJWRDSSOLFDEOHVWDQGDUGVVHWIRUWKWKHUHLQLQFRQVWUXFWLQJWKH3URMHFWRUUHIXVHVWR UHPRYHDQGUHSODFHUHMHFWHGPDWHULDOVRUXQDFFHSWDEOH:RUN RU &RQWUDFWRUGLVFRQWLQXHVWKHSURVHFXWLRQRIWKH:RUN H[FOXVLYHRIZRUNVWRSSDJH D GXHWR WHUPLQDWLRQE\&LW\ RU E GXHWRDQGGXULQJWKHFRQWLQXDQFHRID)RUFH0DMHXUHHYHQWRU VXVSHQVLRQE\&LW\ RU Western Allied Corporation Page 39 of 221 . . Item 10 Page 39 of 221 &RQWUDFWRUIDLOVWRUHVXPHSHUIRUPDQFHRI:RUNZKLFKKDVEHHQVXVSHQGHGRUVWRSSHGZLWKLQD UHDVRQDEOHWLPHDIWHUUHFHLSWRIQRWLFHIURP&LW\WRGRVRRU LIDSSOLFDEOH DIWHUFHVVDWLRQRIWKH HYHQWSUHYHQWLQJSHUIRUPDQFH RU $Q\UHSUHVHQWDWLRQRUZDUUDQW\PDGHE\&RQWUDFWRULQWKH&RQWUDFW'RFXPHQWVRUDQ\FHUWLILFDWH VFKHGXOHLQVWUXPHQWRURWKHUGRFXPHQWGHOLYHUHGE\&RQWUDFWRUSXUVXDQWWRWKH&RQWUDFW 'RFXPHQWVVKDOOKDYHEHHQIDOVHRUPDWHULDOO\PLVOHDGLQJZKHQPDGH RU &RQWUDFWRUIDLOVWRPDNHSD\PHQWWR6XEFRQWUDFWRUVRU0DWHULDO6XSSOLHUVIRUPDWHULDOVRUODERULQ DFFRUGDQFHZLWKWKHUHVSHFWLYH&RQWUDFW'RFXPHQWVDQGDSSOLFDEOHODZ RU &RQWUDFWRUGLVUHJDUGVODZVRUGLQDQFHVRUUXOHVUHJXODWLRQVRURUGHUVRIDSXEOLFDXWKRULW\KDYLQJ MXULVGLFWLRQ RU &RQWUDFWRULVJXLOW\RIEUHDFKRIDSURYLVLRQRIWKH&RQWUDFW'RFXPHQWV RU &RQWUDFWRUEHFRPHVLQVROYHQWLVDGMXGLFDWHGEDQNUXSWRUPDNHVDJHQHUDODVVLJQPHQWIRUWKH EHQHILWRIFUHGLWRUVDQGIDLOVWRSURYLGH&LW\ZLWKDGHTXDWHDVVXUDQFHVRI&RQWUDFWRU¶VDELOLW\WR VDWLVI\LWVFRQWUDFWXDOREOLJDWLRQV $UHFHLYHUWUXVWHHRURWKHUMXGLFLDORIILFHUVKDOOQRWKDYHDQ\ULJKWWLWOHRULQWHUHVWLQRUWRWKH&RQWUDFW 8SRQWKDWSHUVRQ¶VDSSRLQWPHQW&LW\KDVDWLWVRSWLRQDQGVROHGLVFUHWLRQWKHULJKWWRLPPHGLDWHO\ FDQFHOWKH&RQWUDFWDQGGHFODUHLWQXOODQGYRLG % &LW\¶V5LJKWV :KHQDQ\RIWKHUHDVRQVVSHFLILHGLQ3DUDJUDSK$H[LVWWKH&LW\PD\LQDGGLWLRQWRDQGZLWKRXW SUHMXGLFHWRDQ\RWKHUULJKWVRUUHPHGLHVRIWKH&LW\DQGDIWHUJLYLQJWKH&RQWUDFWRUILYH FDOHQGDU GD\VZULWWHQQRWLFHWHUPLQDWH&RQWUDFWRU¶VSHUIRUPDQFHRIWKH:RUNLQZKROHRULQSDUWDQGPD\ 7DNHSRVVHVVLRQRIWKHVLWHDQGDOOPDWHULDOVHTXLSPHQWWRROVFRQVWUXFWLRQHTXLSPHQWDQG PDFKLQHU\WKHUHRQRZQHGE\WKH&RQWUDFWRU :LWKKROGIURP&RQWUDFWRUDPRXQWVXQSDLGKHUHXQGHUDQGWRRIIVHWVXFKDPRXQWVDJDLQVWGDPDJHV RUORVVHVLQFXUUHGE\&LW\ $FFHSWDVVLJQPHQWRIVXEFRQWUDFWVIURP&RQWUDFWRUDWWKHVROHGLVFUHWLRQRI&LW\DQG )LQLVKWKH:RUNE\ZKDWHYHUUHDVRQDEOHPHWKRGWKH&LW\PD\GHHPH[SHGLHQW 8SRQUHTXHVWRIWKH&RQWUDFWRUWKH&LW\VKDOOIXUQLVKWRWKH&RQWUDFWRUDGHWDLOHGDFFRXQWLQJRIWKH FRVWVLQFXUUHGE\WKH&LW\LQILQLVKLQJWKH:RUN & &RVWV ,I&LW\¶VFRVWVWRFRPSOHWHDQGGDPDJHVLQFXUUHGGXHWR&RQWUDFWRU¶VGHIDXOWH[FHHGWKHXQSDLG &RQWUDFWEDODQFHWKH&RQWUDFWRUVKDOOSD\WKHGLIIHUHQFHWRWKH&LW\ ' :URQJIXO7HUPLQDWLRQ ,ILWKDVEHHQDGMXGLFDWHGRURWKHUZLVHGHWHUPLQHGWKDW&LW\KDVZURQJIXOO\WHUPLQDWHGWKH&RQWUDFWRU Western Allied Corporation Page 40 of 221 . . Item 10 Page 40 of 221 IRUFDXVHWKHQVDLGWHUPLQDWLRQVKDOOEHGHHPHGFRQYHUWHGWRDWHUPLQDWLRQIRUFRQYHQLHQFHDVVHW IRUWKLQ3DUDJUDSKDQG&RQWUDFWRU¶VUHPHG\IRUZURQJIXOWHUPLQDWLRQLQVXFKHYHQWVKDOOEHOLPLWHG WRWKHUHFRYHU\RIWKHSD\PHQWVSHUPLWWHGIRUWHUPLQDWLRQIRUFRQYHQLHQFHDVVHWIRUWKLQ3DUDJUDSK 3$57,$/'(/(7,21256863(16,212):25.%<7+(&,7< $ &RQWUDFWRUDJUHHVWKDWWKH&LW\PD\GHWHUPLQHZKHWKHUDQ\RUDOORIWKH:RUNGHVFULEHGLQWKH&RQWUDFW 'RFXPHQWVVKDOOEHGHOHWHGRUSHUIRUPDQFHVXVSHQGHGZLWKRXWHOHFWLQJWRWHUPLQDWHWKH&RQWUDFWRU¶V SHUIRUPDQFHXQGHUWKH&RQWUDFWDQGZLWKRXWDQ\SHQDOW\EHLQJLQFXUUHGE\WKH&LW\ % $Q\VXFKSDUWLDOGHOHWLRQRUVXVSHQVLRQRIWKH:RUNVKDOOLQQRZD\YRLGRULQYDOLGDWHWKH&RQWUDFWQRU VKDOOLWSURYLGH&RQWUDFWRUZLWKDQ\EDVLVIRUVHHNLQJSD\PHQWIURP&LW\IRU:RUNGHOHWHGRUVXVSHQGHG H[FHSWWRWKHH[WHQWVXFK:RUNKDVDOUHDG\EHHQSHUIRUPHGDQGLVRWKHUZLVHFRPSHQVDEOHXQGHUWKH &RQWUDFW & 7KH&LW\VKDOOKDYHWKHULJKWWRODWHUKDYHDQ\VXFKVXVSHQGHGRUGHOHWHG:RUNSHUIRUPHGE\&RQWUDFWRU RURWKHUVZLWKRXWDQ\SHQDOW\WRWKH&LW\ ' ,QWKHHYHQWRIDQ\SDUWLDORUFRPSOHWHGHOHWLRQRUVXVSHQVLRQRI:RUNWKH&LW\VKDOOIXUQLVK&RQWUDFWRU ZLWKSURPSWZULWWHQQRWLFHWKHUHRIDQGWKH&LW\VKDOOEHHQWLWOHGWRWDNHSRVVHVVLRQRIDQGKDYHDVLWV SURSHUW\DOO5HFRUG'RFXPHQWV$FFRXQWLQJ5HFRUGVDQGRWKHUGDWDSUHSDUHGE\&RQWUDFWRURULWV 6XEFRQWUDFWRUV ( 6XVSHQVLRQIRU&RQYHQLHQFH 7KH&LW\PD\DWDQ\WLPHDQGIURPWLPHWRWLPHZLWKRXWFDXVHRUGHUWKH&RQWUDFWRULQZULWLQJWR VXVSHQGGHOD\RULQWHUUXSWWKH:RUNLQZKROHRULQSDUWIRUVXFKSHULRGRIWLPHDVWKH&LW\PD\ GHWHUPLQH6XFKRUGHUVKDOOEHVSHFLILFDOO\LGHQWLILHGDVD³:RUN6XVSHQVLRQ'LUHFWLYH´XQGHUWKLV 6HFWLRQ 8SRQUHFHLSWRID:RUN6XVSHQVLRQ'LUHFWLYH&RQWUDFWRUVKDOODWWKH&LW\¶VH[SHQVHFRPSO\ZLWK LWVWHUPVDQGWDNHDOOUHDVRQDEOHVWHSVWRPLQLPL]HFRVWVDOORFDEOHWRWKH:RUNFRYHUHGE\WKH :RUN6XVSHQVLRQ'LUHFWLYHGXULQJWKHSHULRGRI:RUNVWRSSDJH :LWKLQWKHSHULRGRIVXVSHQVLRQRUVXFKH[WHQVLRQWRWKDWSHULRGDVLVDJUHHGXSRQE\&RQWUDFWRU DQGWKH&LW\WKH&LW\VKDOOHLWKHUFDQFHOWKH:RUN6XVSHQVLRQ'LUHFWLYHRUGHOHWHWKH:RUNFRYHUHG E\VXFK:RUN6XVSHQVLRQ'LUHFWLYHE\LVVXLQJD&KDQJH2UGHURU&RQVWUXFWLRQ&KDQJH'LUHFWLYH ,ID:RUN6XVSHQVLRQ'LUHFWLYHLVFDQFHOOHGRUH[SLUHV&RQWUDFWRUVKDOOFRQWLQXHWKH:RUN $ &KDQJH2UGHURU&RQVWUXFWLRQ&KDQJH'LUHFWLYHZLOOEHLVVXHGWRFRYHUDQ\DGMXVWPHQWVRIWKH &RQWUDFW6XPDQG&RQWUDFW7LPHQHFHVVDULO\FDXVHGE\VXFKVXVSHQVLRQ1RDGMXVWPHQWVKDOOEH PDGHWRWKHH[WHQW D 7KDWSHUIRUPDQFHLVZDVRUZRXOGKDYHEHHQVRVXVSHQGHGGHOD\HGRULQWHUUXSWHGE\ DQRWKHUFDXVHIRUZKLFKWKH&RQWUDFWRULVUHVSRQVLEOH RU E 7KDWDQHTXLWDEOHDGMXVWPHQWLVPDGHRUGHQLHGXQGHUDQRWKHUSURYLVLRQRIWKH&RQWUDFW ) 6XVSHQVLRQVIRU&DXVH &LW\KDVWKHDXWKRULW\E\ZULWWHQRUGHUWRVXVSHQGWKH:RUNLQZKROHRULQSDUWZLWKRXWOLDELOLW\WR&LW\ Western Allied Corporation Page 41 of 221 . . Item 10 Page 41 of 221 IRU&RQWUDFWRU¶VIDLOXUHWR &RUUHFWFRQGLWLRQVXQVDIHIRUWKH3URMHFWSHUVRQQHORUJHQHUDOSXEOLFRU &DUU\RXWWKH&RQWUDFW RU &DUU\RXWRUGHUVRI&LW\ * 5HVSRQVLELOLWLHVRI&RQWUDFWRU'XULQJ6XVSHQVLRQ3HULRGV 'XULQJSHULRGVWKDW:RUNLVVXVSHQGHG&RQWUDFWRUVKDOOFRQWLQXHWREHUHVSRQVLEOHIRUWKH:RUNDQG VKDOOSUHYHQWGDPDJHRULQMXU\WRWKH3URMHFWSURYLGHIRUGUDLQDJHDQGVKDOOHUHFWQHFHVVDU\WHPSRUDU\ VWUXFWXUHVVLJQVRURWKHUIDFLOLWLHVUHTXLUHGWRPDLQWDLQWKH3URMHFWDQGFRQWLQXHWRSHUIRUPDFFRUGLQJ WRWKH&RQWUDFW'RFXPHQWV 7(50,1$7,21%<7+(&,7<)25&219(1,(1&( $ *URXQGV :LWKRXWOLPLWLQJDQ\ULJKWVZKLFK&LW\PD\KDYHE\UHDVRQRIDQ\GHIDXOWE\&RQWUDFWRUKHUHXQGHU&LW\ PD\WHUPLQDWH&RQWUDFWRU¶V SHUIRUPDQFHRIWKH&RQWUDFWLQZKROHRULQSDUWDWDQ\WLPHIRU FRQYHQLHQFHXSRQILIWHHQ FDOHQGDUGD\VZULWWHQQRWLFHWR&RQWUDFWRU % &RQWUDFWRU$FWLRQV 8SRQUHFHLSWRIVXFKQRWLFH&RQWUDFWRUVKDOOSHUIRUPWKHGXWLHVUHTXLUHGE\3DUDJUDSKEHORZ $WWKHHOHFWLRQRIDQGDVGLUHFWHGE\WKH&LW\DQ\RUDOORIWKHVXEFRQWUDFWVDQGSXUFKDVHRUGHUV HQWHUHGLQWRE\&RQWUDFWRUSULRUWRWKHHIIHFWLYHGDWHRIWHUPLQDWLRQVKDOOEHWHUPLQDWHGRUVKDOOEH DVVLJQHGWR&LW\ & &RPSHQVDWLRQ ,IWKH3DUWLHVDUHXQDEOHWRDJUHHRQWKHDPRXQWRIDWHUPLQDWLRQVHWWOHPHQWWKH&LW\VKDOOSD\ WKH&RQWUDFWRUWKHIROORZLQJDPRXQWV D )RU:RUNSHUIRUPHGEHIRUHWKHHIIHFWLYHGDWHRIWHUPLQDWLRQWKHWRWDO ZLWKRXWGXSOLFDWLRQRI DQ\LWHPV RI L 7KHFRVWRIWKH:RUN DQG LL $VXPDVRYHUKHDGDQGSURILWRQWKHFRVWRIWKH:RUNGHWHUPLQHGE\WKH&LW\WREH IDLUDQGUHDVRQDEOH,QQRHYHQWVKDOO&RQWUDFWRUEHHQWLWOHGWRUHFRYHURYHUKHDGRU SURILWRQ:RUNQRWSHUIRUPHG E 7KHUHDVRQDEOHFRVWVRIVHWWOHPHQWRIWKH:RUNWHUPLQDWHGLQFOXGLQJ L $FFRXQWLQJFOHULFDODQGRWKHUH[SHQVHVUHDVRQDEO\QHFHVVDU\IRUWKHSUHSDUDWLRQ RIWHUPLQDWLRQVHWWOHPHQWSURSRVDOVDQGVXSSRUWLQJGDWDLIDQ\ DQG LL 6WRUDJHWUDQVSRUWDWLRQDQGRWKHUFRVWVUHDVRQDEO\QHFHVVDU\IRUWKHSUHVHUYDWLRQ SURWHFWLRQRUGLVSRVLWLRQRILQYHQWRU\ Western Allied Corporation Page 42 of 221 . . Item 10 Page 42 of 221 6XFKSD\PHQWVKDOOEH&RQWUDFWRU¶VH[FOXVLYHUHPHG\IRUWHUPLQDWLRQIRUFRQYHQLHQFHDQGZLOOEH GXHDQGSD\DEOHRQWKHVDPHFRQGLWLRQVDVVHWIRUWKIRUILQDOSD\PHQWWRWKHH[WHQWDSSOLFDEOH 8SRQUHFHLSWRIVXFKSD\PHQWWKH&RQWUDFWRUDQG&LW\VKDOOKDYHQRIXUWKHUREOLJDWLRQVWRHDFK RWKHUH[FHSWIRU&RQWUDFWRU¶VREOLJDWLRQVZLWKUHVSHFWWRZDUUDQWLHVUHSUHVHQWDWLRQVLQGHPQLW\ PDLQWHQDQFHRILQVXUDQFHDQGRWKHUREOLJDWLRQVWKDWVXUYLYHWHUPLQDWLRQRU)LQDO&RPSOHWLRQDV SURYLGHGIRUKHUHLQ ,WLVXQGHUVWRRGDQGDJUHHGWKDWQRIHHDQWLFLSDWHGSURILWFRPSHQVDWLRQIRUORVWRSSRUWXQLW\FRVWV RURWKHUFRPSHQVDWLRQRUSD\PHQWRIDQ\NLQGRUFKDUDFWHUVKDOOEHGXHRUSD\DEOHIRUXQSHUIRUPHG :RUNUHJDUGOHVVRIWKHEDVLVRIWHUPLQDWLRQDQGWKHLQFOXVLRQRIWKLVSURYLVLRQZLWKLQWKLV VXESDUDJUDSKVKDOOLQQRZD\OLPLWLWVDSSOLFDWLRQWRWHUPLQDWLRQXQGHUWKLV3DUDJUDSK &RQWUDFWRUDJUHHVWKDWHDFKRILWVVXEFRQWUDFWVZLOOUHVHUYHIRUWKH&RQWUDFWRUWKHVDPHULJKWRI WHUPLQDWLRQIRUFRQYHQLHQFHSURYLGHGE\WKLV3DUDJUDSK ' 1R&RQVHTXHQWLDO'DPDJHV 8QGHUQRFLUFXPVWDQFHVVKDOO&RQWUDFWRUEHHQWLWOHGWRDQWLFLSDWRU\RUXQHDUQHGSURILWVRUFRQVHTXHQWLDO RURWKHUGDPDJHVDVDUHVXOWRIDWHUPLQDWLRQRUSDUWLDOWHUPLQDWLRQXQGHUWKLV$UWLFOH7KHSD\PHQW WR&RQWUDFWRUGHWHUPLQHGLQDFFRUGDQFHZLWKWKLV$UWLFOHFRQVWLWXWHV&RQWUDFWRU¶VH[FOXVLYHUHPHG\IRU DWHUPLQDWLRQKHUHXQGHU &2175$&725¶6'87,(683217(50,1$7,21)25&$86(25&219(1,(1&( ,IWKH&LW\WHUPLQDWHV&RQWUDFWRU¶VSHUIRUPDQFHRI:RUNXQGHUWKH&RQWUDFWIRUFDXVHRUFRQYHQLHQFHRULI &RQWUDFWRUWHUPLQDWHVD6XEFRQWUDFWRUZLWKWKH&LW\¶VDSSURYDO&RQWUDFWRUVKDOO FHDVHSHUIRUPDQFHRIWKH:RUNWRWKHH[WHQWVSHFLILHGLQWKHQRWLFH WDNHDFWLRQVQHFHVVDU\RUWKDWWKH&LW\PD\GLUHFWIRUWKHSURWHFWLRQDQGSUHVHUYDWLRQRIWKH:RUN VHWWOHRXWVWDQGLQJOLDELOLWLHVDVGLUHFWHGE\&LW\ WUDQVIHUWLWOHDQGGHOLYHUWR&LW\:RUNLQSURJUHVVVSHFLDOL]HGHTXLSPHQWQHFHVVDU\WRSHUIRUPWKH:RUN VXEPLWDOO5HFRUG'RFXPHQWV$FFRXQWLQJ5HFRUGVDQGRWKHUGDWDSUHSDUHGSXUVXDQWWRWKH&RQWUDFWE\ &RQWUDFWRUDQGRULWV6XEFRQWUDFWRUVDVDSSOLFDEOHWRWKH&LW\ZLWKILIWHHQ FDOHQGDUGD\VDIWHUWKH&LW\¶V QRWLFHRIWHUPLQDWLRQLQDQRUJDQL]HGXVDEOHIRUPLQERWKKDUGFRS\DQGHOHFWURQLFGLJLWDOIRUPZLWKDOOLWHPV SURSHUO\ODEHOHGWRWKHGHJUHHRIGHWDLOVSHFLILHGE\WKH&LW\ DQG H[FHSWIRU:RUNGLUHFWHGE\&LW\WREHSHUIRUPHGSULRUWRWKHHIIHFWLYHGDWHRIWHUPLQDWLRQVWDWHGLQWKHQRWLFH LQFXUQRIXUWKHUFRVWVRUH[SHQVHVDQGHQWHULQWRQRIXUWKHUVXEFRQWUDFWVDQGSXUFKDVHRUGHUV 1RFRPSHQVDWLRQVKDOOEHGXH&RQWUDFWRULIDQ\XQWLO&RQWUDFWRUFRPSOLHVZLWKWKHUHTXLUHPHQWVRIWKLV 3DUDJUDSK >(1'2)$57,&/(@ Western Allied Corporation Page 43 of 221 . . Item 10 Page 43 of 221 ARTICLE 6 – CHANGES &,7< 65,*+77225'(5&+$1*(6 7KH&LW\ZLWKRXWLQYDOLGDWLQJWKH&RQWUDFWPD\DXWKRUL]HFKDQJHVLQWKH:RUNFRQVLVWLQJRIDGGLWLRQV GHOHWLRQVRURWKHUUHYLVLRQVZLWKWKH&RQWUDFW6XPDQG&RQWUDFW7LPHEHLQJDGMXVWHGDFFRUGLQJO\LI QHFHVVDU\ $OOVXFKFKDQJHVLQWKH:RUNVKDOOEHDXWKRUL]HGE\&KDQJH2UGHURU&RQVWUXFWLRQ&KDQJH 'LUHFWLYHDQG&RQWUDFWRUVKDOOSHUIRUPVXFKFKDQJHVLQWKH:RUNDFFRUGLQJWRWKHDSSOLFDEOHUHTXLUHPHQWV RIWKH&RQWUDFW'RFXPHQWV $33/,&$%/(3529,6,216 &KDQJHVLQWKH:RUNVKDOOEHSHUIRUPHGXQGHUDSSOLFDEOHSURYLVLRQVRIWKH&RQWUDFW'RFXPHQWV7KH &RQWUDFWRUVKDOOSURFHHGSURPSWO\DQGGLOLJHQWO\ZLWKWKHFKDQJHXQOHVVRWKHUZLVHSURYLGHGLQWKH&KDQJH 2UGHURU&RQVWUXFWLRQ&KDQJH'LUHFWLYH ,WLVRIWKHHVVHQFHWRWKLV&RQWUDFWWKDWDOOVFRSHFKDQJHVLQWKH :RUNWKDWIRUPWKHEDVLVRIDQDGMXVWPHQWRIWKH&RQWUDFW6XPRU&RQWUDFW7LPHPXVWEHDXWKRUL]HGLQ DGYDQFHLQZULWLQJWKURXJKHLWKHUD&KDQJH2UGHURU&RQVWUXFWLRQ&KDQJH'LUHFWLYH$FKDQJHLQWKH&RQWUDFW 6XPRUWKH&RQWUDFW7LPHVKDOOEHDFFRPSOLVKHGRQO\E\&KDQJH2UGHURU&RQVWUXFWLRQ&KDQJH'LUHFWLYH $FFRUGLQJO\QRYHUEDOGLUHFWLRQVFRXUVHRIFRQGXFWRUGHDOLQJVEHWZHHQWKH3DUWLHVH[SUHVVRULPSOLHG DFFHSWDQFHRIDOWHUDWLRQVRUDGGLWLRQVWRWKH:RUNRUFODLPWKDWWKH&RQWUDFWKDVEHHQDEDQGRQHGRUWKH&LW\ KDVEHHQXQMXVWO\HQULFKHGE\DQ\DOWHUDWLRQRUDGGLWLRQWRWKH:RUNVKDOOEHWKHEDVLVRIDQ\FODLPIRUDQ LQFUHDVHLQDQ\DPRXQWVGXHXQGHUWKH&RQWUDFW'RFXPHQWVRUDFKDQJHLQDQ\WLPHSHULRGSURYLGHGLQWKH &RQWUDFW'RFXPHQWV 127,&(2)6&23(&+$1*( &RQWUDFWRUVKDOOVXEPLWZULWWHQQRWLFHRIDQ\FKDQJHLQVFRSHWRWKH'LUHFWRULILQWKH&RQWUDFWRU¶VRSLQLRQ DQ\LQVWUXFWLRQUHTXHVW'UDZLQJV6SHFLILFDWLRQVDFWLRQFRQGLWLRQRPLVVLRQGHIDXOWRURWKHUVLWXDWLRQ RFFXUVWKDWWKH&RQWUDFWRUEHOLHYHVFRQVWLWXWHVDVFRSHFKDQJHRURWKHUPDWWHUUHVXOWLQJLQ([WUD:RUNIRU ZKLFK&RQWUDFWRUEHOLHYHVLWLVHQWLWOHGWRDQDGMXVWPHQWRIWKH&RQWUDFW6XPRU&RQWUDFW7LPH 6XFKQRWLFH VKDOOEHSURYLGHGSULRUWRSHUIRUPDQFHRIWKH:RUNDIIHFWHGE\VXFKRFFXUUHQFHDQGZLWKLQVHYHQ FDOHQGDU GD\VDIWHUWKHGLVFRYHU\GDWHRIWKHFLUFXPVWDQFHVRIVXFKVFRSHFKDQJHRURWKHUPDWWHUV 7KHZULWWHQQRWLFH VKDOOVWDWHWKHGDWHFLUFXPVWDQFHVH[WHQWRIDGMXVWPHQWWRWKH&RQWDFW6XPRUWKH&RQWUDFW7LPHLIDQ\ UHTXHVWHG 7KHPHUHSUHVHQWDWLRQRIVXFKQRWLFHVKDOOQRWHVWDEOLVKWKHH[LVWHQFHRIDQ\ULJKWE\&RQWUDFWRU WRDGMXVWPHQWRIWKH&RQWUDFW6XPRU&RQWUDFW7LPH )DLOXUHWRSURYLGHVXFKWLPHO\ZULWWHQQRWLFHGHVFULEHG KHUHLQVKDOOFRQVWLWXWHDZDLYHUE\&RQWUDFWRURIWKHULJKWWRDQ\DGMXVWPHQWWRWKH&RQWUDFW6XPRU&RQWUDFW 7LPHRQDFFRXQWWKHUHRI &+$1*(25'(56 $ &RPSXWDWLRQ 0HWKRGVXVHGLQGHWHUPLQLQJDGMXVWPHQWVWRWKH&RQWUDFW6XPE\&KDQJH2UGHUPD\LQFOXGHWKRVH OLVWHGLQ3DUDJUDSKEHORZ % $FFRUGDQG6DWLVIDFWLRQ $JUHHPHQWRQDQ\&KDQJH2UGHUVKDOOEHDIXOOFRPSURPLVHDQGVHWWOHPHQWRIDOODGMXVWPHQWVWR &RQWUDFW7LPHDQG&RQWUDFW6XPDQGFRPSHQVDWLRQIRUDQ\DQGDOOGHOD\H[WHQGHGRUDGGLWLRQDO ILHOGDQGKRPHRIILFHRYHUKHDGGLVUXSWLRQDFFHOHUDWLRQLQHIILFLHQFLHVORVWODERURUHTXLSPHQW SURGXFWLYLW\GLIIHULQJ6LWHFRQGLWLRQVFRQVWUXFWLRQLQWHUIHUHQFHVDQGRWKHUH[WUDRUGLQDU\RU Western Allied Corporation Page 44 of 221 . . Item 10 Page 44 of 221 FRQVHTXHQWLDOGDPDJHV KHUHLQDIWHUFDOOHG,PSDFWV LQFOXGLQJDQ\ULSSOHRUFXPXODWLYHHIIHFWVRI VDLG,PSDFWVRQWKHRYHUDOO:RUNXQGHUWKH&RQWUDFWDULVLQJGLUHFWO\RULQGLUHFWO\IURPWKHSHUIRUPDQFH RI:RUNGHVFULEHGLQWKH&KDQJH2UGHU%\H[HFXWLRQRIDQ\&KDQJH2UGHU&RQWUDFWRUDJUHHVWKDW WKH&KDQJH2UGHUFRQVWLWXWHVDFRPSOHWHDFFRUGDQGVDWLVIDFWLRQZLWKUHVSHFWWRDOOFODLPVIRU VFKHGXOHH[WHQVLRQ,PSDFWVRUDQ\FRVWVRIZKDWHYHUQDWXUHFKDUDFWHURUNLQGDULVLQJRXWRIRU LQFLGHQWDOWRWKH&KDQJH2UGHU1RDFWLRQFRQGXFWRPLVVLRQSURGXFWIDLOXUHRUFRXUVHRIGHDOLQJE\ WKH&LW\VKDOODFWWRZDLYHPRGLI\FKDQJHRUDOWHUWKHUHTXLUHPHQWWKDW L &KDQJH2UGHU VPXVWEHLQ ZULWLQJVLJQHGE\WKH&LW\DQG&RQWUDFWRUDQG LL WKDWVXFKZULWWHQ&KDQJH2UGHUVDUHWKHH[FOXVLYH PHWKRGIRUHIIHFWXDWLQJDQ\FKDQJHWRWKH&RQWUDFW6XPDQGRU&RQWUDFW7LPH &216758&7,21&+$1*(',5(&7,9( ),(/'',5(&7,9( $ $&RQVWUXFWLRQ&KDQJH'LUHFWLYHVKDOOEHXVHGLQWKHDEVHQFHRIWRWDODJUHHPHQWRQWKHWHUPVRID &KDQJH2UGHU 7KH&LW\PD\E\&RQVWUXFWLRQ&KDQJH'LUHFWLYHZLWKRXWLQYDOLGDWLQJWKH&RQWUDFW RUGHUFKDQJHVLQWKH:RUNZLWKLQWKHJHQHUDOVFRSHRIWKH&RQWUDFWFRQVLVWLQJRIDGGLWLRQVGHOHWLRQ RURWKHUUHYLVLRQVWKH&RQWUDFW6XPDQG&RQWUDFW7LPHEHLQJDGMXVWHGDFFRUGLQJO\ % ,IWKH&RQVWUXFWLRQ&KDQJH'LUHFWLYHSURYLGHVIRUDQDGMXVWPHQWWRWKH&RQWUDFW6XPWKHDGMXVWPHQW VKDOOEHFDOFXODWHGLQDFFRUGDQFHZLWK3DUDJUDSKKHUHLQ 3ULFLQJ&KDQJHVLQWKH:RUN & 8SRQUHFHLSWRIWKH&RQVWUXFWLRQ&KDQJH'LUHFWLYHWKH&RQWUDFWRUVKDOOSURPSWO\SURFHHGZLWKWKH FKDQJHLQWKH:RUNLQYROYHGDQGDGYLVHWKH&LW\RIWKH&RQWUDFWRU¶VDJUHHPHQWRUGLVDJUHHPHQWZLWK WKHPHWKRGLIDQ\SURYLGHGLQWKH&RQVWUXFWLRQ&KDQJH'LUHFWLYHIRUGHWHUPLQLQJWKHSURSRVHG DGMXVWPHQWLQWKH&RQWUDFW6XPRU&RQWUDFW7LPH ' ,I&RQWUDFWRUEHOLHYHVD&RQVWUXFWLRQ&KDQJH'LUHFWLYHFRQVWLWXWHVDEDVLVIRUDGMXVWPHQWWRWKH &RQWUDFW6XPRU&RQWUDFW7LPHWKHQ&RQWUDFWRUVKDOOJLYHD1RWLFHRI6FRSH&KDQJHSURYLGHGLQ 3DUDJUDSKIROORZHGE\DVXEPLVVLRQRID&KDQJH2UGHU5HTXHVWDVUHTXLUHGE\3DUDJUDSK &RQWUDFWRUVKDOOLIUHTXHVWHGE\&LW\LQVXFK&RQVWUXFWLRQ&KDQJH'LUHFWLYHRULQDVXEVHTXHQW &RQVWUXFWLRQ&KDQJH'LUHFWLYHSURFHHGZLWKWKHSHUIRUPDQFHRIWKH:RUNDVGHVFULEHGLQWKH &RQVWUXFWLRQ&KDQJH'LUHFWLYH )DLOXUHRI&RQWUDFWRUWRSURFHHGZLWKWKHSHUIRUPDQFHRI:RUNDV GHVFULEHGLQWKH&RQVWUXFWLRQ&KDQJH'LUHFWLYHVKDOOJLYHWKH&LW\WKHULJKWWRFDUU\RXWWKH:RUNDV VHWIRUWKLQ3DUDJUDSK ( $&RQVWUXFWLRQ&KDQJH'LUHFWLYHVLJQHGE\WKH&RQWUDFWRULQGLFDWHVWKH&RQWUDFWRU¶VDJUHHPHQW WKHUHZLWKLQFOXGLQJDGMXVWPHQWLQ&RQWUDFW6XPDQG&RQWUDFW7LPHRUWKHPHWKRGIRUGHWHUPLQLQJ WKHP6XFKDJUHHPHQWVKDOOEHHIIHFWLYHLPPHGLDWHO\DQGVKDOOEHUHFRUGHGDVD&KDQJH2UGHU ) ,IWKH&RQWUDFWRUGRHVQRWUHVSRQGSURPSWO\RUGLVDJUHHVZLWKWKHPHWKRGIRUDGMXVWPHQWLQWKH &RQWUDFW6XPWKHPHWKRGDQGWKHDGMXVWPHQWVKDOOEHGHWHUPLQHGE\WKH&LW\RQWKHEDVLVRI UHDVRQDEOHH[SHQGLWXUHVDQGVDYLQJVRIWKRVHSHUIRUPLQJWKH:RUNDWWULEXWDEOHWRWKHFKDQJH LQFOXGLQJLQWKHFDVHRIDQLQFUHDVHLQWKH&RQWUDFW6XP$OORZDEOH0DUN8SVLQDFFRUGDQFHZLWK 3DUDJUDSK ( KHUHLQ 35,&,1*&+$1*(6,17+(:25. $ $OWHUQDWLYH0HWKRGVRI3ULFLQJ 7KHDPRXQWRIDQ\DGMXVWPHQWE\&KDQJH2UGHURU&RQVWUXFWLRQ&KDQJH'LUHFWLYHLQFUHDVLQJRU GHFUHDVLQJWKH&RQWUDFW6XPVKDOOEHGHWHUPLQHGE\WKH'LUHFWRUXVLQJRQHRUDFRPELQDWLRQRIWKH IROORZLQJPHWKRGV Western Allied Corporation Page 45 of 221 . . Item 10 Page 45 of 221 /XPS6XP %\PXWXDODFFHSWDQFHRIDOXPSVXPSURSRVDOIURP&RQWUDFWRUSURSHUO\itemized DQGVXSSRUWHGE\VXIILFLHQWVXEVWDQWLDWLQJGDWDWRSHUPLWHYDOXDWLRQ 6XFKSURSRVDOVKDOOEH EDVHGVROHO\RQ$OORZDEOH&RVWVDVGHILQHGLQ6XESDUDJUDSK&DQG$OORZDEOH0DUN8SV DVGHILQHGLQ6XESDUDJUDSK(DQGVKDOOQRWLQFOXGHDQ\FRVWVRUH[SHQVHWKDWLVQRW SHUPLWWHGE\WKHWHUPVRIDQ\SURYLVLRQRIWKH&RQWUDFW'RFXPHQWV 8QLW3ULFHV%\XQLWSULFHVFRQWDLQHGLQ&RQWUDFWRU¶VRULJLQDO%LGDQGLQFRUSRUDWHGLQWKH&RQWUDFW 'RFXPHQWVRUIL[HGE\VXEVHTXHQWDJUHHPHQWEHWZHHQ&LW\DQG&RQWUDFWRU 8QOHVVRWKHUZLVH VWDWHGLQWKH%LGGLQJ'RFXPHQWVXQLWSULFHVVWDWHGLQWKH&RQWUDFW'RFXPHQWVRUDJUHHGXSRQ E\WKH&RXQW\DQG&RQWUDFWRUVKDOOEHGHHPHGWRLQFOXGHDQGHQFRPSDVVDOO$OORZDEOH0DUNXSV 7LPHDQG0DWHULDOV %\FDOFXODWLQJWKHDFWXDO$OORZDEOH&RVWVGLUHFWO\LQFXUUHGSOXVDVXPIRU $OORZDEOH0DUN8SVRQVXFK$OORZDEOH&RVWV 'HOHWLRQRI:RUN %\8QLW3ULFHVFRQWDLQHGLQ&RQWUDFWRU¶VRULJLQDO%LGDQGLQFRUSRUDWHGLQWKH &RQWUDFW'RFXPHQWVRUE\XVLQJWKH6FKHGXOHRI9DOXHVWRGHWHUPLQHWKHYDOXHRIWKHGHFUHDVH RIWKH&RQWUDFW6XPOHVVWKHYDOXHRIDQ\:RUNSHUIRUPHGSOXVDUHDVRQDEOHSHUFHQWDJHRI WKHGHFUHDVHIRUWKH&RQWUDFWRU¶VVDYHGRYHUKHDGXQOHVVWKH6FKHGXOHRI9DOXHVDOORFDWHV JHQHUDOFRQGLWLRQVFRVWVWRLQGLYLGXDOOLQHLWHPVLQZKLFKFDVHQRSHUFHQWDJHRIWKHGHFUHDVH VKDOOEHDGGHG:KHQDFKDQJHFRQVLVWVRIERWKDGGLWLRQDQGGHOHWLRQRI:RUNWKHDGGHGFRVWV DQGGHOHWHGFRVWVVKDOOEHFDOFXODWHGVHSDUDWHO\DQGWKHQDGGHGWRJHWKHUUHVXOWLQJLQWKHQHW FRVWIRUWKHFKDQJH7KH$OORZDEOH0DUN8SVKDOOEHDSSOLHGWRWKLVQHWFRVW % &RQWUDFWRU0DLQWHQDQFHRI'DLO\5HFRUGVIRU&KDQJHV ,QWKHHYHQWWKDW&RQWUDFWRULVGLUHFWHGWRSHUIRUPDQ\([WUD:RUNRUVKRXOG&RQWUDFWRU HQFRXQWHUFRQGLWLRQVZKLFKWKH&RQWUDFWRUEHOLHYHVZRXOGREOLJDWHWKH&LW\WRDGMXVWWKH&RQWUDFW 6XPDQGRUWKH&RQWUDFW7LPH&RQWUDFWRUVKDOOPDLQWDLQGHWDLOHGUHFRUGVRIWKHFRVWRIVXFK FKDQJHVRQDGDLO\EDVLVVXPPDUL]HGLQDGDLO\UHSRUWVXSSOHPHQWHGE\EDFNXSUHFRUGV6XFK UHFRUGVVKDOOLQFOXGHZLWKRXWOLPLWDWLRQ D /DERU $WWKHFORVHRIHDFKGD\RQZKLFKVXFK([WUD:RUNLVSHUIRUPHG&RQWUDFWRU VKDOOVXEPLWDQ([WUD:RUNODERUUHSRUWRQIRUPVSURYLGHGE\'LUHFWRUWR'LUHFWRUWKDW VHWVIRUWKDOLVWRIWKHDFWXDOKRXUVVSHQWLQSHUIRUPLQJWKH([WUD:RUNWKDWFOHDUO\ GLIIHUHQWLDWHVEHWZHHQWKHODERUH[SHQGHGRQWKH([WUD:RUNDQGRWKHU:RUNDQGWKH $OORZDEOH &RVWV IRU VXFK ([WUD :RUN SHUIRUPHG WKDW GD\ VKRZLQJWKH QDPHV RI ZRUNHUVWKHLUFODVVLILFDWLRQVKRXUVZRUNHGDQGKRXUO\UDWHV E 0DWHULDOV(TXLSPHQW $OLVWRI$OORZDEOH&RVWVRIPDWHULDOVDQGHTXLSPHQWFRQVXPHG LQ WKH SHUIRUPDQFH RI WKH ([WUD :RUN RQ WKH GD\ RQ ZKLFK VXFK ([WUD :RUN LV SHUIRUPHGWRJHWKHUZLWKFRSLHVRIDSSOLFDEOHGHOLYHU\WLFNHWVDQGXQLWSULFHVIRUDOO PDWHULDOVDQGIRUDOOHTXLSPHQWXVHGWKHW\SHRIHTXLSPHQWLGHQWLILFDWLRQQXPEHU KRXUVRIRSHUDWLRQ LQFOXGLQJORDGLQJDQGWUDQVSRUWDWLRQ DQGKRXUO\GDLO\UDWHVLQYROYHG IRUWKDWGD\ F 2WKHU6HUYLFHVRU([SHQGLWXUHV $OLVWRIRWKHUVHUYLFHVDQGH[SHQGLWXUHVFRQVWLWXWLQJ $OORZDEOH&RVWVLQFXUUHGLQSHUIRUPDQFHRIWKH([WUD:RUNRQWKHGD\RQZKLFKVXFK ([WUD:RUNLVSHUIRUPHGDORQJZLWKGRFXPHQWDWLRQYHULI\LQJWKHDPRXQWVWKHUHRILQ VXFKGHWDLODV'LUHFWRUPD\UHTXLUH Western Allied Corporation Page 46 of 221 . . Item 10 Page 46 of 221 ,QWKHHYHQWWKDWPRUHWKDQRQHFKDQJHWRWKH:RUNLVSHUIRUPHGE\WKH&RQWUDFWRULQDFDOHQGDU GD\&RQWUDFWRUVKDOOPDLQWDLQVHSDUDWHUHFRUGVRIODERUFRQVWUXFWLRQHTXLSPHQWPDWHULDOVDQG HTXLSPHQWIRUHDFKVXFKFKDQJH ,QWKHHYHQWWKDWDQ\6XEFRQWUDFWRURIDQ\WLHUVKDOOSURYLGH RUSHUIRUPDQ\SRUWLRQRIDQ\FKDQJHWRWKH:RUN&RQWUDFWRUVKDOOUHTXLUHWKDWHDFKVXFK 6XEFRQWUDFWRUPDLQWDLQUHFRUGVLQDFFRUGDQFHZLWKWKLV6HFWLRQ (DFKGDLO\UHFRUGPDLQWDLQHGKHUHXQGHUVKDOOEHVLJQHGE\&RQWUDFWRU VXFKVLJQDWXUHVKDOOEH GHHPHG&RQWUDFWRU¶VUHSUHVHQWDWLRQDQGZDUUDQW\WKDWDOOLQIRUPDWLRQFRQWDLQHGWKHUHLQLVWUXH DFFXUDWHFRPSOHWHDQGUHODWHVRQO\WRWKHFKDQJHUHIHUHQFHGWKHUHLQ$OOUHFRUGVPDLQWDLQHG E\6XEFRQWUDFWRUVRIDQ\WLHUUHODWLQJWRWKHFRVWVRIDFKDQJHLQWKH:RUNVKDOOEHVLJQHGE\ VXFK6XEFRQWUDFWRU¶VDXWKRUL]HGSURMHFWPDQDJHURUVXSHULQWHQGHQW $OOVXFKUHFRUGVVKDOOEHIRUZDUGHGWRWKH'LUHFWRURQWKHGD\WKH:RUNLVSHUIRUPHG VDPHGD\ IRULQGHSHQGHQWYHULILFDWLRQ7KH'LUHFWRUVKDOODWWHPSWWRUHYLHZDQGUHFRQFLOHFRVWVIRUFKDQJHV RQDGDLO\EDVLV5HFRUGVQRWDYDLODEOHRQWKHGD\RQZKLFKWKH([WUD:RUNLVSHUIRUPHGVXFK DVEXWQRWOLPLWHGWRPDWHULDOLQYRLFHVVKDOOEHVXEPLWWHGDVVRRQDVWKH\DUHDYDLODEOHEXWQRW ODWHUWKDQILYH FDOHQGDUGD\VDIWHUWKHHDUOLHURIWKHGD\RIGHOLYHU\RULQFRUSRUDWLRQRIWKH SDUWLFXODULWHPRI([WUD:RUNDWWKH6LWH 7KH'LUHFWRUPD\DGGLWLRQDOO\UHTXLUHDXWKHQWLFDWLRQRIDOOWLPHDQGPDWHULDOWLFNHWVDQGLQYRLFHV E\SHUVRQVGHVLJQDWHGE\WKH'LUHFWRUIRUVXFKSXUSRVH ,QWKHHYHQWWKDW&RQWUDFWRUVKDOOIDLO RUUHIXVHIRUDQ\UHDVRQWRPDLQWDLQRUPDNHDYDLODEOHIRULQVSHFWLRQ UHYLHZ DQGRU UHSURGXFWLRQVXFKUHFRUGVDGMXVWPHQWVWRWKH&RQWUDFW6XPRU&RQWUDFW7LPHLIDQ\RQDFFRXQW RIDQ\FKDQJHWRWKH:RUNPD\EHGHHPHGZDLYHGIRUWKDWGD\ &RQWUDFWRU¶VREOLJDWLRQWR PDLQWDLQEDFNXSUHFRUGVKHUHXQGHULVLQDGGLWLRQWRDQGQRWLQOLHXRIDQ\RWKHU&RQWUDFWRU REOLJDWLRQXQGHUWKH&RQWUDFW'RFXPHQWVZLWKUHVSHFWWRFKDQJHVWRWKH:RUN :DLYHUE\&RQWUDFWRU )DLOXUHWRVXEPLWVXFKUHFRUGVDVDUHUHTXLUHGE\WKLV3DUDJUDSKGDLO\ VKDOOZDLYHDQ\ULJKWVIRUUHFRYHU\RI$OORZDEOH&RVWVLQFXUUHGIRU([WUD:RUNSHUIRUPHGWKDW GD\ 7KHIDLOXUHRIWKH&RQWUDFWRUWRVHFXUHDQ\UHTXLUHGDXWKHQWLFDWLRQVKDOOLIWKH&LW\HOHFWV LQLWVVROHGLVFUHWLRQWRWUHDWLWDVVXFKFRQVWLWXWHDZDLYHUE\WKH&RQWUDFWRURIDQ\ULJKWWR DGMXVWPHQWRIWKH&RQWUDFW6XPIRUWKH$OORZDEOH&RVWRIDOORUWKDWSRUWLRQRIWKH([WUD:RUN FRYHUHGE\VXFKQRQDXWKHQWLFDWHGWLFNHWRULQYRLFH & $OORZDEOH&RVWV 7KHWHUP³$OORZDEOH&RVWV´VKDOOPHDQLQWKHFDVHRI([WUD:RUNDFWXDOFRVWVLQFXUUHGE\&RQWUDFWRU DQGRUDQ\6XEFRQWUDFWRUUHJDUGOHVVRIWLHUDQGQHFHVVDULO\LQYROYHGLQGLUHFWSHUIRUPDQFHRIWKH ([WUD:RUNRULQWKHFDVHRIGHOHWHGZRUNWKHDFWXDOFRVWVWKDWZRXOGKDYHEHHQLQFXUUHGLQ SHUIRUPLQJGHOHWHGZRUNE\&RQWUDFWRUDQGRUDQ\6XEFRQWUDFWRUUHJDUGOHVVRIWLHUDQGVKDOOEH OLPLWHGWRWKHIROORZLQJFRVWV /DERU6WUDLJKWWLPHZDJHVRUVDODULHVDQGRYHUWLPHZDJHVDQGVDODULHVVSHFLILFDOO\DXWKRUL]HG E\&LW\LQZULWLQJIRUHPSOR\HHVHPSOR\HGDWWKHVLWHRUDWIDEULFDWLRQVLWHVRIIWKHVLWHLQWKH GLUHFWSHUIRUPDQFHRIWKH([WUD:RUNRUWKDWZRXOGKDYHEHHQLQFXUUHGLQWKHGLUHFWSHUIRUPDQFH RIWKHGHOHWHGZRUNEDVHGRQWKHDFWXDOFRVWIRUZDJHVSUHYDLOLQJORFDOO\IRUHDFKFUDIWRUW\SH RIZRUNHUVDWWKHWLPHWKH([WUD:RUNLVGRQHRUWKHGHOHWHGZRUNLVRUGHUHGHOLPLQDWHG /DERU FRVWVIRUHTXLSPHQWRSHUDWRUVDQGKHOSHUVVKDOOEHUHSRUWHGRQO\ZKHQVXFKFRVWVDUHQRW LQFOXGHGLQWKHLQYRLFHIRUHTXLSPHQWUHQWDO7KHXVHRIODERUFODVVLILFDWLRQZKLFKZRXOGLQFUHDVH WKH$OORZDEOH&RVWIRU([WUD:RUNZLOOQRWEHSHUPLWWHGXQOHVV&RQWUDFWRUHVWDEOLVKHVWKH QHFHVVLW\IRUVXFKDGGLWLRQDOFRVWV Western Allied Corporation Page 47 of 221 . . Item 10 Page 47 of 221 %HQHILWV 3D\UROOWD[HVLQVXUDQFHKHDOWKDQGZHOIDUHSHQVLRQYDFDWLRQDSSUHQWLFHVKLSIXQGV DQGEHQHILWVUHTXLUHGE\ODZIXOFROOHFWLYHEDUJDLQLQJDJUHHPHQWVIRUHPSOR\HHVRQVWUDLJKWWLPH ZDJHVRUVDODULHVDQGRQRYHUWLPHZDJHVDQGVDODULHVVSHFLILFDOO\DXWKRUL]HGE\&LW\LQZULWLQJ IRUHPSOR\HHVHPSOR\HGDWWKHVLWHRUDWIDEULFDWLRQVLWHVRIIWKHVLWHLQWKHGLUHFWSHUIRUPDQFH RIWKH([WUD:RUNRUWKDWZRXOGKDYHEHHQLQFXUUHGLQWKHGLUHFWSHUIRUPDQFHRIWKHGHOHWHG ZRUN 0DWHULDOV&RQVXPDEOHV &RVWVRIPDWHULDOVDQGFRQVXPDEOHLWHPVZKLFKDUHIXUQLVKHGDQG LQFRUSRUDWHGLQWRWKH:RUNDVDSSURYHGE\&LW\RUWKDWZRXOGKDYHEHHQLQFRUSRUDWHGLQWRWKH :RUNLQWKHFDVHRIGHOHWHGZRUNVKDOOEHDWWKHORZHVWSULFHDYDLODEOHWR&RQWUDFWRUEXWLQQR HYHQW VKDOO VXFK FRVWV H[FHHG FRPSHWLWLYH ZKROHVDOH SULFHV REWDLQDEOH IURP RWKHU 6XEFRQWUDFWRUVVXSSOLHUVPDQXIDFWXUHUVDQGGLVWULEXWRUVLQWKHJHQHUDOYLFLQLW\RIWKHVLWH ,I &LW\GHWHUPLQHVLQLWVGLVFUHWLRQWKDWWKHFRVWRIPDWHULDOVLVH[FHVVLYHRULI&RQWUDFWRUIDLOVWR IXUQLVKVDWLVIDFWRU\HYLGHQFHRIWKHFRVWIURPWKHDFWXDOVXSSOLHUWKHUHRIWKHQLQHLWKHUFDVHWKH FRVWRIWKHPDWHULDOVVKDOOEHGHHPHGWREHWKHORZHVWZKROHVDOHSULFHDWZKLFKVLPLODUPDWHULDOV DUHDYDLODEOHLQWKHTXDQWLWLHVUHTXLUHGDWWKHWLPHWKH\ZHUHQHHGHG7KH&LW\UHVHUYHVWKHULJKW WRIXUQLVKVXFKPDWHULDOVDVLWGHHPVDGYLVDEOHDQG&RQWUDFWRUVKDOOKDYHQRFODLPIRUFRVWVRU SURILWVRQPDWHULDOVVRIXUQLVKHG0DWHULDOLQYRLFHVPXVWEHLQFOXGHGZLWKWKHH[WUDZRUNUHSRUW WRREWDLQSD\PHQW 7D[HV 6DOHVWD[HVRQWKHFRVWVRIPDWHULDOVDQGFRQVXPDEOHLWHPVGHVFULEHGLQ3DUDJUDSK &DERYH 7RRO(TXLSPHQW5HQWDO 5HQWDOFKDUJHVIRUQHFHVVDU\PDFKLQHU\DQGHTXLSPHQWZKHWKHU RZQHGRUKLUHGDVDXWKRUL]HGLQZULWLQJE\&LW\H[FOXVLYHRIKDQGWRROVXVHGGLUHFWO\LQWKH SHUIRUPDQFHRIWKH([WUD:RUNRUWKDWZRXOGKDYHEHHQXVHGLQWKHGLUHFWSHUIRUPDQFHRIWKH GHOHWHGZRUN 5HJDUGOHVVRIRZQHUVKLSVXFKUHQWDOFKDUJHVVKDOOQRWH[FHHGWKHKRXUO\UDWH GHULYHGIURPWKHPRVWUHFHQWO\SXEOLVKHG³5HQWDO5DWH%OXH%RRNIRU&RQVWUXFWLRQ(TXLSPHQW´ RUWKH³5HQWDO5DWH%OXH%RRNIRU2OGHU&RQVWUXFWLRQ(TXLSPHQW´DVSXEOLVKHGE\.6DQ -RVH&DOLIRUQLDZKLFKLVLQHIIHFWDWWKHWLPHRIFRPPHQFHPHQWRIWKHFKDQJHGZRUN7KH &RQWUDFWRUVKDOODWWDFKDFRS\RIWKHUDWHVFKHGXOHWRWKHGDLO\UHSRUWVUHTXLUHGE\3DUDJUDSK %DERYH7KHFKDUJHVIRUDQ\PDFKLQHU\DQGHTXLSPHQWVKDOOFHDVHZKHQWKHXVHWKHUHRI LVQRORQJHUQHFHVVDU\IRUWKH([WUD:RUNRUGHOHWHGZRUN 1RFKDUJHVKDOOEHDOORZHGIRUXVH RIHTXLSPHQWRUWRROVZKLFKKDYHDUHSODFHPHQWYDOXHRIRUOHVV 7KHDOORZDEOHUHQWDO UDWHVVKDOOLQFOXGHWKHFRVWRIIXHOSRZHURLOOXEULFDWLRQVXSSOLHVVPDOOWRROVQHFHVVDU\ DWWDFKPHQWV ORDGLQJ WUDQVSRUWDWLRQ UHSDLUV DQG PDLQWHQDQFH RI DQ\ NLQG GHSUHFLDWLRQ VWRUDJHLQVXUDQFHDQGDOOLQFLGHQWDOV 1RWZLWKVWDQGLQJWKHSURYLVLRQVRI3DUDJUDSK( EHORZQRPDUNXSVKDOOEHDOORZHGIRURYHUKHDGSURILWRUERQGSUHPLXPVIRUXVHRIHTXLSPHQW LIWKHHTXLSPHQWLVVXSSOLHGE\DQHTXLSPHQWUHQWDOILUP,IHTXLSPHQWLVXVHGLQWHUPLWWHQWO\DQG ZKHQQRWLQXVHFRXOGEHUHWXUQHGWRLWVUHQWDOVRXUFHDWOHVVH[SHQVHWR&LW\WKDQKROGLQJLWDW WKH6LWHLWVKDOOEHUHWXUQHGXQOHVV&RQWUDFWRUHOHFWVWRNHHSLWDWWKH6LWHDWQRH[SHQVHWR&LW\ &RVWVLQFXUUHGZKLOHHTXLSPHQWLVLQRSHUDWLYHGXHWREUHDNGRZQVUHJXODUPDLQWHQDQFHRUIRU QRQ:RUNLQJ'D\VVKDOOQRWEHDOORZHG 7KHUHQWDOWLPHVKDOOLQFOXGHWKHWLPHUHTXLUHGWRPRYH WKHHTXLSPHQWWRWKH:RUNIURPWKHQHDUHVWDYDLODEOHVRXUFHIRUUHQWDORIVXFKHTXLSPHQWDQG WRUHWXUQLWWRWKHVRXUFH ,IVXFKHTXLSPHQWLVQRWPRYHGE\LWVRZQSRZHUWKHQORDGLQJDQG WUDQVSRUWDWLRQZLOOEHDOORZHG 1HLWKHUPRYLQJWLPHQRUORDGLQJDQGWUDQVSRUWDWLRQFRVWVZLOOEH SDLGLIWKHHTXLSPHQWLVIRUXVHRQWKH3URMHFWXQUHODWHGWRWKH([WUD:RUN $OOHTXLSPHQWVKDOO EHDFFHSWDEOHWR&LW\LQJRRGZRUNLQJFRQGLWLRQDQGVXLWDEOHIRUWKHSXUSRVHIRUZKLFKLWLVWR EHXVHG Western Allied Corporation Page 48 of 221 . . Item 10 Page 48 of 221 5R\DOWLHV $GGLWLRQDORUVDYHGFRVWVRIUR\DOWLHVGXHWRWKHSHUIRUPDQFHRIWKH([WUD:RUNRU GHOHWHGZRUN ,QVXUDQFH%RQGV $GGLWLRQDORUVDYHGFRVWVRILQVXUDQFHDQGERQGVSURYLGHGKRZHYHUWKDW IRU([WUD:RUNVXFKFRVWVVKDOOQRWH[FHHGRQHSHUFHQW RI,WHPVWKURXJKDERYH ' &RVWV1RW$OORZHG $OORZDEOH&RVWVVKDOOQRWLQFOXGHDQ\RIWKHIROORZLQJ :DJHVVDODULHVIULQJHEHQHILWVDQGSD\UROOWD[HVRI&RQWUDFWRU¶VDQGDOO6XEFRQWUDFWRU¶VQRQ FUDIWODERU DERYHD)RUHPDQOHYHO 2YHUKHDG LQFOXGLQJKRPHRIILFHRYHUKHDG DGPLQLVWUDWLYHRUJHQHUDOH[SHQVHVRIDQ\NLQG LQFOXGLQJHQJLQHHULQJHVWLPDWLQJVFKHGXOLQJGUDIWLQJGHWDLOLQJHWFLQFXUUHGLQFRQQHFWLRQ ZLWK([WUD:RUN 9HKLFOHVQRWGHGLFDWHGVROHO\IRUWKHSHUIRUPDQFHRIWKHH[WUDRIGHOHWHGZRUN 6PDOOWRROV UHSODFHPHQWYDOXHQRWH[FHHGLQJ 2IILFHH[SHQVHVLQFOXGLQJVHFUHWDULDODQGDGPLQLVWUDWLYHVWDIIPDWHULDOVDQGVXSSOLHV 2QVLWHDQGRIIVLWHWUDLOHUDQGVWRUDJHUHQWDODQGH[SHQVHV 6LWHIHQFLQJ 8WLOLWLHVLQFOXGLQJJDVHOHFWULFVHZHUZDWHUWHOHSKRQHWHOHID[FRSLHUHTXLSPHQW &RPSXWHUDQGGDWDSURFHVVLQJSHUVRQQHOHTXLSPHQWDQGVRIWZDUH )HGHUDOVWDWHRIORFDOEXVLQHVVLQFRPHDQGIUDQFKLVHWD[HV /RVVHVRIHIILFLHQF\RUSURGXFWLYLW\ DQG &RVWVDQGH[SHQVHVRIDQ\NLQGRULWHPQRWVSHFLILFDOO\DQGH[SUHVVO\LQFOXGHGLQ3DUDJUDSK & (Allowable Mark-Up ([WUD:RUNE\FRQWUDFWRU 0DUNXS 7KHIROORZLQJSHUFHQWDJHVVKDOOEHDGGHGWRWKH&RQWUDFWRU¶VFRVWV DQGVKDOOFRQVWLWXWHWKHPDUNXSIRUDOORYHUKHDGDQGSURILWV /DERU 0DWHULDOV (TXLSPHQW5HQWDO 2WKHU,WHPVDQG([SHQGLWXUHV ([WUD:RUNE\6XEFRQWUDFWRU 0DUNXS :KHQDOORUDQ\SDUWRIWKHH[WUDZRUNLVSHUIRUPHGE\D 6XEFRQWUDFWRU WKH PDUNXS SURYLGHG IRU WKH &RQWUDFWRU LQ ( VKDOO DSSO\ WR WKH 6XEFRQWUDFWRU¶VDFWXDOFRVWV$PDUNXSRIRQWKHVXEFRQWUDFWHGSRUWLRQRIHDFKH[WUDZRUN PD\EHDGGHGIRUWKH&RQWUDFWRU Western Allied Corporation Page 49 of 221 . . Item 10 Page 49 of 221 ) 1HW$OORZDEOH&RVWV ,IDQ\RQHVFRSHFKDQJHLQYROYHVERWK([WUD:RUNDQGGHOHWHGZRUNLQWKHVDPHSRUWLRQRIWKH:RUN DQGWKHDGGLWLYHDOORZDEOHFRVWVH[FHHGWKHGHGXFWLYHDOORZDEOHFRVWVWKH$OORZDEOH0DUNXSVRQ WKH([WUD:RUNZLOOEHRQO\WKHGLIIHUHQFHEHWZHHQWKHWZRDPRXQWV &,7<25,*,1$7('5(48(67)25,7(0,=('&+$1*(25'(5352326$/5(48(67 &LW\PD\LVVXHD&RQVWUXFWLRQ&KDQJH'LUHFWLYHRURWKHUZULWWHQUHTXHVWWR&RQWUDFWRUGHVFULELQJDSURSRVHG FKDQJHWRWKH:RUNDQGUHTXHVWLQJWKH&RQWUDFWRUVXEPLWDQLWHPL]HGFKDQJHRUGHUSURSRVDOLQDIRUPDW DFFHSWDEOHWR&LW\ZLWKLQWHQ FDOHQGDUGD\VDIWHU&LW\LVVXHVWKHUHTXHVW7KH&RQWUDFWRU VFKDQJHRUGHU SURSRVDOVKDOOLQFOXGHDQDQDO\VLVRILPSDFWVWRFRVWDQGWLPHLIDQ\WRSHUIRUPDGGLWLRQDOZRUNFKDQJH:RUN RUGHOHWH:RUNDVDSSOLFDEOHLQFOXGLQJWKHHIIHFWVDQGLPSDFWVLIDQ\RQXQFKDQJHG:RUNHVWLPDWHVRIFRVWV EURNHQGRZQE\WKHFRVWFDWHJRULHVOLVWHGLQWKLV3DUDJUDSK DQG&RQWUDFWRU VSURSRVHGPHWKRGVWRPLQLPL]H FRVWVGHOD\DQGGLVUXSWLRQWRWKHSHUIRUPDQFHRIWKH:RUN,I&RQWUDFWRUIDLOVWRVXEPLWDZULWWHQFKDQJHRUGHU SURSRVDOZLWKLQVXFKSHULRGRIWLPHLWVKDOOEHSUHVXPHGWKDWWKHFKDQJHGHVFULEHGLQWKH&LW\ VRULJLQDO SURSRVDOUHTXHVWZLOOQRWUHVXOWLQDQLQFUHDVHWRWKH&RQWUDFW6XPRU&RQWUDFW7LPHDQGWKHFKDQJHVKDOOEH SHUIRUPHGE\&RQWUDFWRUZLWKRXWDGGLWLRQDOFRPSHQVDWLRQWR&RQWUDFWRU&LW\ VUHTXHVWIRULWHPL]HG Western Allied Corporation Page 50 of 221 . . Item 10 Page 50 of 221 FKDQJHRUGHUSURSRVDOUHTXHVWGRHVQRWDXWKRUL]HWKH&RQWUDFWRUWRFRPPHQFHSHUIRUPDQFHRIWKHFKDQJH ,I&LW\GHVLUHVWKDWWKHSURSRVHGFKDQJHEHSHUIRUPHGWKH:RUNVKDOOEHDXWKRUL]HGDFFRUGLQJWRWKH&KDQJH 2UGHURU&RQVWUXFWLRQ&KDQJH'LUHFWLYHSURFHGXUHVVHWIRUWKKHUHLQ &2175$&72525,*,1$7('&+$1*(25'(55(48(67 &25 ,IWKH&RQWUDFWRUEHOLHYHVWKDWLQVWUXFWLRQVLVVXHGE\WKH&LW\DIWHUWKHHIIHFWLYHGDWHRIWKH&RQWUDFWZLOOUHVXOW LQFKDQJHVWRWKH&RQWUDFW6XPRU&RQWUDFW7LPHRULIWKH&RQWUDFWRURWKHUZLVHEHFRPHVDZDUHRIWKHQHHG IRURUGHVLUDELOLW\RIDFKDQJHLQWKH:RUN&RQWUDFWRUPD\VXEPLWDZULWWHQ&KDQJH2UGHU5HTXHVW &25 WRWKH&LW\LQZULWLQJLQDIRUPDWDFFHSWDEOHWR&LW\DQGLQDFFRUGDQFHZLWKWKHQRWLFHSURYLVLRQVDQGRWKHU UHTXLUHPHQWVRI$UWLFOHEHORZIRU&ODLPV7KH&25PXVWVSHFLI\WKHUHDVRQVIRUWKHSURSRVHGFKDQJHFRVW LPSDFWVDQGUHOHYDQWFLUFXPVWDQFHVDQGLPSDFWVRQWKH&RQVWUXFWLRQ6FKHGXOH7KHGRFXPHQWVKDOOEH FRPSOHWHLQLWVGHVFULSWLRQRIWKH:RUNLWVPDWHULDODQGODERUTXDQWLWLHVDQGGHWDLODQGPXVWVXSSRUWDQG MXVWLI\WKHFRVWVDQGFUHGLWVFODLPHGE\WKH&RQWUDFWRU$&ULWLFDO3DWK0HWKRGVFKHGXOH)UDJQHWLVUHTXLUHG WRVXSSRUWDQGMXVWLI\DQ\DGGLWLRQDOWLPHRISHUIRUPDQFHUHTXHVWHGE\WKH&RQWUDFWRU7KH&LW\ZLOOQRWUHYLHZ DQ\&25ZKLFKLVLQFRPSOHWH7KH&RQWUDFWRUPD\UHTXHVWDGGLWLRQDOFRPSHQVDWLRQDQGRUWLPHWKURXJKD &25EXWQRWIRULQVWDQFHVWKDWRFFXUUHGPRUHWKDQWHQ FDOHQGDUGD\VSULRUWRWKHQRWLFHGDWH&RQWUDFWRU V IDLOXUH WR LQLWLDWH D &25 ZLWKLQ WKLV WHQGD\ SHULRG RU WR SURYLGH GHWDLOHG EDFNXS GRFXPHQWDWLRQ WR VXEVWDQWLDWHWKH&25ZLWKLQWKLUW\ FDOHQGDUGD\VRIWKHLQLWLDOZULWWHQQRWLFHVKDOOEHGHHPHGDZDLYHURI WKHULJKWWRDGMXVWPHQWRIWKH&RQWUDFW6XPRUWKH&RQWUDFW7LPHIRUWKHDOOHJHGFKDQJH$Q\&25WKDWLV DSSURYHGE\WKH&LW\VKDOOEHLQFRUSRUDWHGLQD&KDQJH2UGHURU&RQVWUXFWLRQ&KDQJH'LUHFWLYH ,IWKH&25 LVGHQLHGEXWWKH&RQWUDFWRUEHOLHYHVWKDWLWGRHVKDYHPHULWWKH&RQWUDFWRUVKDOOSURFHHGZLWKWKHGLVSXWHG :RUNDQGPD\VXEPLWD&ODLPLQDFFRUGDQFHZLWKWKHSURFHGXUHVVHWIRUWKKHUHLQ ,668$1&(2):25.',5(&7,9( 81,/$7(5$/ ,QWKHHYHQWRIDGLVSXWHDVWRZKHWKHURUQRW([WUD:RUNLVUHTXLUHG&LW\VKDOOKDYHWKHULJKWWRXQLODWHUDOO\ LVVXHD:RUN'LUHFWLYH &RQWUDFWRUVKDOOFRQWLQXHSHUIRUPDQFHRIGLVSXWHG:RUNSHQGLQJUHVROXWLRQDQGVKDOO PDLQWDLQDQGVXEPLWWR&LW\DOODFFRXQWLQJDQGFRVWGDWDQHFHVVDU\WRVXEVWDQWLDWH&RQWUDFWRU¶VFRVWRIVXFK GLVSXWHG:RUN >(1'2)$57,&/(@ Western Allied Corporation Page 51 of 221 . . Item 10 Page 51 of 221 ARTICLE 7 - CONTRACT PAYMENTS AND CLAIMS *(1(5$/ $ 3D\PHQWZLOOEHPDGHDWWKHSULFHIRUHDFKLWHPOLVWHGRQWKHELGGLQJIRUPRUDV([WUD:RUNDVSURYLGHG LQWKH*HQHUDO&RQGLWLRQV % ,QLWLDOSURJUHVVSD\PHQWZLOOQRWEHPDGHSULRUWRDSSURYDOE\WKH'LUHFWRURIWKH6FKHGXOHRI9DOXHV WKH&RQVWUXFWLRQ3URJUHVV6FKHGXOHDQGWKH6FKHGXOHRI6XEPLWWDOV & 1RVXEVHTXHQWSURJUHVVSD\PHQWZLOOEHPDGHSULRUWRUHFHLSWE\WKH'LUHFWRURIWKHPRQWKO\UHYLVLRQ RIWKH&RQVWUXFWLRQ3URJUHVV6FKHGXOH 6&+('8/(2)9$/8(6)253$<0(176 $ 6XEPLVVLRQ 8SRQ&LW\¶VUHTXHVWWKHWKUHH ORZHVWELGGHUVVKDOOFRPSOHWHDQGVXEPLWD3UHOLPLQDU\6FKHGXOH RI9DOXHVZLWKLQVHYHQ FDOHQGDUGD\V ,QDGGLWLRQ&RQWUDFWRUVKDOOFRPSOHWHDQGIXUQLVKZLWKLQVHYHQ FDOHQGDUGD\VDIWHUUHFHLYLQJWKH 1RWLFH RI $ZDUG RI WKH &RQVWUXFWLRQ &RQWUDFW D )LQDO 6FKHGXOH RI 9DOXHV JLYLQJ D FRPSOHWH EUHDNGRZQRIWKH&RQWUDFW6XPIRUHDFKFRPSRQHQWRIWKH:RUN % &RQWHQW 7KH6FKHGXOHRI9DOXHVVKDOOEHLQVXIILFLHQWGHWDLODVWKH'LUHFWRUPD\LQLWVGLVFUHWLRQGHHP QHFHVVDU\WRHYDOXDWHSURJUHVVDWDQ\SRLQWLQWKHSHUIRUPDQFHRIWKH:RUN8QOHVVRWKHUZLVH VSHFLILHGLQWKH&RQWUDFW'RFXPHQWVWKH6FKHGXOHRI9DOXHVVKDOOLQFOXGHZLWKRXWOLPLWDWLRQD EUHDNGRZQRIWKHJHQHUDOFDWHJRULHVRI6XEFRQWUDFWRUZRUNGLUHFWRYHUKHDGSURILWDQGFRQWLQJHQF\ DQGDIXUWKHUEUHDNGRZQRIWKHJHQHUDOFDWHJRULHVRI6XEFRQWUDFWRUZRUNLQWRVHSDUDWHWUDGHOLQH LWHPVRIFRVWVIRU6XEFRQWUDFWRUVHUYLFHVODERUDQGPDWHULDOZKLFKLVEDVHGRQDFWXDO6XEFRQWUDFWRU FRQWUDFWVXEFRQWUDFWSXUFKDVHRUGHURUYHQGRUSULFHV,IUHTXHVWHGE\'LUHFWRU&RQWUDFWRUVKDOO UHYLVHWKH6FKHGXOHRI9DOXHVWRDOORFDWHVXPVIRU&RQWUDFWRURYHUKHDGSURILWDQGRUFRQWLQJHQF\ DPRQJWKHLQGLYLGXDOOLQHLWHPVIRUWUDGHSRUWLRQVRIWKH:RUN1RDPRXQWVVKDOOEHUHIOHFWHGLQWKH 6FKHGXOHRI9DOXHVRU$SSOLFDWLRQIRU3D\PHQWIRU([WUD:RUNRU'HOHWHG:RUNIRUZKLFKD&KDQJH 2UGHUKDVQRWEHHQH[HFXWHGE\&RQWUDFWRUDQG&LW\RUIRUZKLFKD&RQVWUXFWLRQ&KDQJH'LUHFWLYH KDVQRWEHHQLVVXHGE\&LW\$PRXQWVWKDWKDYHEHHQPXWXDOO\DJUHHGWRE\&KDQJH2UGHURU XQLODWHUDOO\GHWHUPLQHGE\&LW\SXUVXDQWWRD&RQVWUXFWLRQ&KDQJH'LUHFWLYHVKDOOEHVHJUHJDWHGIURP WKHFRVWRIWKHEDVH&RQWUDFW:RUNDQGVHSDUDWHO\OLVWHGE\OLQHLWHPLQWKH6FKHGXOHRI9DOXHV7KH 6FKHGXOHRI9DOXHVPXVWEHSUHSDUHG LQ VXIILFLHQW GHWDLO DQG VXSSRUWHG E\ VXIILFLHQW GDWD WR VXEVWDQWLDWHLWVDFFXUDF\DVWKH'LUHFWRUPD\UHTXLUH & $SSOLFDWLRQVIRU3D\PHQW 7KH6FKHGXOHRI9DOXHVZKHQDSSURYHGE\WKH'LUHFWRUVKDOOEHXVHGDVDEDVLVIRU&RQWUDFWRU V $SSOLFDWLRQVIRU3D\PHQWDQGPD\EHFRQVLGHUHGDVIL[LQJDEDVLVIRUDGMXVWPHQWVWRWKH&RQWUDFW 6XP Western Allied Corporation Page 52 of 221 . . Item 10 Page 52 of 221 ' 5HYLVLRQV ,IDWDQ\WLPHLWLVGHWHUPLQHGWKDWWKH6FKHGXOHRI9DOXHVGRHVQRWDOORFDWHWKH&RQWUDFW6XPLQD PDQQHUWKDWUHDVRQDEO\DQGIDLUO\UHIOHFWVWKHDFWXDOFRVWVDQWLFLSDWHGWREHSURJUHVVLYHO\LQFXUUHG E\&RQWUDFWRULWVKDOOEHUHYLVHGDQGUHVXEPLWWHGIRUWKH'LUHFWRU¶VDSSURYDO $33/,&$7,216)253$<0(17 $ 0DUNHG6FKHGXOHRI9DOXHV )LYH 'D\VSULRUWRWKHGDWHVHWIRUWKLQ3DUDJUDSK%EHORZIRUWKHPRQWKO\SURJUHVVSD\PHQW PHHWLQJ&RQWUDFWRUVKDOOVXEPLWWR'LUHFWRUDFRS\RIWKHSURSRVHG6FKHGXOHRI9DOXHVPDUNHGWR VKRZWKHSHUFHQWDJHRIFRPSOHWLRQFHUWLILHGE\&RQWUDFWRUIRUHDFKOLQHLWHPLQWKH6FKHGXOHRI 9DOXHVLQFOXGLQJDQ\VWRUHGPDWHULDOVDSSURYHGIRUSD\PHQWE\&LW\SXUVXDQWWR3DUDJUDSK' EHORZDQGDQ\ZLWKKROGLQJVIURP&RQWUDFWRUSURSRVHGE\'LUHFWRU % 0RQWKO\5HYLHZ )RUWKHSXUSRVHRIH[SHGLWLQJWKHSURJUHVVSD\PHQWSURFHGXUH&RQWUDFWRUVKDOOPHHWZLWKWKH 'LUHFWRURQRUEHIRUHWKHWZHQWLHWK WK GD\RIHDFKPRQWKWRUHYLHZWKH&RQWUDFWRU VPDUNHG 6FKHGXOHRI9DOXHVSUHSDUHGLQDFFRUGDQFHZLWK3DUDJUDSK$DERYH7KH'LUHFWRUVKDOOUHYLVH DVDSSURSULDWHDQGVLJQWKHPDUNHG6FKHGXOHRI9DOXHVWRYHULI\VXFKUHYLHZ,IDQ\LWHPLQWKH PDUNHG6FKHGXOHRI9DOXHVVXEPLWWHGIRUSD\PHQWLVGLVSXWHGGXULQJWKLVUHYLHZ&RQWUDFWRUDJUHHV WRXVHLWVEHVWHIIRUWVWRUHVROYHWKHGLVSXWHGLWHPVZLWKWKH'LUHFWRUEHIRUHVXEPLWWLQJLWV$SSOLFDWLRQ IRU3D\PHQW,IWKH'LUHFWRUDQG&RQWUDFWRUFDQQRWDJUHHWKHQWKHSHUFHQWDJHFRPSOHWLRQVKDOOEH HVWDEOLVKHGDWVXFKSHUFHQWDJHDVWKH'LUHFWRULQJRRGIDLWKGHWHUPLQHVLVDSSURSULDWHWRWKHDFWXDO SURJUHVVRIWKH:RUN1RLQDFFXUDF\RUHUURULQWKH'LUHFWRU¶VJRRGIDLWKHVWLPDWHVKDOORSHUDWHWR UHOHDVH&RQWUDFWRURU6XUHW\IURPDQ\UHVSRQVLELOLW\RUOLDELOLW\DULVLQJIURPRUUHODWHGWRSHUIRUPDQFH RIWKH:RUN7KH'LUHFWRUVKDOOKDYHWKHULJKWVXEVHTXHQWO\WRFRUUHFWDQ\HUURUDQGGLVSXWHDQ\LWHP VXEPLWWHGLQ&RQWUDFWRU V$SSOLFDWLRQIRU3D\PHQWUHJDUGOHVVRIZKHWKHUDQLWHPZDVLGHQWLILHGDV GLVSXWHGLQWKHUHYLHZSURFHVVSURYLGHGIRUKHUHLQ & &HUWLILFDWLRQ (DFK$SSOLFDWLRQIRU3D\PHQWVKDOOEHVLJQHGDQGFHUWLILHGE\&RQWUDFWRUXQGHUSHQDOW\RISHUMXU\WR &LW\WKDW 7KHGDWDFRPSULVLQJWKH$SSOLFDWLRQIRU3D\PHQWLVDFFXUDWHDQGWKH:RUNKDVSURJUHVVHGWR WKHSRLQWLQGLFDWHG 7RWKHEHVWRI&RQWUDFWRU VNQRZOHGJHLQIRUPDWLRQDQGEHOLHIWKH:RUNLVLQDFFRUGDQFHZLWK WKH&RQWUDFW'RFXPHQWV &RQWUDFWRULVHQWLWOHGWRSD\PHQWLQWKHDPRXQWFHUWLILHG DQG $OOVXPVSUHYLRXVO\DSSOLHGIRUE\&RQWUDFWRURQDFFRXQWRI:RUNSHUIRUPHGE\6XEFRQWUDFWRUV DQGWKDWKDYHEHHQSDLGE\&LW\KDYHEHHQSDLGWRWKH6XEFRQWUDFWRUVSHUIRUPLQJVXFK:RUN ZLWKRXWDQ\UHWHQWLRQZLWKKROGLQJRUEDFNFKDUJHE\&RQWUDFWRU Western Allied Corporation Page 53 of 221 . . Item 10 Page 53 of 221 ' 6WRUHG0DWHULDOV 3D\PHQWV PD\ EH PDGH E\ &LW\ DW LWV GLVFUHWLRQ RQ DFFRXQW RIPDWHULDOV RU HTXLSPHQW QRW LQFRUSRUDWHGLQWRWKH:RUNEXWGHOLYHUHGRQWKHJURXQGDWWKH6LWHDQGVXLWDEO\VWRUHGE\&RQWUDFWRU RUVWRUHGRII6LWHXQGHUWKHFRQWURORI&LW\6XFKSD\PHQWVVKDOORQO\EHFRQVLGHUHGXSRQVXEPLVVLRQ E\&RQWUDFWRURIVDWLVIDFWRU\HYLGHQFHWKDWLWKDVDFTXLUHGWLWOHWRVDPHWKDWWKHPDWHULDORUHTXLSPHQW ZLOOEHXWLOL]HGLQWKH:RUNDQGWKDWWKHPDWHULDOLVVDWLVIDFWRULO\VWRUHGSURWHFWHGDQGLQVXUHGDQG WKDW VXFK RWKHU SURFHGXUHV DUH LQ SODFH VDWLVIDFWRU\ WR &LW\ WR SURWHFW &LW\ V LQWHUHVWV 7R EH FRQVLGHUHGIRUSD\PHQWPDWHULDOVRUHTXLSPHQWVWRUHGRII6LWHVKDOOLQDGGLWLRQWRWKHDERYH UHTXLUHPHQWVDQGXQOHVVRWKHUZLVHVSHFLILFDOO\DSSURYHGE\&LW\LQZULWLQJEHVWRUHGLQDERQGHG ZDUHKRXVHIXOO\LQVXUHGDQGDYDLODEOHWR&LW\IRULQVSHFWLRQ&LW\VKDOOKDYHVROHGLVFUHWLRQWR GHWHUPLQHWKHDPRXQWRIPDWHULDODQGHTXLSPHQWWKDWPD\EHVWRUHGRQWKH6LWHDWDQ\JLYHQWLPH 352*5(663$<0(176 $ &RQGLWLRQVWR3URJUHVV3D\PHQWV &RQWUDFWRUVKDOOVXEPLWLWV$SSOLFDWLRQIRU3D\PHQWWRWKH'LUHFWRUXVLQJVXFKIRUPVDVUHTXLUHGE\ &LW\RQFHDPRQWKRQRUEHIRUHWKHILUVW VW 'D\RIWKHPRQWKIROORZLQJWKHPRQWKLQZKLFKWKH:RUN WKDWLVWKHVXEMHFWRIVXFK$SSOLFDWLRQIRU3D\PHQWZDVSHUIRUPHG:LWKRXWOLPLWDWLRQWRDQ\RWKHU SURYLVLRQVRIWKH&RQWUDFW'RFXPHQWVWKHIROORZLQJVKDOOEHFRQGLWLRQVSUHFHGHQWWRDSURSHU VXEPLVVLRQDQGWRWKH'LUHFWRUDSSURYDORIHDFK$SSOLFDWLRQIRU3D\PHQW 6XEPLVVLRQRID6FKHGXOHRI9DOXHVWKDWUHIOHFWVWKHSHUFHQWDJHVRIFRPSOHWLRQHLWKHUDJUHHG WRRUGHWHUPLQHGE\'LUHFWRULQDFFRUGDQFHZLWK3DUDJUDSK%DERYH 6XEPLVVLRQRIWKH&RQWUDFWRU VFHUWLILFDWLRQUHTXLUHGE\3DUDJUDSK&DERYH 6XEPLVVLRQ RI FRQGLWLRQDO UHOHDVHV RI VWRS QRWLFH LI DQ\ DQG ERQG ULJKWV XSRQ SURJUHVV SD\PHQWFRPSO\LQJZLWK&DOLIRUQLD&LYLO&RGH6HFWLRQIRUDOO:RUNSHUIRUPHGGXULQJWKH WLPH SHULRG FRYHUHG E\ WKH FXUUHQW $SSOLFDWLRQ IRU 3D\PHQW VLJQHG E\ &RQWUDFWRU LWV 6XEFRQWUDFWRUVRIHYHU\WLHUDQGDOOPDWHULDOVXSSOLHUVWRHDFKDQG IRUPVRIXQFRQGLWLRQDO UHOHDVHRIVWRSQRWLFHDQGERQGULJKWVXSRQSURJUHVVSD\PHQWFRPSO\LQJZLWK&DOLIRUQLD&LYLO &RGH6HFWLRQIRUDOO:RUNSHUIRUPHGGXULQJWKHWLPHSHULRGFRYHUHGE\WKHSUHYLRXV $SSOLFDWLRQIRU3D\PHQWVLJQHGE\&RQWUDFWRULWV6XEFRQWUDFWRUVRIHYHU\WLHUDQGDOOPDWHULDO VXSSOLHUVWRHDFK &RPSOLDQFHE\&RQWUDFWRUZLWKLWVREOLJDWLRQIRUPDLQWHQDQFHRI$V%XLOWVDVUHTXLUHGE\WKH &RQWUDFW'RFXPHQWV &RPSOLDQFHE\&RQWUDFWRUZLWKLWVREOLJDWLRQIRUVXEPLVVLRQRIPRQWKO\DQGGDLO\UHSRUWVDV UHTXLUHGE\WKH&RQWUDFW'RFXPHQWV &RPSOLDQFHE\&RQWUDFWRUZLWKLWVREOLJDWLRQVIRUVXEPLVVLRQRIVFKHGXOLQJLQIRUPDWLRQDQG XSGDWLQJRIWKH&RQVWUXFWLRQ6FKHGXOHDVUHTXLUHGE\$UWLFOHDERYHDQGRWKHUSURYLVLRQVRI WKH&RQWUDFW'RFXPHQWVSHUWDLQLQJWRSUHSDUDWLRQRUXSGDWLQJRIVFKHGXOHLQIRUPDWLRQ 6XEPLVVLRQRIFHUWLILHGSD\UROOUHFRUGVDVUHTXLUHGE\WKH&RQWUDFW'RFXPHQWV 6XEPLVVLRQRIFHUWLILFDWLRQVE\&RQWUDFWRUDQGHDFK6XEFRQWUDFWRUDVUHTXLUHGE\DSSOLFDEOH FROOHFWLYHEDUJDLQLQJDJUHHPHQWVFHUWLI\LQJWKDWDOOHPSOR\HHEHQHILWFRQWULEXWLRQVGXHDQG Western Allied Corporation Page 54 of 221 . . Item 10 Page 54 of 221 RZHGSXUVXDQWWRDQ\DSSOLFDEOHFROOHFWLYHEDUJDLQLQJDJUHHPHQWKDYHEHHQSDLGLQIXOO DQG &RPSOLDQFHE\&RQWUDFWRUZLWKDOORILWVRWKHUREOLJDWLRQVIRUVXEPLVVLRQRIGRFXPHQWDWLRQRU SHUIRUPDQFHRIFRQGLWLRQVZKLFKE\WKHWHUPVRIWKH&RQWUDFW'RFXPHQWVFRQVWLWXWHFRQGLWLRQV WR&RQWUDFWRU VULJKWWRUHFHLYHSD\PHQWIRU:RUNSHUIRUPHG % 3D\PHQWVE\&LW\ 3XUVXDQWWR&DOLIRUQLD3XEOLF&RQWUDFW&RGH6HFWLRQ&LW\VKDOOPDNHSURJUHVVSD\PHQWRI XQGLVSXWHGVXPVGXHZLWKLQWKLUW\ 'D\VDIWHUUHFHLSWE\'LUHFWRURIDQXQGLVSXWHGDQGSURSHUO\ VXEPLWWHG$SSOLFDWLRQIRU3D\PHQWFDOFXODWHGRQWKHEDVLVRIQLQHW\ILYHSHUFHQW RIYDOXH GHWHUPLQHGSXUVXDQWWR3DUDJUDSK%DERYHRIWKHIROORZLQJ 7KHSRUWLRQRIWKH:RUNSHUPDQHQWO\LQVWDOOHGDQGLQSODFH 3OXVWKHYDOXHRIPDWHULDOVGHOLYHUHGRQWKHJURXQGRULQVWRUDJHDVDSSURYHGE\&LW\SXUVXDQW WR3DUDJUDSK'DERYH /HVVWKHDJJUHJDWHRISUHYLRXVSD\PHQWVDQG /HVVDQ\RWKHUZLWKKROGLQJVDXWKRUL]HGE\WKH&RQWUDFW'RFXPHQWV & 5HMHFWLRQE\&LW\ $Q\$SSOLFDWLRQIRU3D\PHQWGHWHUPLQHGQRWWREHXQGLVSXWHGSURSHUDQGVXLWDEOHIRUSD\PHQWVKDOO EHUHWXUQHGWR&RQWUDFWRUDVVRRQDVSUDFWLFDEOHEXWQRWODWHUWKDQVHYHQ 'D\VDIWHUUHFHLSWE\ &LW\DFFRPSDQLHGE\DQZULWWHQH[SODQDWLRQRIWKHUHDVRQVZK\WKHSD\PHQWUHTXHVWZDVUHMHFWHG )DLOXUHE\&LW\RU'LUHFWRUWRHLWKHUWLPHO\UHMHFWDQ$SSOLFDWLRQIRU3D\PHQWRUVSHFLI\DQ\JURXQGV IRUUHMHFWLRQVKDOOQRWFRQVWLWXWHDZDLYHURIDQ\ULJKWVE\&LW\$SSOLFDWLRQVIRU3D\PHQWWKDWDUH UHMHFWHGVKDOOEHFRUUHFWHGDQGUHVXEPLWWHGZLWKLQVHYHQ 'D\VDIWHUUHFHLSWE\&RQWUDFWRU ' ,QWHUHVW ,I&LW\IDLOVWRPDNHDSURJUHVVSD\PHQWWR&RQWUDFWRUDVUHTXLUHGE\3DUDJUDSK%DERYH&LW\ VKDOOSD\LQWHUHVWWR&RQWUDFWRUHTXLYDOHQWWRWKHOHJDOUDWHVHWIRUWKLQVXEGLYLVLRQ D RI&DOLIRUQLD &RGHRI&LYLO3URFHGXUH6HFWLRQ7KHQXPEHURI'D\VDYDLODEOHWR&LW\WRPDNHSD\PHQW SXUVXDQWWR3DUDJUDSK%DERYHZLWKRXWLQFXUULQJLQWHUHVWSXUVXDQWWRWKLV3DUDJUDSKVKDOOEH UHGXFHGE\WKHQXPEHURI'D\VE\ZKLFK&LW\H[FHHGVWKHVHYHQ 'D\UHWXUQUHTXLUHPHQW DSSOLFDEOHWR&LW\DVVHWIRUWKLQ3DUDJUDSK&DERYH ),1$/3$<0(17 $ 5HWHQWLRQ OQDGGLWLRQWRZLWKKROGLQJVSHUPLWWHGE\3DUDJUDSK EHORZDVXPHTXDOWRILYHSHUFHQW RI DOOVXPVRWKHUZLVHGXHWR&RQWUDFWRUDVSURJUHVVSD\PHQWVVKDOOEHZLWKKHOGE\FLW\SXUVXDQWWR 3DUDJUDSK%IURPHDFKSURJUHVVSD\PHQW ³5HWHQWLRQ´ DQGUHWDLQHGXQWLOVXFKWLPHDVLWLVGXH DVGHVFULEHGKHUHLQ$KLJKHU5HWHQWLRQDPRXQWPD\EHDSSURYHGE\WKH&LW\&RXQFLOZKHUHSURMHFW LVGHHPHG³VXEVWDQWLDOO\FRPSOH[´E\&LW\&RXQFLO Western Allied Corporation Page 55 of 221 . . Item 10 Page 55 of 221 % &RQGLWLRQVWR)LQDO3D\PHQW &RQWUDFWRUVKDOOVXEPLWLWV$SSOLFDWLRQIRU)LQDO3D\PHQWXVLQJVXFKIRUPVDVUHTXLUHGE\'LUHFWRU SULRUWRUHTXHVWLQJDILQDOLQVSHFWLRQRIWKH:RUNLQDFFRUGDQFHZLWK3DUDJUDSKDERYH 6XFK $SSOLFDWLRQIRU)LQDO3D\PHQWVKDOOEHDFFRPSDQLHGE\DOOWKHIROORZLQJ $QDIILGDYLWWKDWSD\UROOVELOOVIRUPDWHULDOVDQGHTXLSPHQWDQGRWKHULQGHEWHGQHVVFRQQHFWHG ZLWKWKH3URMHFWIRUZKLFK&LW\RU&LW\ VSURSHUW\RUIXQGVPLJKWEHOLDEOHKDYHEHHQSDLGRU RWKHUZLVHVDWLVILHG &RQWUDFWRU¶VFHUWLILFDWLRQDVUHTXLUHGE\3DUDJUDSK&DERYH &RQVHQWRIVXUHW\LIDQ\WR)LQDO3D\PHQW $FHUWLILFDWHHYLGHQFLQJWKDWWKHLQVXUDQFHUHTXLUHGE\WKH&RQWUDFW'RFXPHQWVLVLQIRUFH &RQGLWLRQDO:DLYHUDQG5HOHDVH8SRQ)LQDO3D\PHQWLQWKHIRUPUHTXLUHGE\&DOLIRUQLD&LYLO &RGH6HFWLRQH[HFXWHGE\&RQWUDFWRUDOO6XEFRQWUDFWRUVRIHYHU\WLHUDQGE\DOOPDWHULDO VXSSOLHUVRIHDFKFRYHULQJWKHILQDOSD\PHQWSHULRG 8QFRQGLWLRQDO:DLYHUDQG5HOHDVH8SRQ3URJUHVV3D\PHQWLQWKHIRUPUHTXLUHGE\&DOLIRUQLD &LYLO&RGH6HFWLRQH[HFXWHGE\&RQWUDFWRUDOO6XEFRQWUDFWRUVRIHYHU\WLHUDQGE\DOO PDWHULDOVXSSOLHUVRIHDFKFRYHULQJWKHSUHYLRXVSD\PHQWSHULRG $OO5HFRUG'RFXPHQWV LQFOXGLQJZLWKRXWOLPLWDWLRQFRPSOHWHDQGDFFXUDWH$V%XLOWGUDZLQJV ZKLFKVKDOOEHNHSWXSWRGDWHGXULQJWKHSHUIRUPDQFHRIWKH:RUN 'RFXPHQWDWLRQWKDW&RQWUDFWRUKDVLQVSHFWHGWHVWHGDQGDGMXVWHGSHUIRUPDQFHLIHYHU\V\VWHP RUIDFLOLW\RIWKH:RUNWRHQVXUHWKDWRYHUDOOSHUIRUPDQFHLVLQFRPSOLDQFHZLWKWKHWHUPVRIWKH &RQWUDFW'RFXPHQWV )RXU FRSLHVRIDOOZDUUDQWLHVIURPYHQGRUVDQG6XEFRQWUDFWRUVRSHUDWLRQDQGPDLQWHQDQFH PDQXDOV LQVWUXFWLRQV DQG UHODWHG DJUHHPHQWV DQG HTXLSPHQW FHUWLILFDWLRQV DQG VLPLODU GRFXPHQWV &HUWLILFDWLRQV E\ &RQWUDFWRU DQG HDFK 6XEFRQWUDFWRU DV UHTXLUHG E\ DSSOLFDEOH FROOHFWLYH EDUJDLQLQJDJUHHPHQWVWKDWDOOHPSOR\HHEHQHILWFRQWULEXWLRQVGXHDQGRZLQJSXUVXDQWWRDQ\ DSSOLFDEOHFROOHFWLYHEDUJDLQLQJDJUHHPHQWKDYHEHHQSDLGLQIXOO 5HOHDVHVRIULJKWVDQGFODLPVUHODWLQJWRSDWHQWVDQGWUDGHPDUNVDVUHTXLUHGE\WKH&RQWUDFW 'RFXPHQWV DQG $Q\RWKHUGRFXPHQWVRULQIRUPDWLRQUHTXLUHGE\WKH&RQWUDFW'RFXPHQWVDVDFRQGLWLRQRI)LQDO 3D\PHQWRU)LQDO&RPSOHWLRQ & )LQDO3D\PHQW 3XUVXDQWWRWKH3XEOLF&RQWUDFW&RGH6HFWLRQZLWKLQVL[W\ 'D\VDIWHU&LW\LVVXHVWKH1RWLFH Western Allied Corporation Page 56 of 221 . . Item 10 Page 56 of 221 RI&RPSOHWLRQWR&RQWUDFWRUWKH)LQDO3D\PHQWLQFOXGLQJ5HWHQWLRQVKDOOEHUHOHDVHGWR&RQWUDFWRU VXEMHFWWRWKH&LW\¶VULJKWWRZLWKKROGRIDQ\GLVSXWHGDPRXQWV ' 'LVSXWHG$PRXQWV 3XUVXDQWWR&DOLIRUQLD3XEOLF&RQWUDFW&RGH&LW\PD\GHGXFWDQGZLWKKROGIURPWKH)LQDO 3D\PHQWGXHXQGHU3DUDJUDSK&DERYHDQDPRXQWXSWRRIDQ\GLVSXWHGDPRXQWV LQFOXGLQJZLWKRXWOLPLWDWLRQDPRXQWVWRSURWHFW&LW\DJDLQVWDQ\ORVVFDXVHGRUWKUHDWHQHGDVDUHVXOW RI&RQWUDFWRU VIDLOLQJWRIXOO\SHUIRUPDOORIWKRVHREOLJDWLRQVWKDWDUHUHTXLUHGWREHIXOILOOHGE\ &RQWUDFWRUDVDFRQGLWLRQWR)LQDO&RPSOHWLRQDQG)LQDO3D\PHQW$OWHUQDWLYHO\&LW\PD\HOHFWLQLWV VROHGLVFUHWLRQWRDFFHSWWKH:RUNZLWKRXWFRUUHFWLRQRUFRPSOHWLRQDQGDGMXVWWKH&RQWUDFW6XP SXUVXDQWWRWKH&RQWUDFW'RFXPHQWV ( $FFHSWDQFHRI)LQDO3D\PHQW $FFHSWDQFHRI)LQDO3D\PHQWE\&RQWUDFWRUVKDOOFRQVWLWXWHDZDLYHURIDOOULJKWVE\&RQWUDFWRU DJDLQVW&LW\IRUUHFRYHU\RIDQ\ORVVH[FHSWLQJRQO\WKRVH&ODLPVWKDWKDYHEHHQVXEPLWWHGE\ &RQWUDFWRULQWKHPDQQHUUHTXLUHGE\WKH&RQWUDFW'RFXPHQWVSULRUWRRUDWWKHWLPHRIWKH)LQDO 3D\PHQW 0,6&(//$1(286 $ -RLQW3D\PHQW &LW\VKDOOKDYHWKHULJKWLIGHHPHGQHFHVVDU\LQLWVVROHGLVFUHWLRQWRLVVXHMRLQWFKHFNVPDGH SD\DEOHWR&RQWUDFWRUDQGDQ\6XEFRQWUDFWRU V RIDQ\7LHU7KHMRLQWFKHFNSD\HHVVKDOOEHVROHO\ UHVSRQVLEOHIRUWKHDOORFDWLRQDQGGLVEXUVHPHQWRIIXQGVLQFOXGHGDVSDUWRIDQ\VXFKMRLQWSD\PHQW (QGRUVHPHQWRQVXFKFKHFNE\DSD\HHVKDOOEHFRQFOXVLYHO\SUHVXPHGWRFRQVWLWXWHUHFHLSWRI SD\PHQWE\VXFKSD\HH ,QQRHYHQWVKDOODQ\MRLQWFKHFNSD\PHQWEHFRQVWUXHGWRFUHDWHDQ\ FRQWUDFWEHWZHHQ&LW\DQGD6XEFRQWUDFWRURIDQ\7LHUDQ\REOLJDWLRQIURP&LW\WRVXFK6XEFRQWUDFWRU RUDQ\WKLUGSDUW\ULJKWVDJDLQVW&LW\RU'LUHFWRU % :LWKKROGLQJ'XW\WR3URFHHG 7KHSD\PHQWZLWKKROGLQJRUUHWHQWLRQRIDOORUDQ\SRUWLRQRIDQ\SD\PHQWFODLPHGWREHGXHDQG RZLQJWR&RQWUDFWRUVKDOOQRWRSHUDWHLQDQ\ZD\WRUHOLHYH&RQWUDFWRUIURPLWVREOLJDWLRQVXQGHUWKH &RQWUDFW'RFXPHQWV&RQWUDFWRUVKDOOFRQWLQXHGLOLJHQWO\WRSURVHFXWHWKH:RUNZLWKRXWUHIHUHQFHWR WKHSD\PHQWZLWKKROGLQJRUUHWHQWLRQRIDQ\SD\PHQW7KHSDUWLDOSD\PHQWZLWKKROGLQJRUUHWHQWLRQ E\&LW\LQJRRGIDLWKRIDQ\GLVSXWHGSRUWLRQRIDSD\PHQWZKHWKHUXOWLPDWHO\GHWHUPLQHGWREH FRUUHFWO\RULQFRUUHFWO\DVVHUWHGVKDOOQRWFRQVWLWXWHDEUHDFKE\&LW\RIWKH&RQVWUXFWLRQ&RQWUDFW DQGVKDOOQRWEHJURXQGVIRUDQDGMXVWPHQWRIWKH&RQWUDFW6XPRU&RQWUDFW7LPH & 1R$FFHSWDQFH 1RSD\PHQWE\&LW\RUSDUWLDORUHQWLUHXVHRIWKH:RUNE\&LW\VKDOOEHFRQVWUXHGDVDSSURYDORU DFFHSWDQFHRIWKH:RUNRUDQ\SRUWLRQWKHUHRI ' &RQWUDFWRU3D\PHQW:DUUDQW\ 6XEPLVVLRQ RI DQ $SSOLFDWLRQ IRU 3D\PHQW VKDOO FRQVWLWXWH D UHSUHVHQWDWLRQ DQG ZDUUDQW\ E\ &RQWUDFWRUWKDW Western Allied Corporation Page 57 of 221 . . Item 10 Page 57 of 221 7LWOHWR:RUNFRYHUHGE\DQ$SSOLFDWLRQIRU3D\PHQWZLOOSDVVWR&LW\HLWKHUE\LQFRUSRUDWLRQLQWR WKHFRQVWUXFWLRQRUXSRQUHFHLSWRISD\PHQWE\&RQWUDFWRUZKLFKHYHURFFXUVILUVW DQG :RUNFRYHUHGE\SUHYLRXV$SSOLFDWLRQVIRU3D\PHQWDUHIUHHDQGFOHDURIOLHQVVWRSQRWLFHV FODLPVVHFXULW\LQWHUHVWVRUHQFXPEUDQFHVLPSRVHGE\WKH&RQWUDFWRURUDQ\RWKHUSHUVRQ ( &RUUHFWLRQV 1RLQDFFXUDF\RUHUURULQDQ\$SSOLFDWLRQIRU3D\PHQWSURYLGHGE\&RQWUDFWRUVKDOORSHUDWHWRUHOHDVH &RQWUDFWRUIURPWKHHUURURUIURPORVVHVDULVLQJIURPWKH:RUNRUIURPDQ\REOLJDWLRQLPSRVHGE\ WKH&RQWUDFW'RFXPHQWV&LW\UHWDLQVWKHULJKWWRVXEVHTXHQWO\FRUUHFWDQ\HUURUPDGHLQDQ\ SUHYLRXVO\ DSSURYHG $SSOLFDWLRQ IRU 3D\PHQW RU SURJUHVV SD\PHQW LVVXHG E\ DGMXVWPHQWV WR VXEVHTXHQWSD\PHQWV 3$<0(176%<&2175$&725 &RQWUDFWRUVKDOOQRWLQFOXGHLQLWV$SSOLFDWLRQVIRU3D\PHQWVXPVRQDFFRXQWRIDQ\6XEFRQWUDFWRU VSRUWLRQRI WKH:RUNWKDWLWGRHVQRWLQWHQGWRSD\WRVXFK6XEFRQWUDFWRU8SRQUHFHLSWRISD\PHQWIURP&LW\&RQWUDFWRU VKDOOSD\WKH6XEFRQWUDFWRUSHUIRUPLQJ:RUNRQWKH3URMHFWRXWRIWKHDPRXQWSDLGWR&RQWUDFWRURQDFFRXQW RIVXFK6XEFRQWUDFWRU VSRUWLRQRIWKH:RUNWKHDPRXQWWRZKLFKVDLG6XEFRQWUDFWRULVHQWLWOHGLQDFFRUGDQFH ZLWKWKHWHUPVRILWVFRQWUDFWZLWK&RQWUDFWRUDQGDSSOLFDEOHODZVLQFOXGLQJZLWKRXWOLPLWDWLRQ&DOLIRUQLD3XEOLF &RQWUDFW&RGH6HFWLRQ &RQWUDFWRUVKDOOUHPDLQUHVSRQVLEOHQRWZLWKVWDQGLQJDZLWKKROGLQJE\&LW\ SXUVXDQWWRWKHWHUPVRIWKHVH&RQWUDFW'RFXPHQWVWRSURPSWO\VDWLVI\IURPLWVRZQIXQGVVXPVGXHWRDOO 6XEFRQWUDFWRUVZKRKDYHSHUIRUPHG:RUNWKDWLVLQFOXGHGLQ&RQWUDFWRU V$SSOLFDWLRQIRU3D\PHQW&RQWUDFWRU VKDOOE\DSSURSULDWHDJUHHPHQWUHTXLUHHDFK6XEFRQWUDFWRUWRPDNHSD\PHQWVWRLWVVXEFRQWUDFWRUVDQG PDWHULDOVXSSOLHUVLQVLPLODUPDQQHU &LW\VKDOOKDYHQRREOLJDWLRQWRSD\RUEHUHVSRQVLEOHLQDQ\ZD\IRU SD\PHQWWRD6XEFRQWUDFWRURIDQ\WLHURUPDWHULDOVXSSOLHU 3$<0(176:,7++(/' $ :LWKKROGLQJE\&LW\ ,QDGGLWLRQWR DQ\ RWKHU DPRXQWVZKLFK&LW\PD\ KDYH WKHULJKWWRUHWDLQXQGHUWKH&RQWUDFW 'RFXPHQWV&LW\PD\ZLWKKROGDVXIILFLHQWDPRXQWRIDQ\SD\PHQWRWKHUZLVHGXHWR&RQWUDFWRUDV &LW\LQLWVVROHGLVFUHWLRQPD\GHHPQHFHVVDU\WRFRYHUDFWXDORUWKUHDWHQHGORVVGXHWRDQ\RIWKH IROORZLQJ 7KLUG3DUW\&ODLPV 7KLUGSDUW\FODLPVRUVWRSQRWLFHVILOHGRUUHDVRQDEOHHYLGHQFHLQGLFDWLQJ SUREDEOHILOLQJRIVXFKFODLPVRUVWRSQRWLFHV&LW\VKDOOSURPSWO\LQIRUP&RQWUDFWRURIDQ\WKLUG SDUW\FODLPVUHODWHGWRWKLV&RQWUDFW 'HIHFWLYH:RUN'HIHFWLYH:RUNQRWUHPHGLHG 1RQSD\PHQW)DLOXUHRI&RQWUDFWRUWRPDNHSURSHUSD\PHQWVWRLWV6XEFRQWUDFWRUVIRUVHUYLFHV ODERUPDWHULDOVRUHTXLSPHQW ,QDELOLW\WR&RPSOHWH 5HDVRQDEOHGRXEWWKDWWKH:RUNFDQEHFRPSOHWHGIRUWKHWKHQXQSDLG EDODQFHRIWKH&RQWUDFW6XPRUZLWKLQWKH&RQWUDFW7LPH Western Allied Corporation Page 58 of 221 . . Item 10 Page 58 of 221 9LRODWLRQ RI $SSOLFDEOH /DZV )DLOXUH RI &RQWUDFWRU RU LWV 6XEFRQWUDFWRUV WR FRPSO\ ZLWK DSSOLFDEOHODZVRUODZIXORUGHUVRIJRYHUQPHQWDODXWKRULWLHV 3HQDOW\ $Q\FODLPRUSHQDOW\DVVHUWHGDJDLQVW&LW\E\YLUWXHRI&RQWUDFWRU¶VIDLOXUHWRFRPSO\ ZLWKDSSOLFDEOHODZVRUODZIXORUGHUVRIJRYHUQPHQWDODXWKRULWLHV LQFOXGLQJZLWKRXWOLPLWDWLRQ ODERUODZV )DLOXUHWR0HHW&RQWUDFW7LPH$Q\GDPDJHVZKLFKPD\DFFUXHDVDUHVXOWRI&RQWUDFWRUIDLOLQJ WRPHHWWKH&RQVWUXFWLRQ6FKHGXOHRUIDLOLQJWRSHUIRUPZLWKLQWKH&RQWUDFW7LPH 6HWRII$Q\UHDVRQVSHFLILHGHOVHZKHUHLQWKH&RQWUDFW'RFXPHQWVDVJURXQGVIRUDZLWKKROGLQJ RIIVHWRUVHWRIIRUWKDWZRXOGOHJDOO\HQWLWOH&LW\WRDVHWRIIRUUHFRXSPHQW &RQVXOWDQW6HUYLFHV $GGLWLRQDOSURIHVVLRQDOFRQVXOWDQWRULQVSHFWLRQVHUYLFHVUHTXLUHGGXHWR &RQWUDFWRU¶VIDLOXUHWRFRPSO\ZLWKWKH&RQWUDFW'RFXPHQWV /LTXLGDWHG'DPDJHV/LTXLGDWHGGDPDJHVDVVHVVHGDJDLQVW&RQWUDFWRU 0DWHULDOV0DWHULDOVRUGHUHGE\&LW\SXUVXDQWWRWKH&RQWUDFW'RFXPHQWV 'DPDJHV /RVVFDXVHGE\&RQWUDFWRURU6XEFRQWUDFWRUWR&LW\6HSDUDWH&RQWUDFWRUVRUDQ\ RWKHUSHUVRQRUHQWLW\XQGHUFRQWUDFWWR&LW\ &OHDQ8S &OHDQXSSHUIRUPHGE\&LW\DQGFKDUJHDEOHWR&RQWUDFWRUSXUVXDQWWRWKH&RQWUDFW 'RFXPHQWV (PSOR\HH%HQHILWV )DLOXUHRI&RQWUDFWRUWRSD\FRQWULEXWLRQVGXHDQGRZLQJWRHPSOR\HH EHQHILWVIXQGVSXUVXDQWWRDQ\DSSOLFDEOHFROOHFWLYHEDUJDLQLQJDJUHHPHQWRUWUXVWDJUHHPHQW 5HTXLUHG'RFXPHQWV )DLOXUHRI&RQWUDFWRUWRVXEPLWRQDWLPHO\EDVLVSURSHUDQGVXIILFLHQW GRFXPHQWDWLRQUHTXLUHGE\WKH&RQWUDFW'RFXPHQWVLQFOXGLQJZLWKRXWOLPLWDWLRQ&RQVWUXFWLRQ 6FKHGXOHXSGDWHVµORRNDKHDG¶VFKHGXOHV6XEPLWWDOV6FKHGXOHVRI9DOXHVLQIRUPDWLRQRQ 6XEFRQWUDFWRUV&KDQJH2UGHUVFHUWLILFDWLRQVDQGRWKHUUHTXLUHGUHSRUWVRUGRFXPHQWDWLRQ DQG 2WKHU%UHDFK $EUHDFKRIDQ\REOLJDWLRQRUSURYLVLRQRIWKH&RQWUDFW'RFXPHQWV % 5HOHDVHRI:LWKKROGLQJ ,IDQGZKHQ&LW\GHWHUPLQHVLQLWVVROHGLVFUHWLRQWKDWWKHDERYHJURXQGVIRUZLWKKROGLQJKDYHEHHQ UHPRYHGDQGWKDWDOOORVVHVLQFXUUHGRUWKUHDWHQHGKDYHEHHQSDLGFUHGLWHGRURWKHUZLVHVDWLVILHGWKHQ SD\PHQWVKDOOEHPDGHIRUDPRXQWVZLWKKHOGEHFDXVHRIWKHP & $SSOLFDWLRQRI:LWKKROGLQJ &LW\PD\DSSO\VXPVZLWKKHOGSXUVXDQWWR3DUDJUDSK$DERYHLQSD\PHQWRIDQ\ORVVRU WKUHDWHQHGORVVDV&LW\GHWHUPLQHVLQLWVVROHGLVFUHWLRQWREHDSSURSULDWH 6XFKSD\PHQWVPD\EH PDGHZLWKRXWDSULRUMXGLFLDOGHWHUPLQDWLRQRI&LW\¶VDFWXDOULJKWVZLWKUHVSHFWWRVXFKORVV&RQWUDFWRU DJUHHVDQGKHUHE\GHVLJQDWHV&LW\DVLWVDJHQWIRUVXFKSXUSRVHVDQGDJUHHVWKDWVXFKSD\PHQWV VKDOOEHFRQVLGHUHGDVSD\PHQWVPDGHXQGHU&RQVWUXFWLRQ&RQWUDFWE\&LW\WR&RQWUDFWRU&LW\VKDOO QRWEHOLDEOHWR&RQWUDFWRUIRUVXFKSD\PHQWVPDGHLQJRRGIDLWK &LW\VKDOOVXEPLWWR&RQWUDFWRUDQ DFFRXQWLQJRIVXFKIXQGVGLVEXUVHGRQEHKDOIRI&RQWUDFWRU$VDQDOWHUQDWLYHWRVXFKSD\PHQW&LW\ Western Allied Corporation Page 59 of 221 . . Item 10 Page 59 of 221 PD\LQLWVVROHGLVFUHWLRQHOHFWWRH[HUFLVHLWVULJKWWRDGMXVWWKH&RQWUDFW6XPDVSURYLGHGLQWKH &RQWUDFW'RFXPHQWV ' &RQWLQXRXV3HUIRUPDQFH 3URYLGHG&LW\SD\VWKHXQGLVSXWHGSRUWLRQLIDQ\RIIXQGVZLWKKHOGLQJRRGIDLWK&RQWUDFWRUVKDOO PDLQWDLQFRQWLQXRXVDQGXQLQWHUUXSWHGSHUIRUPDQFHRIWKH:RUNGXULQJWKHSHQGHQF\RIDQ\GLVSXWHV RUGLVDJUHHPHQWVZLWK&LW\ 68%67,787,212)6(&85,7,(6 $ 3XEOLF&RQWUDFW&RGH 3XUVXDQWWRWKHUHTXLUHPHQWVRI&DOLIRUQLD3XEOLF&RQWUDFW&RGH6HFWLRQXSRQ&RQWUDFWRU¶V UHTXHVW&LW\ZLOOPDNHSD\PHQWWR&RQWUDFWRURIDQ\IXQGVZLWKKHOGIURPSD\PHQWVWRHQVXUH SHUIRUPDQFHXQGHUWKH&RQWUDFW'RFXPHQWVLI&RQWUDFWRUGHSRVLWVZLWK&LW\RULQHVFURZZLWKD &DOLIRUQLDRUIHGHUDOO\FKDUWHUHGEDQNLQ&DOLIRUQLDDFFHSWDEOHWR&LW\ ³(VFURZ$JHQW´ VHFXULWLHV HOLJLEOHIRUWKHLQYHVWPHQWRI6WDWH)XQGVXQGHU*RYHUQPHQW&RGH6HFWLRQRUEDQNRUVDYLQJV DQGORDQFHUWLILFDWHVRIGHSRVLWLQWHUHVWEHDULQJGHPDQGGHSRVLWDFFRXQWVVWDQGE\OHWWHUVRIFUHGLWRU DQ\RWKHUVHFXULW\PXWXDOO\DJUHHGWRE\WKH&RQWUDFWRUDQGWKH&LW\XSRQWKHIROORZLQJFRQGLWLRQV &RQWUDFWRUVKDOOEHWKHEHQHILFLDORZQHURUDQ\VHFXULWLHVVXEVWLWXWHGIRUPRQLHVZLWKKHOGIRUWKH SXUSRVHRIUHFHLYLQJDQ\LQWHUHVWWKHUHRQ $OOH[SHQVHVUHODWLQJWRWKHVXEVWLWXWLRQRIVHFXULWLHVXQGHU3XEOLF&RQWUDFW&RGH6HFWLRQ DQGXQGHUWKLV3DUDJUDSKLQFOXGLQJEXWQRWOLPLWHGWR&LW\¶VRYHUKHDGDQGDGPLQLVWUDWLYH H[SHQVHVDQGH[SHQVHVRI(VFURZ$JHQWVKDOOEHWKHUHVSRQVLELOLW\RI&RQWUDFWRU 6HFXULWLHVRUFHUWLILFDWHVRIGHSRVLWVXEVWLWXWHGIRUPRQLHVZLWKKHOGVKDOOEHRIDYDOXHRIDWOHDVW HTXLYDOHQW WR WKH DPRXQWV RI UHWHQWLRQ WR EH SDLG WR &RQWUDFWRU SXUVXDQW WR WKH &RQWUDFW 'RFXPHQWV ,I&RQWUDFWRUFKRRVHVWRGHSRVLWVHFXULWLHVLQOLHXRIPRQLHVZLWKKHOGZLWKDQ(VFURZ$JHQW &RQWUDFWRU&LW\DQG(VFURZ$JHQWVKDOODVDSUHUHTXLVLWHWRVXFKGHSRVLWHQWHULQWRDQHVFURZ DJUHHPHQWXVLQJWKH&LW\¶VIRUP³(VFURZ$JUHHPHQWIRU'HSRVLWRI6HFXULWLHVLQ/LHXRI 5HWHQWLRQ´ &RQWDFWRUVKDOOREWDLQWKHZULWWHQFRQVHQWRI6XUHW\WRVXFKDJUHHPHQW 6HFXULWLHVLIDQ\VKDOOEHUHWXUQHGWR&RQWUDFWRURQO\XSRQVDWLVIDFWRU\)LQDO&RPSOHWLRQRIWKH :RUN % 6XEVWLWXWH6HFXULW\ 7RPLQLPL]HWKHH[SHQVHFDXVHGE\VXFKVXEVWLWXWLRQRIVHFXULWLHV&RQWUDFWRUVKDOOSULRUWRRUDWWKH WLPH&RQWUDFWRUUHTXHVWVWRVXEVWLWXWHVHFXULW\GHSRVLWVXIILFLHQWVHFXULW\WRFRYHUWKHHQWLUHDPRXQWWR EHZLWKKHOG 6KRXOGWKHFXUUHQWPDUNHWYDOXHRIVXFKVXEVWLWXWHGVHFXULW\IDOOEHORZWKHDPRXQWIRU ZKLFKLWZDVVXEVWLWXWHGRUDQ\RWKHUDPRXQWVZKLFKWKH&LW\ZLWKKROGVSXUVXDQWWRWKH&RQWUDFW 'RFXPHQWV&RQWUDFWRUVKDOOLPPHGLDWHO\DQGDW&RQWUDFWRU¶VH[SHQVHDQGDWQRFRVWWR&LW\GHSRVLW DGGLWLRQDOVHFXULW\TXDOLI\LQJXQGHU3XEOLF&RQWUDFW&RGH6HFWLRQXQWLOWKHFXUUHQWPDUNHWYDOXH RIWKHWRWDOVHFXULW\GHSRVLWHGLVQROHVVWKDQWKHDPRXQWVXEMHFWWRZLWKKROGLQJXQGHUWKH&RQWUDFW Western Allied Corporation Page 60 of 221 . . Item 10 Page 60 of 221 'RFXPHQWV6HFXULWLHVVKDOOEHYDOXHGDVRIWHQDVFRQGLWLRQVRIWKHVHFXULWLHVPDUNHWZDUUDQWEXWLQ QRFDVHOHVVIUHTXHQWO\WKDQRQFHSHUPRQWK & 'HSRVLWRI5HWHQWLRQV $OWHUQDWLYHO\ VXEMHFW WR WKH FRQGLWLRQV VHW IRUWK LQ 3DUDJUDSK $ DERYH XSRQ UHTXHVW RI &RQWUDFWRU&LW\VKDOOPDNHSD\PHQWRIUHWHQWLRQVGLUHFWO\WR(VFURZ$JHQWDWWKHH[SHQVHRI &RQWUDFWRUSURYLGHGWKDW&RQWUDFWRU&LW\DQG(VFURZ$JHQWVKDOODVDSUHUHTXLVLWHVXFKSD\PHQW HQWHULQWRDQHVFURZDJUHHPHQWLQWKHVDPHIRUPDVSUHVFULEHGLQ3DUWRI3DUDJUDSK$DERYH $W WKHH[SHQVHRI&RQWUDFWRUDQGDWQRFRVWWR&LW\&RQWUDFWRUPD\GLUHFWWKHLQYHVWPHQWRIWKH SD\PHQWVLQWRVHFXULWLHVDQGLQWHUHVWEHDULQJDFFRXQWVDQG&RQWUDFWRUVKDOOUHFHLYHWKHLQWHUHVW HDUQHGRQWKHLQYHVWPHQWV (VFURZ$JHQWVKDOOKROGVXFKGLUHFWSD\PHQWVE\&LW\XQGHUWKHVDPH WHUPVSURYLGHGKHUHLQIRUVHFXULWLHVGHSRVLWHGE\&RQWUDFWRU 8SRQVDWLVIDFWRU\)LQDO&RPSOHWLRQRI WKH:RUN&RQWUDFWRUVKDOOUHFHLYHIURP(VFURZ$JHQWDOOVHFXULWLHVLQWHUHVWDQGSD\PHQWVUHFHLYHG E\(VFURZ$JHQWIURP&LW\OHVVHVFURZIHHVDQGFKDUJHVRIWKH(VFURZ$FFRXQWDFFRUGLQJWRWKH WHUPVRI3XEOLF&RQWUDFW&RGH6HFWLRQDQGWKH&RQWUDFW'RFXPHQWV ' 7LPHIRU(OHFWLRQRI6XEVWLWXWLRQRI6HFXULWLHV 1RWZLWKVWDQGLQJWKHSURYLVLRQRI$%DQG&DERYHDQG&DOLIRUQLD3XEOLF&RQWUDFW&RGH6HFWLRQ WKHIDLOXUHRI&RQWUDFWRUWRUHTXHVWWKH6XEVWLWXWLRQRIHOLJLEOHVHFXULWLHVIRUPRQLHVWREHZLWKKHOG E\&LW\ZLWKLQWHQ GD\VRIWKHDZDUGRI&RQWUDFWWR&RQWUDFWRUVKDOOEHGHHPHGWREHDZDLYHURI DOOVXFKULJKWV &/$,06 $ $ULVLQJRI&ODLP 6FRSH&KDQJH :KHQ&RQWUDFWRUKDVDFODLPIRUDQLQFUHDVHLQWKH&RQWUDFW6XPRU&RQWUDFW 7LPHGXHWRDVFRSHFKDQJHZKLFKKDVQRW\HWEHFRPHILQDOD³FODLP´ZLOOEHGHHPHGWRDULVH RQFHWKH'LUHFWRUKDVLVVXHGDGHFLVLRQGHQ\LQJLQZKROHRULQSDUWWKH&RQWUDFWRU¶V&KDQJH 2UGHU5HTXHVW 2WKHU&ODLPV ,QWKHFDVHRID&ODLPE\&RQWUDFWRUWKDWGRHVQRWLQYROYHDQDGMXVWPHQWWRWKH &RQWUDFW6XPRU&RQWUDFW7LPHGXHWRDVFRSHFKDQJHDQGZKLFKKDVQRWEHFRPHILQDOWKH &ODLPPD\EHDVVHUWHGLIDQGRQO\LI&RQWUDFWRUJLYHVZULWWHQQRWLFHWR&LW\RILQWHQWWRILOHWKH &ODLPZLWKLQWKUHH GD\VRIWKHGDWHRIGLVFRYHU\UHODWLYHWRVXFKFLUFXPVWDQFHV HYHQLI &RQWUDFWRUKDVQRW\HWEHHQGDPDJHGRUGHOD\HG 6XFKZULWWHQQRWLFHRILQWHQWWRILOHD&ODLP VKDOOEHYDOLGLIDQGRQO\LILWLGHQWLILHVWKHHYHQWRUFRQGLWLRQJLYLQJULVHWRWKH&ODLPVWDWHVLWV SUREDEOHHIIHFWLIDQ\ZLWKUHVSHFWWR&RQWUDFWRU VHQWLWOHPHQWWRDQDGMXVWPHQWRIWKH&RQWUDFW 6XPRU&RQWUDFW7LPHDQGFRPSOLHVZLWKWKHUHTXLUHPHQWVRI3DUDJUDSK%EHORZ )RU SXUSRVHVRIWKLV3DUDJUDSKD&ODLPIRUZKLFKVXFKZULWWHQQRWLFHLVUHTXLUHGDQGKDVEHHQ JLYHQE\&RQWUDFWRUVKDOOEHGHHPHGWRDULVHRQWKHGDWHWKDWVXFKZULWWHQQRWLFHLVUHFHLYHGE\ &LW\ % &RQWHQWRI&ODLP $&ODLPE\&RQWUDFWRUPXVWLQFOXGHDOORIWKHIROORZLQJ $VWDWHPHQWWKDWLWLVD&ODLPDQGDUHTXHVWIRUDGHFLVLRQRQWKH&ODLP Western Allied Corporation Page 61 of 221 . . Item 10 Page 61 of 221 $ GHWDLOHG GHVFULSWLRQ RI WKHDFW HUURU RPLVVLRQ XQIRUHVHHQ FRQGLWLRQ HYHQW RU RWKHU FLUFXPVWDQFHJLYLQJULVHWRWKH&ODLP ,IWKH&ODLPLQYROYHVDQDGMXVWPHQWWRWKH&RQWUDFW6XPRU&RQWUDFW7LPHGXHWRDFKDQJHLQ VFRSHDVWDWHPHQWGHPRQVWUDWLQJWKDWDOOUHTXLVLWHQRWLFHVZHUHSURYLGHGLQFOXGLQJZLWKRXW OLPLWDWLRQWLPHO\ZULWWHQQRWLFHDQGD&KDQJH2UGHU5HTXHVWDVUHTXLUHGE\$UWLFOHRIWKHVH *HQHUDO&RQGLWLRQVDQGWLPHO\QRWLFHRIGHOD\DQGUHTXHVWIRUH[WHQVLRQRIWLPHLQDFFRUGDQFH ZLWK$UWLFOH,IWKH&ODLPGRHVQRWLQYROYHDQDGMXVWPHQWWRWKH&RQWUDFW6XPRU&RQWUDFW7LPH GXHWRDFKDQJHLQVFRSHDVWDWHPHQWGHPRQVWUDWLQJWKDWDQRWLFHRILQWHQWWRILOHWKH&ODLPZDV WLPHO\VXEPLWWHGDVUHTXLUHGE\3DUDJUDSK$DERYH $GHWDLOHGMXVWLILFDWLRQIRUDQ\UHPHG\RUUHOLHIVRXJKWE\WKH&ODLPLQFOXGLQJZLWKRXWOLPLWDWLRQ DGHWDLOHGFRVWEUHDNGRZQLQWKHIRUPUHTXLUHGIRUVXEPLWWDORI&KDQJH2UGHU5HTXHVWVDQG DFWXDOMREFRVWUHFRUGVGHPRQVWUDWLQJWKDWWKHFRVWVKDYHEHHQLQFXUUHG ,IWKH&ODLPLQYROYHVDUHTXHVWIRUDGMXVWPHQWRIWKH&RQWUDFW7LPHZULWWHQGRFXPHQWDWLRQ GHPRQVWUDWLQJWKDW&RQWUDFWRUKDVFRPSOLHGZLWKWKHUHTXLUHPHQWVRIWKH&RQWUDFW'RFXPHQWV DQGZULWWHQVXEVWDQWLDWLRQ LQFOXGLQJZLWKRXWOLPLWDWLRQD7LPH,PSDFW$QDO\VLV GHPRQVWUDWLQJ WKDW&RQWUDFWRULVHQWLWOHGWRDQH[WHQVLRQRIWLPHXQGHUWKH&RQWUDFW'RFXPHQWV DQG $ZULWWHQFHUWLILFDWLRQVLJQHGE\DPDQDJLQJRIILFHURI&RQWUDFWRU VRUJDQL]DWLRQZKRKDVWKH DXWKRULW\WRVLJQFRQWUDFWVDQGSXUFKDVHRUGHUVRQEHKDOIRI&RQWUDFWRUDQGZKRKDVSHUVRQDOO\ LQYHVWLJDWHGDQGFRQILUPHGWKHWUXWKDQGDFFXUDF\RIWKHPDWWHUVVHWIRUWKLQVXFKFHUWLILFDWLRQ LQWKH IROORZLQJIRUP ,KHUHE\FHUWLI\XQGHUSHQDOW\RISHUMXU\WKDW,DPDPDQDJLQJRIILFHURI &RQWUDFWRU VQDPH DQG WKDW,KDYHUHYLHZHGWKH&ODLPSUHVHQWHGKHUHZLWKRQ&RQWUDFWRU VEHKDOIDQGRURQEHKDOIRI 6XEFRQWUDFWRU VQDPH DQGWKDWWRWKHEHVWRIP\NQRZOHGJHDIWHUFRQGXFWLQJDGLOLJHQWLQTXLU\ LQWRWKHIDFWVRIWKH&ODLPWKHIROORZLQJVWDWHPHQWVDUHWUXHDQGFRUUHFW 7KHIDFWVDOOHJHGLQRUWKDWIRUPWKHEDVLVIRUWKH&ODLPDUHWRWKHEHVWRIP\NQRZOHGJH IROORZLQJGLOLJHQWLQTXLU\WUXHDQGDFFXUDWH DQG D ,GRQRWNQRZRIDQ\IDFWVRUFLUFXPVWDQFHVQRWDOOHJHGLQWKH&ODLP, WKDWE\ UHDVRQRIWKHLUQRWEHLQJDOOHJHGUHQGHUDQ\IDFWRUVWDWHPHQWDOOHJHGLQWKH&ODLP PDWHULDOO\PLVOHDGLQJ DQG E ,KDYHZLWKUHVSHFWWRDQ\UHTXHVWIRUPRQH\RUGDPDJHVDOOHJHGLQRUWKDWIRUPV WKHEDVLVIRUWKH&ODLPUHYLHZHGWKHMREFRVWUHFRUGV LQFOXGLQJWKRVHPDLQWDLQHG E\&RQWUDFWRUDQGE\DQ\6XEFRQWUDFWRURIDQ\WLHUWKDWLVDVVHUWLQJDOORUDQ\ SRUWLRQRIWKH&ODLP DQGFRQILUPHGZLWKUHDVRQDEOHFHUWDLQW\WKDWWKHORVVHVRU GDPDJHVVXIIHUHGE\&RQWUDFWRUDQGRUVXFK6XEFRQWUDFWRUZHUHLQIDFWVXIIHUHG LQWKHDPRXQWVDQGIRUWKHUHDVRQVDOOHJHGLQWKH&ODLP DQG F ,KDYHZLWKUHVSHFWWRDQ\UHTXHVWIRUH[WHQVLRQRIWLPHRU FODLP RI GHOD\ GLVUXSWLRQKLQGUDQFHRULQWHUIHUHQFHDOOHJHGLQRUWKDWIRUPVWKHEDVLVIRUWKH &ODLPUHYLHZHGWKHMREVFKHGXOHV LQFOXGLQJWKRVHPDLQWDLQHGE\&RQWUDFWRUDQG WKH6XEFRQWUDFWRURIDQ\WLHUWKDWLVDVVHUWLQJDOORUDQ\SRUWLRQRIWKH&ODLP DQG FRQILUPHGRQDQHYHQWE\HYHQWEDVLVWKDWWKHGHOD\VRUGLVUXSWLRQVXIIHUHGE\ &RQWUDFWRUDQGRUVXFK6XEFRQWUDFWRUZHUHLQIDFWH[SHULHQFHGIRUWKHGXUDWLRQV LQWKHPDQQHUDQGZLWKWKHFRQVHTXHQWHIIHFWVRQWKHWLPHDQGRUVHTXHQFHRI Western Allied Corporation Page 62 of 221 . . Item 10 Page 62 of 221 SHUIRUPDQFHRIWKH:RUNDVDOOHJHGLQWKH&ODLP DQG G ,KDYHQRWUHFHLYHGSD\PHQWIURP&LW\IRUQRUKDV&RQWUDFWRUSUHYLRXVO\UHOHDVHG &LW\IURPDQ\SRUWLRQRIWKH&ODLP´ & 1RQFRPSOLDQFH )DLOXUHWRVXEPLWDQ\RIWKHLQIRUPDWLRQGRFXPHQWDWLRQRUFHUWLILFDWLRQVUHTXLUHGE\3DUDJUDSK %DERYHVKDOOUHVXOWLQWKH&ODLPEHLQJUHWXUQHGWR&RQWUDFWRUZLWKRXWDQ\GHFLVLRQ ' 6XEPLVVLRQRI&ODLPV 'LUHFWRU &ODLPVVKDOOEHILUVWVXEPLWWHGWRWKH&LW\IRUGHFLVLRQE\WKH'LUHFWRU &RQWLQXRXV:RUN 1RWZLWKVWDQGLQJWKHPDNLQJRIDQ\&ODLPRUWKHH[LVWHQFHRIDQ\GLVSXWH UHJDUGLQJDQ\&ODLPXQOHVVRWKHUZLVHGLUHFWHGE\&LW\&RQWUDFWRUVKDOOQRWGHOD\VORZRUVWRS SHUIRUPDQFHRIWKH:RUNEXWVKDOOGLOLJHQWO\SURFHHGZLWKSHUIRUPDQFHLQDFFRUGDQFHZLWKWKH &RQWUDFW'RFXPHQWVDQG&LW\ZLOOFRQWLQXHWRPDNHXQGLVSXWHGSD\PHQWVDVE\WKH&RQWUDFW 'RFXPHQWV 7LPHIRU)LOLQJ $OO&ODLPVDQGVXSSRUWLQJGRFXPHQWDWLRQDQGFHUWLILFDWLRQVPXVWEHILOHGZLWKLQ WKLUW\ GD\VDIWHUWKH&ODLPDULVHV1R&ODLPVVKDOOEHILOHGDIWHU)LQDO3D\PHQW &RQGLWLRQV3UHFHGHQW 1R&ODLPPD\EHDVVHUWHGXQOHVV&RQWUDFWRUKDVVWULFWO\FRPSOLHGZLWK WKHUHTXLUHPHQWVRIWKLV3DUDJUDSK'ZKLFKVKDOOEHFRQVLGHUHGFRQGLWLRQVSUHFHGHQWWR &RQWUDFWRU¶VULJKWWRDVVHUWWKH&ODLPDQGWRLQLWLDWHWKH'LVSXWH5HVROXWLRQ3URFHVVZLWKUHVSHFW WRVXFK&ODLP ( 5HVSRQVHWR&ODLPV0HHWDQG&RQIHU &ODLPVOHVVWKDQ &ODLPVOHVVWKDQVKDOOEHUHVSRQGHGWRE\&LW\LQZULWLQJ ZLWKLQIRUW\ILYH GD\VRIUHFHLSWRIWKH&ODLPXQOHVV&LW\UHTXHVWVDGGLWLRQDOLQIRUPDWLRQRU GRFXPHQWDWLRQRIWKH&ODLPZLWKLQWKLUW\ GD\VRIUHFHLSWRIWKH&ODLPLQZKLFKFDVH&LW\ VKDOOUHVSRQGWRWKH&ODLPZLWKLQILIWHHQ GD\VDIWHUUHFHLSWRIWKHIXUWKHULQIRUPDWLRQRU GRFXPHQWDWLRQRUZLWKLQDSHULRGRIWLPHQRJUHDWHUWKDQWKDWWDNHQE\&RQWUDFWRULQSURGXFLQJ WKHDGGLWLRQDOLQIRUPDWLRQRUGRFXPHQWDWLRQZKLFKHYHULVJUHDWHU &ODLPVRUPRUH&ODLPVRUPRUHVKDOOEHUHVSRQGHGWRE\&LW\LQZULWLQJZLWKLQ GD\VRIUHFHLSWRIWKH&ODLPXQOHVV&LW\UHTXHVWVDGGLWLRQDOLQIRUPDWLRQRUGRFXPHQWDWLRQ RIWKH&ODLPZLWKLQWKLUW\ GD\VRIUHFHLSWRIWKH&ODLPLQZKLFKFDVH&LW\VKDOOUHVSRQGWR WKH&ODLPZLWKLQWKLUW\ GD\VDIWHUUHFHLSWRIWKHIXUWKHULQIRUPDWLRQRUGRFXPHQWDWLRQRUZLWKLQ DSHULRGRIWLPHQRJUHDWHUWKDQWKDWWDNHQE\&RQWUDFWRULQSURGXFLQJWKHDGGLWLRQDOLQIRUPDWLRQ RUGRFXPHQWDWLRQZKLFKHYHULVJUHDWHU 6LJQDWXUH 'DWH 1DPH 7LWOH &RPSDQ\ Western Allied Corporation Page 63 of 221 . . Item 10 Page 63 of 221 0HHWDQG&RQIHU ,I&RQWUDFWRUGLVSXWHV&LW\ VUHVSRQVHRULI&LW\IDLOVWRUHVSRQGZLWKLQWKH SUHVFULEHGWLPHVHWIRUWKLQ3DUDJUDSK(DQG(DERYH&RQWUDFWRUPD\VRQRWLI\ &LW\LQZULWLQJZLWKLQILIWHHQ GD\VRI&LW\ VUHVSRQVHRUZLWKLQILIWHHQ GD\VRI&LW\¶V UHVSRQVHGXHGDWHLQWKHHYHQWRIDIDLOXUHWRUHVSRQGDQGGHPDQGDQLQIRUPDOFRQIHUHQFHWR PHHWDQGFRQIHUIRUVHWWOHPHQWRIWKHLVVXHVLQGLVSXWH8SRQVXFKGHPDQG&LW\VKDOOVFKHGXOH D PHHW DQG FRQIHU FRQIHUHQFH ZLWKLQ WKLUW\ GD\V RI VXFK GHPDQG IRU GLVFXVVLRQ RI VHWWOHPHQWRIWKHGLVSXWH ) )LQDOLW\RI'HFLVLRQ ,I&RQWUDFWRUGLVSXWHVWKH'LUHFWRU¶VGHFLVLRQXQGHUWKLV$UWLFOHLWVKDOOFRPPHQFHWKH'LVSXWH 5HVROXWLRQ3URFHVVDVVHWIRUWKLQ$UWLFOHRIWKHVH*HQHUDO&RQGLWLRQVE\ILOLQJD6WDWHPHQWRI 'LVSXWHZLWKLQVHYHQ GD\VDIWHUUHFHLSWRIWKH'LUHFWRU¶VUHVSRQVH * &RQWLQXLQJ&RQWUDFW3HUIRUPDQFH'XW\WR3URFHHGZLWK'LVSXWHG:RUN &RQWUDFWRUVKDOOQRWGHOD\RUSRVWSRQHDQ\:RUNSHQGLQJUHVROXWLRQRIDQ\FODLPVGLVSXWHVRU GLVDJUHHPHQWV 3HQGLQJILQDOUHVROXWLRQRIDFODLPWKH&RQWDFWRUVKDOOSURFHHGGLOLJHQWO\ZLWK SHUIRUPDQFHRIWKH&RQWUDFWDQGWKH&LW\VKDOOFRQWLQXHWRPDNHSD\PHQWVIRUXQGLVSXWHG:RUNLQ DFFRUGDQFHZLWKWKH&RQWUDFW'RFXPHQWV ,QWKHHYHQWRIGLVSXWHG:RUN&LW\VKDOOKDYHWKHULJKWWR XQLODWHUDOO\LVVXHD:RUN'LUHFWLYHDQG&RQWUDFWRUVKDOOFRQWLQXHSHUIRUPDQFHSHQGLQJUHVROXWLRQRIWKH GLVSXWHDQGVKDOOPDLQWDLQWKHDFFRXQWLQJDQGFRVWGDWDWRVXEVWDQWLDWHWKHFRVWRIVXFKGLVSXWHGZRUN >(1'2)$57,&/(@ Western Allied Corporation Page 64 of 221 . . Item 10 Page 64 of 221 *(1(5$/ ARTICLE 8 - MATERIALS AND EQUIPMENT $ 7KH&RQWUDFWRUVKDOOIXUQLVKDOOPDWHULDOVDQGHTXLSPHQWQHHGHGWRFRPSOHWHWKH:RUNDQGLQVWDOODWLRQV UHTXLUHGXQGHUWKHWHUPVRIWKLV&RQWUDFWH[FHSWWKRVHPDWHULDOVDQGHTXLSPHQWVSHFLILHGWREH IXUQLVKHGE\WKH&LW\ % 7KH&RQWUDFWRUVKDOOVXEPLWVDWLVIDFWRU\HYLGHQFHWKDWWKHPDWHULDOVDQGHTXLSPHQWWREHIXUQLVKHGDQG XVHGLQWKHZRUNDUHLQFRPSOLDQFHZLWKWKH6SHFLILFDWLRQV 0DWHULDOVDQGHTXLSPHQWLQFRUSRUDWHGLQ WKH:RUNDQGQRWVSHFLILFDOO\FRYHUHGLQWKH6SHFLILFDWLRQVVKDOOEHWKHEHVWRIWKHLUNLQG8QOHVV RWKHUZLVHVSHFLILHGDOOPDWHULDOVDQGHTXLSPHQWLQFRUSRUDWHGLQWKH:RUNXQGHUWKH&RQWUDFWVKDOOEH QHZ 48$/,7<$1':25.0$16+,3 $OOPDWHULDODQGHTXLSPHQWIXUQLVKHGE\WKH&RQWUDFWRUVKDOOEHQHZKLJKJUDGHDQGIUHHIURPGHIHFWVDQG LPSHUIHFWLRQVXQOHVVRWKHUZLVHKHUHLQDIWHUVSHFLILHG :RUNPDQVKLSVKDOOEHLQDFFRUGDQFHZLWKWKHEHVW VWDQGDUGSUDFWLFHV$OOPDWHULDOVDQGHTXLSPHQWPXVWEHRIWKHVSHFLILHGTXDOLW\DQGHTXDOWRDSSURYHGVDPSOHV LIVDPSOHVKDYHEHHQUHTXLUHG$OO:RUNVKDOOEHGRQHDQGFRPSOHWHGLQDWKRURXJKZRUNPDQOLNHPDQQHU QRWZLWKVWDQGLQJDQ\RPLVVLRQIURPWKH6SHFLILFDWLRQVRU'UDZLQJVDQGLWVKDOOEHWKHGXW\RIWKH&RQWUDFWRUWR FDOODWWHQWLRQWRDSSDUHQWHUURUVRURPLVVLRQVDQGUHTXHVWLQVWUXFWLRQVEHIRUHSURFHHGLQJZLWKWKH:RUN7KH 'LUHFWRUPD\E\DSSURSULDWHLQVWUXFWLRQVFRUUHFWHUURUVDQGVXSSO\RPLVVLRQVZKLFKLQVWUXFWLRQVVKDOOEHELQGLQJ XSRQWKH&RQWUDFWRUDVWKRXJKFRQWDLQHGLQWKHRULJLQDO6SHFLILFDWLRQVRU'UDZLQJV$OO:RUNSHUIRUPHGXQGHU WKH6SHFLILFDWLRQVZLOOEHLQVSHFWHGE\WKH'LUHFWRUDVSURYLGHGLQ3DUDJUDSK$OOPDWHULDOVDQGHTXLSPHQW IXUQLVKHGDQGDOO:RUNGRQHPXVWEHVDWLVIDFWRU\WRWKH'LUHFWRU:RUNPDWHULDORUHTXLSPHQWQRWLQDFFRUGDQFH ZLWKWKH6SHFLILFDWLRQVLQWKHRSLQLRQRIWKH'LUHFWRUVKDOOEHPDGHWRFRQIRUPWKHUHWR8QVDWLVIDFWRU\PDWHULDOV DQGHTXLSPHQWZLOOEHUHMHFWHGDQGLIVRRUGHUHGE\WKH'LUHFWRUVKDOODWWKH&RQWUDFWRU VH[SHQVHEH LPPHGLDWHO\UHPRYHGIURPWKHYLFLQLW\RIWKH:RUN 75$'(1$0(6$1'25$33529('(48$/3529,6,21 :KHQHYHULQWKH6SHFLILFDWLRQVRU'UDZLQJVWKHQDPHRUEUDQGRIDPDQXIDFWXUHGDUWLFOHLVXVHGLWLVLQWHQGHG WRLQGLFDWHDPHDVXUHRITXDOLW\DQGXWLOLW\RUDVWDQGDUG([FHSWLQWKRVHLQVWDQFHVZKHUHWKHSURGXFWLV GHVLJQDWHGWRPDWFKRWKHUVLQXVHRQDSDUWLFXODULPSURYHPHQWHLWKHUFRPSOHWHGRULQWKHFRXUVHRIFRPSOHWLRQ WKH&RQWUDFWRUPD\VXEVWLWXWHDQ\RWKHUEUDQGRUPDQXIDFWXUHRIHTXDODSSHDUDQFHTXDOLW\DQGXWLOLW\RQ DSSURYDORIWKH'LUHFWRUSURYLGHGWKHXVHRIVXFKEUDQGRUPDQXIDFWXUHLQYROYHVQRDGGLWLRQDOFRVWWRWKH&LW\ $33529$/2)0$7(5,$/6 $ 7KH&RQWUDFWRUVKDOOIXUQLVKZLWKRXWDGGLWLRQDOFRVWWRWKH&LW\VXFKTXDQWLWLHVRIFRQVWUXFWLRQPDWHULDOV DVPD\EHUHTXLUHGE\WKH'LUHFWRUIRUWHVWSXUSRVHV+HVKHVKDOOSODFHDWWKH'LUHFWRU VGLVSRVDODOO DYDLODEOHIDFLOLWLHVIRUDQGFRRSHUDWHZLWKKLPLQWKHVDPSOLQJDQGWHVWLQJRIDOOPDWHULDOVDQG ZRUNPDQVKLS7KH&RQWUDFWRUVKDOOSUHSD\DOOVKLSSLQJFKDUJHVRQVDPSOHV1RVDPSOHVDUHWREH VXEPLWWHGZLWKWKHELGVXQOHVVRWKHUZLVHVSHFLILHG % (DFKVDPSOHVXEPLWWHGVKDOOEHODEHOHG$OHWWHULQGXSOLFDWHVXEPLWWLQJHDFKVKLSPHQWRIVDPSOHV VKDOOEHPDLOHGWRWKH'LUHFWRUE\WKH&RQWUDFWRU %RWKWKHODEHORQWKHVDPSOHDQGWKHOHWWHURI WUDQVPLWWDOVKDOOLQGLFDWHWKHPDWHULDOUHSUHVHQWHGLWVSODFHRIRULJLQWKHQDPHVRIWKHSURGXFHUDQG WKH&RQWUDFWRUWKH6SHFLILFDWLRQVQXPEHUDQGWLWOHDQGDUHIHUHQFHWRWKHDSSOLFDEOH'UDZLQJVDQG 6SHFLILFDWLRQVSDUDJUDSKV Western Allied Corporation Page 65 of 221 . . Item 10 Page 65 of 221 & 0DWHULDOVRUHTXLSPHQWRIZKLFKVDPSOHVDUHUHTXLUHGVKDOOQRWEHXVHGRQWKH:RUNXQWLODSSURYDOKDV EHHQJLYHQE\WKH'LUHFWRULQZULWLQJ$SSURYDORIDQ\VDPSOHVKDOOEHRQO\IRUWKHFKDUDFWHULVWLFVRIWKH XVHVQDPHGLQVXFKDSSURYDODQGQRRWKHU1RDSSURYDORIDVDPSOHVKDOOEHWDNHQLQLWVHOIWRFKDQJH RUPRGLI\DQ\&RQWUDFWUHTXLUHPHQW ' )DLOXUHRIDQ\PDWHULDOWRSDVVWKHVSHFLILHGWHVWVLQFOXGLQJOLIHF\FOHPDLQWHQDQFHGDWDPD\EH VXIILFLHQWFDXVHIRUUHIXVDOWRFRQVLGHUXQGHUWKLV&RQWUDFWDQ\IXUWKHUVDPSOHRIWKHVDPHEUDQGRU PDNHRIWKDWPDWHULDO 25'(5,1*0$7(5,$/6$1'(48,30(17 2QHFRS\RIHDFKRIWKH&RQWUDFWRU VSXUFKDVHRUGHUVIRUPDWHULDOVDQGHTXLSPHQWIRUPLQJDSRUWLRQRIWKH:RUN PXVWEHIXUQLVKHGWRWKH'LUHFWRULIUHTXHVWHG(DFKVXFKSXUFKDVHRUGHUVKDOOFRQWDLQDVWDWHPHQWWKDWWKH PDWHULDOVDQGHTXLSPHQWLQFOXGHGLQWKHRUGHUDUHVXEMHFWWRLQVSHFWLRQE\WKH&LW\0DWHULDOVDQGHTXLSPHQW SXUFKDVHGORFDOO\ZLOODWWKH&LW\¶VGLVFUHWLRQEHLQVSHFWHGDWWKHSRLQWRIPDQXIDFWXUHRUVXSSO\DQGPDWHULDOV DQGHTXLSPHQWVXSSOLHGIURPSRLQWVRXWVLGHWKH/RV$QJHOHVDUHDZLOOEHLQVSHFWHGXSRQDUULYDODWWKHMREH[FHSW ZKHQRWKHULQVSHFWLRQUHTXLUHPHQWVDUHSURYLGHGIRUVSHFLILFPDWHULDOVLQRWKHUVHFWLRQVRIWKH&RQWUDFW 'RFXPHQWV $87+25,7<2)7+(',5(&725 $ 2QDOOTXHVWLRQVFRQFHUQLQJWKHDFFHSWDELOLW\RIPDWHULDOVRUPDFKLQHU\WKHFODVVLILFDWLRQRIPDWHULDOV WKHH[HFXWLRQRIWKH:RUNDQGFRQIOLFWLQJLQWHUHVWVRI&RQWUDFWRUVSHUIRUPLQJUHODWHGZRUNWKHGHFLVLRQ RIWKH'LUHFWRUVKDOOEHILQDODQGELQGLQJ % 7KH'LUHFWRUZLOOPDNHSHULRGLFREVHUYDWLRQVRIPDWHULDOVDQGFRPSOHWHGZRUNWRREVHUYHWKHLU FRPSOLDQFHZLWK'UDZLQJV6SHFLILFDWLRQVDQGGHVLJQDQGSODQQLQJFRQFHSWVEXWKHVKHLVQRW UHVSRQVLEOHIRUWKHVXSHULQWHQGHQFHRIFRQVWUXFWLRQSURFHVVHVVLWHFRQGLWLRQVRSHUDWLRQVHTXLSPHQW SHUVRQQHORUWKHPDLQWHQDQFHRIDVDIHSODFHWRZRUNRUDQ\VDIHW\LQRQRUDERXWWKHVLWHRIZRUN ,163(&7,21 $OOPDWHULDOVIXUQLVKHGDQGZRUNGRQHXQGHUWKLV&RQWUDFWZLOOEHVXEMHFWWRULJLGLQVSHFWLRQ7KH&RQWUDFWRUVKDOO IXUQLVKZLWKRXWH[WUDFKDUJHWKHQHFHVVDU\WHVWSLHFHVDQGVDPSOHVLQFOXGLQJIDFLOLWLHVDQGODERUIRUREWDLQLQJ WKHPDVUHTXHVWHGE\WKH'LUHFWRU7KH'LUHFWRURUKLVKHUDXWKRUL]HGDJHQWRUDJHQWVDWDOOWLPHVVKDOOKDYH DFFHVVWRDOOSDUWVRIWKHVKRSDQGWKHZRUNVZKHUHVXFKPDWHULDOVXQGHUKLVKHULQVSHFWLRQLVEHLQJ PDQXIDFWXUHGRUWKHZRUNSHUIRUPHG:RUNRUPDWHULDOWKDWGRHVQRWFRQIRUPWRWKH6SHFLILFDWLRQVDOWKRXJK DFFHSWHGWKURXJKRYHUVLJKWPD\EHUHMHFWHGDWDQ\VWDJHRIWKH:RUN :KHQHYHUWKH&RQWUDFWRULVSHUPLWWHGRU GLUHFWHGWRGRQLJKWZRUNRUWRYDU\WKHSHULRGGXULQJZKLFKZRUNLVFDUULHGRQHDFKGD\KHVKHVKDOOJLYHWKH 'LUHFWRUGXHQRWLFHVRWKDWLQVSHFWLRQPD\EHSURYLGHG6XFKZRUNVKDOOEHGRQHXQGHUUHJXODWLRQVWREH IXUQLVKHGLQZULWLQJE\WKH'LUHFWRU ,1)5,1*(0(172)3$7(176 7KH&RQWUDFWRUVKDOOKROGDQGVDYHWKH&LW\LWVRIILFHUVDJHQWVVHUYDQWVDQGHPSOR\HHVKDUPOHVVIURPDQG DJDLQVWDOODQGHYHU\GHPDQGRUGHPDQGVRIDQ\QDWXUHRUNLQGIRURURQDFFRXQWRIWKHXVHRIDQ\SDWHQWHG LQYHQWLRQSURFHVVHTXLSPHQWDUWLFOHRUDSSOLDQFHHPSOR\HGLQWKHH[HFXWLRQRIWKH:RUNRULQFOXGHGLQWKH PDWHULDOVRUVXSSOLHVDJUHHGWREHIXUQLVKHGXQGHUWKLV&RQWUDFWDQGVKRXOGWKH&RQWUDFWRUKLVKHUDJHQWV VHUYDQWVRUHPSOR\HHVRUDQ\RIWKHPEHHQMRLQHGIURPIXUQLVKLQJRUXVLQJDQ\LQYHQWLRQSURFHVVHTXLSPHQW DUWLFOHPDWHULDOVVXSSOLHVRUDSSOLDQFHVXSSOLHGRUUHTXLUHGWREHVXSSOLHGRUXVHGXQGHUWKLV&RQWUDFWWKH &RQWUDFWRUVKDOOSURPSWO\VXEVWLWXWHRWKHULQYHQWLRQVSURFHVVHVHTXLSPHQWDUWLFOHVPDWHULDOVVXSSOLHVRU Western Allied Corporation Page 66 of 221 . . Item 10 Page 66 of 221 DSSOLDQFHVLQOLHXWKHUHRIRIHTXDOHIILFLHQF\TXDOLW\ILQLVKVXLWDELOLW\DQGPDUNHWYDOXHDQGVDWLVIDFWRU\LQDOO UHVSHFWVWRWKH'LUHFWRU2ULQWKHHYHQWWKDWWKH'LUHFWRUHOHFWVLQOLHXRIVXFKVXEVWLWXWLRQWRKDYHVXSSOLHG DQGWRUHWDLQDQGXVHDQ\VXFKLQYHQWLRQSURFHVVHTXLSPHQWDUWLFOHPDWHULDOVVXSSOLHVRUDSSOLDQFHVDVPD\ E\WKLV&RQWUDFWEHUHTXLUHGWREHVXSSOLHGDQGXVHGLQWKDWHYHQWWKH&RQWUDFWRUVKDOODWKLVKHUH[SHQVHSD\ VXFKUR\DOWLHVDQGVHFXUHVXFKYDOLGOLFHQVHVDVPD\EHUHTXLVLWHDQGQHFHVVDU\WRHQDEOHWKH&LW\LWVRIILFHUV DJHQWVVHUYDQWVDQGHPSOR\HHVRUDQ\RIWKHPWRXVHVXFKLQYHQWLRQSURFHVVHTXLSPHQWDUWLFOHPDWHULDOV VXSSOLHVRUDSSOLDQFHVZLWKRXWEHLQJGLVWXUEHGRULQZD\LQWHUIHUHGZLWKE\DQ\SURFHHGLQJLQODZRUHTXLW\RQ DFFRXQWWKHUHRI6KRXOGWKH&RQWUDFWRUQHJOHFWRUUHIXVHSURPSWO\WRPDNHWKHVXEVWLWXWLRQKHUHLQEHIRUHUHTXLUHG RUWRSD\VXFKUR\DOWLHVDQGVHFXUHVXFKOLFHQVHVDVPD\EHQHFHVVDU\DQGUHTXLVLWHIRUWKHSXUSRVHDIRUHVDLG WKHQLQWKDWHYHQWWKH'LUHFWRUVKDOOKDYHWKHULJKWWRPDNHVXFKVXEVWLWXWLRQRUWKH&LW\PD\SD\VXFKUR\DOWLHV DQGVHFXUHVXFKOLFHQVHVDQGFKDUJHWKHFRVWWKHUHRIDJDLQVWDQ\PRQH\GXHWKH&RQWUDFWRUIURPWKH&LW\RU UHFRYHUWKHDPRXQWWKHUHRIIURPKLPKHUDQGKLVKHUVXUHW\QRWZLWKVWDQGLQJILQDOSD\PHQWXQGHUWKLV&RQWUDFW PD\KDYHEHHQPDGH >(1'2)$57,&/(@ Western Allied Corporation Page 67 of 221 . . Item 10 Page 67 of 221 ARTICLE 9 – SUBMITTALS *(1(5$/ $ 7KH&RQWUDFWRUVKDOOVXEPLWVDPSOHVGUDZLQJVDQGGDWDIRUWKH'LUHFWRU VDSSURYDOZKLFKGHPRQVWUDWH IXOO\WKDWWKHFRQVWUXFWLRQDQGWKHPDWHULDOVDQGHTXLSPHQWWREHIXUQLVKHGZLOOFRPSO\ZLWKWKH SURYLVLRQVDQGLQWHQWRIWKH'UDZLQJVDQG6SHFLILFDWLRQV % 6SHFLILFLWHPVWREHFRYHUHGE\WKHVXEPLWWDOVVKDOOLQFOXGHDVDPLQLPXPWKHIROORZLQJ )RUVWUXFWXUHVVXEPLWDOOVKRSVHWWLQJHTXLSPHQWPLVFHOODQHRXVLURQDQGUHLQIRUFHPHQW GUDZLQJVDQGVFKHGXOHVQHFHVVDU\ )RUFRQGXLWVVXEPLWDGHWDLOHGOD\RXWRIWKHFRQGXLWZLWKGHWDLOVRIEHQGVDQGIDEULFDWHG VSHFLDOVDQGIXUQLVKDQ\RWKHUGHWDLOVQHFHVVDU\6KRZORFDWLRQRIVKRSDQGILHOGZHOGV )RUHTXLSPHQWZKLFKUHTXLUHVHOHFWULFDOVHUYLFHVXEPLWGHWDLOHGLQIRUPDWLRQWRVKRZSRZHU VXSSO\UHTXLUHPHQWVZLULQJGLDJUDPVFRQWURODQGSURWHFWLRQVFKHPDWLFVVKRSWHVWGDWD RSHUDWLRQ DQG PDLQWHQDQFH SURFHGXUHV RXWOLQH GUDZLQJV DQG PDQXIDFWXUHU V UHFRPPHQGDWLRQRIWKHLQWHUIDFHLQWHUORFNDPRQJWKHHTXLSPHQW )RUPHFKDQLFDOHTXLSPHQWVXEPLWDOOGDWDSHUWLQHQWWRWKHLQVWDOODWLRQDQGPDLQWHQDQFHRI WKH HTXLSPHQW LQFOXGLQJ VKRS GUDZLQJV PDQXIDFWXUHU V UHFRPPHQGHG LQVWDOODWLRQ SURFHGXUHGHWDLOHGLQVWDOODWLRQGUDZLQJVWHVWGDWDDQGFXUYHVPDLQWHQDQFHPDQXDOVDQG RWKHUGHWDLOVQHFHVVDU\ 6DPSOHV &RORUV 6XEVWLWXWLRQV 0DQXDOV $VEXLOWGUDZLQJV 6DIHW\SODQVUHTXLUHGE\$UWLFOH 352'8&7+$1'/,1* $ 6XEPLWWDOVVKDOOEHDFFRPSDQLHGE\DOHWWHURIWUDQVPLWWDODQGVKDOOEHLQVWULFWDFFRUGDQFHZLWKWKH SURYLVLRQVRIWKLV$UWLFOH % 6XEPLWSULRULW\RISURFHVVLQJZKHQDSSURSULDWH 6&+('8/(2)68%0,77$/6 $ 7KH&RQWUDFWRUVKDOOSUHSDUHDQGVXEPLWDVFKHGXOHRIVXEPLWWDOV 7KHVFKHGXOHRIVXEPLWWDOVVKDOOEH LQWKHIRUPRIDVXEPLWWDOORJ5HIHUWR3DUDJUDSK Western Allied Corporation Page 68 of 221 . . Item 10 Page 68 of 221 6+23'5$:,1*6 $ $OOVKRSGUDZLQJVVKDOOEHSURGXFHGWRDVFDOHVXIILFLHQWO\ODUJHWRVKRZDOOSHUWLQHQWIHDWXUHVRIWKH LWHPDQGLWVPHWKRGRIFRQQHFWLRQWRWKH:RUN % $OOVKRSGUDZLQJSULQWVVKDOOEHPDGHLQEOXHRUEODFNOLQHRQZKLWHEDFNJURXQG5HSURGXFWLRQVRI &LW\&RQWUDFW'UDZLQJVDUHQRWDFFHSWDEOH & 7KHRYHUDOOGLPHQVLRQVRIHDFKGUDZLQJVXEPLWWHGWRWKH'LUHFWRUVKDOOEHHTXDOWRRQHRIWKH&LW\ V VWDQGDUGVKHHWVL]HVDVOLVWHGEHORZ7KHWLWOHEORFNVKDOOEHORFDWHGLQWKHORZHUULJKWKDQGFRUQHURI HDFKGUDZLQJDQGVKDOOEHFOHDURIDOOOLQH:RUNGLPHQVLRQVGHWDLOVDQGQRWHV 6KHHW6L]HV +HLJKW;:LGWK ; ; ; ´;´ &2/256 8QOHVVWKHSUHFLVHFRORUDQGSDWWHUQDUHVSHFLILHGHOVHZKHUHVXEPLWDFFXUDWHFRORUFKDUWVDQGSDWWHUQFKDUWVWR WKH'LUHFWRUIRUKLVKHUUHYLHZDQGVHOHFWLRQZKHQHYHUDFKRLFHRIFRORURUSDWWHUQLVDYDLODEOHLQDVSHFLILHG SURGXFW/DEHOHDFKFKDUWQDPLQJWKHVRXUFHWKHSURSRVHGORFDWLRQRIXVHRQWKHSURMHFWDQGWKHSURMHFW 0$18)$&785(56 /,7(5$785( :KHUHFRQWHQWVRIVXEPLWWHGOLWHUDWXUHIURPPDQXIDFWXUHUVLQFOXGHVGDWDQRWSHUWLQHQWWRWKHVXEPLWWDOFOHDUO\ VKRZZKLFKSRUWLRQVRIWKHFRQWHQWVDUHEHLQJVXEPLWWHGIRUUHYLHZ 68%67,787,216 $ 7KH&RQWUDFWLVEDVHGRQWKHPDWHULDOVHTXLSPHQWDQGPHWKRGVGHVFULEHGLQWKH&RQWUDFW'RFXPHQWV $Q\&RQWUDFWRUSURSRVHGVXEVWLWXWLRQVDUHVXEMHFWWRWKH'LUHFWRU¶VDSSURYDO 7KH'LUHFWRUZLOOFRQVLGHUSURSRVDOVIRUVXEVWLWXWLRQRIPDWHULDOVHTXLSPHQWDQGPHWKRGVRQO\ZKHQ VXFKSURSRVDOVDUHDFFRPSDQLHGE\IXOODQGFRPSOHWHWHFKQLFDOGDWDDQGDOORWKHULQIRUPDWLRQ LQFOXGLQJOLIHF\FOHPDLQWHQDQFHGDWDUHTXLUHGE\WKH'LUHFWRUWRHYDOXDWHWKHSURSRVHGVXEVWLWXWLRQ % $Q\UHTXHVWVIRUVXEVWLWXWLRQVE\WKH&RQWUDFWRUPXVWEHPDGHZLWKLQIRUW\ILYH FDOHQGDUGD\VIURP WKH,VVXDQFH'DWHRQWKH1RWLFHWR3URFHHG2WKHUZLVHVXFKUHTXHVWVZLOOQRWEHFRQVLGHUHG & 7UDGHQDPHVDQGRUDSSURYHGHTXDOSURYLVLRQDVVHWIRUWKLQ3DUDJUDSK 0$18$/6 $ :KHQPDQXDOVDUHUHTXLUHGWREHVXEPLWWHGFRYHULQJLWHPVLQFOXGHGLQWKLV:RUNSUHSDUHDQGVXEPLW VXFKPDQXDOVLQDSSUR[LPDWHO\;IRUPDWLQGXUDEOHSODVWLFELQGHUV ,QDGGLWLRQPDQXDOV VKDOOEHVXEPLWWHGLQHOHFWURQLFIRUPDW0DQXDOVVKDOOFRQWDLQDWOHDVWWKHIROORZLQJ ,GHQWLILFDWLRQRQRUUHDGDEOHWKURXJKWKHIURQWFRYHUVWDWLQJJHQHUDOQDWXUHRIWKHPDQXDO Western Allied Corporation Page 69 of 221 . . Item 10 Page 69 of 221 1HDWO\W\SHZULWWHQLQGH[QHDUWKHIURQWRIWKHPDQXDOIXUQLVKLQJLPPHGLDWHLQIRUPDWLRQDVWR ORFDWLRQLQWKHPDQXDORIDOOHPHUJHQF\GDWDUHJDUGLQJWKHLQVWDOODWLRQ &RPSOHWHLQVWUXFWLRQVUHJDUGLQJRSHUDWLRQDQGPDLQWHQDQFHRIDOOHTXLSPHQWLQYROYHG &RPSOHWHQRPHQFODWXUHRIDOOUHSODFHDEOHSDUWVWKHLUSDUWQXPEHUVFXUUHQWFRVWDQGQDPH DQGDGGUHVVRIQHDUHVWYHQGRURISDUWV &RS\RIDOOJXDUDQWHHVDQGZDUUDQWLHVLVVXHG &RS\RIGUDZLQJVZLWKDOOGDWDFRQFHUQLQJFKDQJHVPDGHGXULQJFRQVWUXFWLRQ % :KHUHFRQWHQWVRIPDQXDOVLQFOXGHPDQXIDFWXUHUV FDWDORJSDJHVFOHDUO\LQGLFDWHWKHSUHFLVHLWHPV LQFOXGHGLQWKLVLQVWDOODWLRQDQGGHOHWHRURWKHUZLVHFOHDUO\LQGLFDWHDOOPDQXIDFWXUHUV GDWDZLWKZKLFK WKLVLQVWDOODWLRQLVQRWFRQFHUQHG $6%8,/7'5$:,1*6 $ :KHQUHTXLUHGWREHVXEPLWWHGFRYHULQJLWHPVLQFOXGHGLQWKLV:RUNWKH&RQWUDFWRUVKDOOGHOLYHUWRWKH &LW\RQHFRPSOHWHVHWRIILQDO$V%XLOWKDUGFRS\GUDZLQJVWRJHWKHUZLWKDVHWRI$XWR&$'GUDZLQJILOHV LQHOHFWURQLFIRUPDWVKRZLQJFRPSOHWHGEXLOGLQJ³DVEXLOW´IRU&LW\UHFRUGVEHIRUHWKH&RQWUDFWZLOOEH DFFHSWHGE\WKH&LW\ % 7KHGUDZLQJVVKDOOEHGXSOLFDWHVDQGDWWKHVDPHVL]HDQGGLPHQVLRQDOVFDOHDVWKHRULJLQDOV7KH\ VKDOOEHRQDSRO\HVWHUWUDQVOXFHQWEDVHPDWHULDOZLWKDPLQLPXPVKHHWWKLFNQHVVRILQFK PP & 7KHOHJLELOLW\DQGFRQWUDVWRIHDFKGUDZLQJVXEPLWWHGWRWKH&LW\VKDOOEHVXFKWKDWHYHU\OLQHQXPEHU OHWWHUDQGFKDUDFWHULVFOHDUO\UHDGDEOHLQDIXOOVL]HEORZEDFNIURPDPPPLFURILOPQHJDWLYHRIWKH GUDZLQJ 68%0,77$/648$17,7,(6 $ 6XEPLWRQH FRS\YLDHPDLOWRNMDFNVRQ#FLW\RIYHUQRQRUJRIDOOGDWDDQGGUDZLQJVXQOHVVVSHFLILHG RWKHUZLVH % 6XEPLWDOOVDPSOHVXQOHVVVSHFLILHGRWKHUZLVHLQWKHTXDQWLW\WREHUHWXUQHGSOXVWZRZKLFKZLOOEH UHWDLQHGE\WKH'LUHFWRU ,'(17,),&$7,212)68%0,77$/6 &RPSOHWHO\LGHQWLI\HDFKVXEPLWWDODQGUHVXEPLWWDOE\VKRZLQJDWOHDVWWKHIROORZLQJLQIRUPDWLRQ $ 1DPHDQGDGGUHVVRIVXEPLWWHUSOXVQDPHDQGWHOHSKRQHQXPEHURIWKHLQGLYLGXDOZKRPD\EH FRQWDFWHGIRUIXUWKHULQIRUPDWLRQ % 1DPHRISURMHFWDVLWDSSHDUVLQWKH&RQWUDFW'RFXPHQWVDQG6SHFLILFDWLRQ1R & 'UDZLQJQXPEHUDQG6SHFLILFDWLRQVVHFWLRQQXPEHURWKHUWKDQWKLVVHFWLRQWRZKLFKWKHVXEPLWWDO DSSOLHV ' :KHWKHUWKLVLVDQRULJLQDOVXEPLWWDORUUHVXEPLWWDO Western Allied Corporation Page 70 of 221 . . Item 10 Page 70 of 221 ( )RUVDPSOHVLQGLFDWHWKHVRXUFHRIWKHVDPSOH 6&+('8/(2)68%0,77$/6 $ 6XEPLWLQLWLDOVFKHGXOHRIVXEPLWWDOVZLWKLQILYH :RUNLQJ'D\VDIWHUWKH,VVXDQFH'DWHRQ1RWLFHWR 3URFHHG % 6XEPLWUHYLVHGVFKHGXOHRIVXEPLWWDOVZLWKLQILYH :RUNLQJ'D\VDIWHUGDWHRIUHTXHVWIURPWKH 'LUHFWRU & 7KH'LUHFWRUZLOOUHYLHZVFKHGXOHRIVXEPLWWDOVDQGZLOOQRWLI\&RQWUDFWRUWKDWVFKHGXOHLVDFFHSWDEOH RUQRWDFFHSWDEOHZLWKLQILYH :RUNLQJ'D\VDIWHUUHFHLSW &225',1$7,212)68%0,77$/6 $ 3ULRUWRVXEPLWWDOIRUWKH'LUHFWRU¶VUHYLHZXVHDOOPHDQVQHFHVVDU\WRIXOO\FRRUGLQDWHDOOPDWHULDO LQFOXGLQJWKHIROORZLQJSURFHGXUHV 'HWHUPLQHDQGYHULI\DOOILHOGGLPHQVLRQVDQGFRQGLWLRQVPDWHULDOVFDWDORJQXPEHUVDQGVLPLODU GDWD &RRUGLQDWHDVUHTXLUHGZLWKDOOWUDGHVDQGZLWKDOOSXEOLFDJHQFLHVLQYROYHG 6HFXUHDOOQHFHVVDU\DSSURYDOVIURPSXEOLFDJHQFLHVDQGRWKHUVDQGVLJQLI\E\VWDPSRURWKHU PHDQVWKDWWKH\KDYHEHHQVHFXUHG &OHDUO\LQGLFDWHDOOGHYLDWLRQVIURPWKH6SHFLILFDWLRQV % 8QOHVVRWKHUZLVHVSHFLILFDOO\SHUPLWWHGE\WKH'LUHFWRUPDNHDOOVXEPLWWDOVLQJURXSVFRQWDLQLQJDOO DVVRFLDWHGLWHPV WKH'LUHFWRUPD\UHMHFWSDUWLDOVXEPLWWDOVDVQRWFRPSO\LQJZLWKWKHSURYLVLRQVRIWKH 6SHFLILFDWLRQV 7,0,1*)2568%0,77$/6 $ 0DNHDOOVXEPLWWDOVIDUHQRXJKLQDGYDQFHRIVFKHGXOHGGDWHVRILQVWDOODWLRQWRSURYLGHDOOUHTXLUHGWLPH IRUUHYLHZVIRUVHFXULQJQHFHVVDU\DSSURYDOVIRUSRVVLEOHUHYLVLRQDQGUHVXEPLWWDODQGIRUSODFLQJ RUGHUVDQGVHFXULQJGHOLYHU\ % ,QVFKHGXOLQJDOORZDWOHDVW:RUNLQJ'D\VIRUWKH'LUHFWRU¶VUHYLHZSOXVWKHWUDQVLWWLPHWRDQGIURP WKH&LW\RIILFH & 0DQXDOVVKDOOEHVXEPLWWHGSULRUWRSHUIRUPLQJIXQFWLRQDOWHVWV $33529$/%<&,7< $ (DFKVXEPLWWDOH[FHSWPDQXDOVVFKHGXOHRIFRVWVIRUSURJUHVVSD\PHQWVDQGDVEXLOWGUDZLQJVZLOO EHUHWXUQHGWRWKH&RQWUDFWRUPDUNHG1R([FHSWLRQV7DNHQ³0DNH&RUUHFWLRQV1RWHG'R1RW 5HVXEPLW´RU³0DNH&RUUHFWLRQV1RWHG5HVXEPLW´0DQXDOVVFKHGXOHRIFRVWVDQGDVEXLOWGUDZLQJV ZLOOEHUHWXUQHGWR&RQWUDFWRUYLDHPDLOIRUUHVXEPLWWDOLILQFRPSOHWHRUXQDFFHSWDEOH % 6XEPLWWDOVPDUNHG$SSURYHGDV1RWHGQHHGQRWEHUHVXEPLWWHGEXWWKHQRWHVVKDOOEHIROORZHG Western Allied Corporation Page 71 of 221 . . Item 10 Page 71 of 221 & ,IVXEPLWWDOLVUHWXUQHGIRUFRUUHFWLRQLWZLOOEHPDUNHGWRLQGLFDWHZKDWLVXQVDWLVIDFWRU\ ' 5HVXEPLW RQH RULJLQDO KDUG FRS\ DQG RQH HOHFWURQLF FRS\ YLD HPDLO WR NMDFNVRQ#FLW\RIYHUQRQRUJRIWKHUHYLVHGGUDZLQJVRUGDWDDVLQGLFDWHG ( $SSURYDORIHDFKVXEPLWWDOE\WKH'LUHFWRUZLOOEHJHQHUDORQO\DQGVKDOOQRWEHFRQVWUXHGDV 3HUPLWWLQJDQ\GHSDUWXUHVIURPWKH6SHFLILFDWLRQVUHTXLUHPHQWV 5HOLHYLQJWKH&RQWUDFWRURIWKHUHVSRQVLELOLW\IRUDQ\HUURUVDQGRPLVVLRQVLQGHWDLOVGLPHQVLRQV RURIRWKHUQDWXUHWKDWPD\H[LVW $SSURYLQJGHSDUWXUHVIURPDGGLWLRQDOGHWDLOVRULQVWUXFWLRQVSUHYLRXVO\IXUQLVKHGE\WKH'LUHFWRU &+$1*(672$33529('68%0,77$/6 $ $UHVXEPLWWDOLVUHTXLUHGIRUDQ\SURSRVHGFKDQJHWRDQDSSURYHGVXEPLWWDO&KDQJHVZKLFKUHTXLUH UHVXEPLWWDOLQFOXGHEXWDUHQRWQHFHVVDULO\OLPLWHGWRGUDZLQJUHYLVLRQVFKDQJHVLQPDWHULDOVDQG HTXLSPHQWLQVWDOODWLRQSURFHGXUHVDQGWHVWGDWD$OOUHVXEPLWWDOVVKDOOLQFOXGHDQH[SODQDWLRQRIWKH QHFHVVLW\IRUWKHFKDQJH % 0LQRUFRUUHFWLRQVWRDQDSSURYHGVXEPLWWDOPD\EHDFFRPSOLVKHGE\VXEPLWWLQJD&RUUHFWHG&RS\ >(1'2)$57,&/(@ Western Allied Corporation Page 72 of 221 . . Item 10 Page 72 of 221 ARTICLE 10 – SAFETY 3527(&7,212)3(56216$1'3523(57< $ &RQWUDFWRU V5HVSRQVLELOLW\ 1RWZLWKVWDQGLQJDQ\RWKHUSURYLVLRQRIWKH&RQWUDFW'RFXPHQWVWKH &RQWUDFWRUVKDOOEHVROHO\DQGFRPSOHWHO\UHVSRQVLEOHIRUFRQGLWLRQVRIWKHMREVLWHLQFOXGLQJVDIHW\RI DOOSHUVRQVDQGSURSHUW\GXULQJSHUIRUPDQFHRIWKH:RUN7KLVUHTXLUHPHQWZLOODSSO\FRQWLQXRXVO\DQG ZLOOQRWEHOLPLWHGWRQRUPDOZRUNLQJKRXUV6DIHW\DQGVDQLWDU\SURYLVLRQVVKDOOFRQIRUPWRDOODSSOLFDEOH )HGHUDO6WDWH&RXQW\DQGORFDOODZVUHJXODWLRQVRUGLQDQFHVVWDQGDUGVDQGFRGHV:KHUHDQ\RI WKHVHDUHLQFRQIOLFWWKHPRUHVWULQJHQWUHTXLUHPHQWVKDOOEHIROORZHG % 6DQLWDU\)DFLOLWLHV7KH&RQWUDFWRUVKDOOIXUQLVKDQGPDLQWDLQVDQLWDU\IDFLOLWLHVE\WKHZRUNVLWHVIRUWKH HQWLUHFRQVWUXFWLRQSHULRG & 3URWHFWLRQRIWKH3XEOLF7KH&RQWUDFWRUVKDOOWDNHVXFKVWHSVDQGSUHFDXWLRQVDVKLVKHURSHUDWLRQV ZDUUDQWWRSURWHFWWKHSXEOLFIURPGDQJHUORVVRIOLIHORVVRISURSHUW\RULQWHUUXSWLRQRISXEOLFVHUYLFHV 8QIRUHVHHQFRQGLWLRQVPD\DULVHZKLFKZLOOUHTXLUHWKDWLPPHGLDWHSURYLVLRQVEHPDGHWRSURWHFWWKH SXEOLFIURPGDQJHURUORVVRUGDPDJHWROLIHDQGSURSHUW\GXHGLUHFWO\RULQGLUHFWO\WRSURVHFXWLRQRI ZRUNXQGHUWKLVFRQWUDFW:KHQHYHULQWKHRSLQLRQRIWKH'LUHFWRUDFRQGLWLRQH[LVWVZKLFKWKH &RQWUDFWRUKDVQRWWDNHQVXIILFLHQWSUHFDXWLRQRISXEOLFVDIHW\SURWHFWLRQRIXWLOLWLHVDQGRUSURWHFWLRQRI DGMDFHQWVWUXFWXUHVRUSURSHUW\WKH'LUHFWRUZLOORUGHUWKH&RQWUDFWRUWRSURYLGHDUHPHG\IRUWKH FRQGLWLRQ,IWKH&RQWUDFWRUIDLOVWRDFWRQWKHVLWXDWLRQZLWKLQDUHDVRQDEOHWLPHSHULRGDVGHWHUPLQHG E\WKH'LUHFWRURULQWKHHYHQWRIDQHPHUJHQF\VLWXDWLRQWKH'LUHFWRUPD\SURYLGHVXLWDEOHSURWHFWLRQ E\FDXVLQJVXFKZRUNWREHGRQHDQGPDWHULDOWREHIXUQLVKHGDVLQWKHRSLQLRQRIWKH'LUHFWRUPD\ VHHPUHDVRQDEOHDQGQHFHVVDU\7KHFRVWDQGH[SHQVHRIDOOUHSDLUV LQFOXGLQJODERUDQGPDWHULDOV DVDUHGHHPHGQHFHVVDU\VKDOOEHERUQHE\WKH&RQWUDFWRU$OOH[SHQVHVLQFXUUHGE\WKH&LW\IRU HPHUJHQF\UHSDLUVZLOOEHGHGXFWHGIURPWKHILQDOSD\PHQWGXHWRWKH&RQWUDFWRU 3527(&7,21)520+$=$5'6 $ 7UHQFK([FDYDWLRQ ([FDYDWLRQIRUDQ\WUHQFKIRXU IHHWRUPRUHLQGHSWKVKDOOQRWEHJLQXQWLOWKH&RQWUDFWRUKDVUHFHLYHG DSSURYDOIURPWKH'LUHFWRURIWKH&RQWUDFWRU VGHWDLOHGSODQIRUZRUNHUSURWHFWLRQIURPWKHKD]DUGVRI FDYLQJJURXQGGXULQJWKHH[FDYDWLRQRIVXFKWUHQFK6XFKSODQVKDOOVKRZWKHGHWDLOVRIWKHGHVLJQRI VKRULQJEUDFLQJVORSLQJRURWKHUSURYLVLRQVWREHPDGHIRUZRUNHUSURWHFWLRQGXULQJVXFKH[FDYDWLRQ 1RVXFKSODQVKDOODOORZWKHXVHRIVKRULQJVORSLQJRUSURWHFWLYHV\VWHPOHVVHIIHFWLYHWKDQWKDWUHTXLUHG E\WKH&RQVWUXFWLRQ6DIHW\2UGHUVRIWKH'LYLVLRQRI2FFXSDWLRQDO6DIHW\DQG+HDOWKDQGLIVXFKSODQ YDULHVIURPWKHVKRULQJV\VWHPVWDQGDUGVHVWDEOLVKHGE\WKH&RQVWUXFWLRQ6DIHW\2UGHUVWKHSODQVKDOO EHSUHSDUHGDQGVLJQHGE\DQHQJLQHHUZKRLVUHJLVWHUHGDVD&LYLORU6WUXFWXUDO'LUHFWRULQWKH6WDWH RI&DOLIRUQLD % &RQILQHG6SDFHV &RQWUDFWRUVKDOOFRPSO\ZLWKDOORIWKHSURYLVLRQVRI*HQHUDO,QGXVWU\6DIHW\2UGHUVRIWKH&DOLIRUQLD &RGHRI5HJXODWLRQV(QWU\RIDFRQILQHGVSDFHVKDOOQRWEHDOORZHGXQWLOWKH&RQWUDFWRUKDVUHFHLYHG DSSURYDOIURPWKH'LUHFWRURIWKH&RQWUDFWRU¶VSURJUDPIRUFRQILQHGVSDFHHQWU\ &RQILQHGVSDFHPHDQV DVSDFHWKDW ,VODUJHHQRXJKDQGVRFRQILJXUHGWKDWDQHPSOR\HHFDQERGLO\HQWHUDQGSHUIRUP DVVLJQHG:RUN DQG +DVOLPLWHGRUUHVWULFWHGPHDQVIRUHQWU\RUH[LW IRUH[DPSOHWDQNVYHVVHOV VLORVVWRUDJHELQVKRSSHUVYDXOWVDQGSLWVDUHVSDFHVWKDWPD\KDYHOLPLWHGPHDQVRIHQWU\ DQG ,VQRWGHVLJQHGIRUFRQWLQXRXVHPSOR\HHRFFXSDQF\)DLOXUHWRVXEPLWDFRQILQHGVSDFHHQWU\SURJUDP Western Allied Corporation Page 73 of 221 . . Item 10 Page 73 of 221 PD\UHVXOWLQDFWLRQVDVSURYLGHGLQ$UWLFOH ³6XVSHQVLRQRU7HUPLQDWLRQRI&RQWUDFW´ & 0DWHULDO6DIHW\'DWD6KHHW &RQWUDFWRUVKDOOFRPSO\ZLWKDOORIWKHSURYLVLRQVRI*HQHUDO,QGXVWU\6DIHW\2UGHUVRIWKH&DOLIRUQLD $GPLQLVWUDWLYH&RGH7KH&RQWUDFWRUVKDOOVXEPLWWRWKH'LUHFWRUD0DWHULDO6DIHW\'DWD6KHHW 06'6 IRUHDFKKD]DUGRXVVXEVWDQFHSURSRVHGWREHXVHGWHQ GD\VSULRUWRWKHGHOLYHU\RIVXFKPDWHULDOV WRWKHMREVLWHRUXVHRIVXFKPDWHULDOVDWDPDQXIDFWXULQJSODQWZKHUHWKH'LUHFWRULVWRSHUIRUPDQ LQVSHFWLRQ )RUPDWHULDOVZKLFKDUHWREHWHVWHGLQ&LW\ODERUDWRULHVWKH06'6VKDOOEHVXEPLWWHGZLWK WKHVDPSOH V +D]DUGRXVVXEVWDQFHLVGHILQHGDVDQ\VXEVWDQFHLQFOXGHGLQWKHOLVW 'LUHFWRU V/LVW RIKD]DUGRXVVXEVWDQFHVSUHSDUHGE\WKH'LUHFWRU&DOLIRUQLD'HSDUWPHQWRI,QGXVWULDO5HODWLRQV SXUVXDQWWR/DERU&RGH6HFWLRQ)DLOXUHWRVXEPLWDQ06'6IRUDQ\KD]DUGRXVVXEVWDQFHPD\ UHVXOWLQDFWLRQVDVSURYLGHGLQ$UWLFOH6XVSHQVLRQRU7HUPLQDWLRQRI&RQWUDFW ',))(5,1*6,7(&21',7,216 $ 'LIIHULQJ6LWH&RQGLWLRQV'HILQHG 7KH&RQWUDFWRUVKDOOSURPSWO\DQGEHIRUHVXFKFRQGLWLRQVDUH GLVWXUEHGQRWLI\WKH'LUHFWRULQZULWLQJRIDQ\'LIIHULQJ6LWH&RQGLWLRQV 'LIIHULQJ6LWH&RQGLWLRQVDUH WKRVHFRQGLWLRQVORFDWHGDWWKHSURMHFWVLWHRULQH[LVWLQJLPSURYHPHQWVDQGQRWRWKHUZLVHDVFHUWDLQDEOH E\&RQWUDFWRUWKURXJKWKHH[HUFLVHRIGXHGLOLJHQFHLQWKHSHUIRUPDQFHRILWVLQVSHFWLRQREOLJDWLRQVLQ WKH&RQWUDFW'RFXPHQWVHQFRXQWHUHGE\&RQWUDFWRULQGLJJLQJWUHQFKHVRURWKHUH[FDYDWLRQV V WKDW H[WHQGGHHSHUWKDQIRXUIHHWEHORZWKHVXUIDFHRIWKHJURXQGWKDWFRQVWLWXWH 0DWHULDOWKDWWKH&RQWUDFWRUEHOLHYHVPD\EHPDWHULDOWKDWLVKD]DUGRXVZDVWHDVGHILQHGLQ6HFWLRQ RIWKH+HDOWKDQG6DIHW\&RGHZKLFKLVUHTXLUHGWREHUHPRYHGWRD&ODVV,&ODVV,,RU &ODVV,,,GLVSRVDOVLWHLQDFFRUGDQFHZLWKSURYLVLRQVRIH[LVWLQJODZ 6XEVXUIDFHRUODWHQWSK\VLFDOFRQGLWLRQVDWWKHVLWHGLIIHULQJPDWHULDOO\IURPWKRVHLQGLFDWHGLQWKHVH &RQWUDFW'RFXPHQWV 8QNQRZQSK\VLFDOFRQGLWLRQVDWWKHVLWHRIDQ\XQXVXDOQDWXUHGLIIHUHQWPDWHULDOO\IURPWKRVH RUGLQDULO\HQFRXQWHUHGDQGJHQHUDOO\UHFRJQL]HGDVLQKHUHQWLQ:RUNRIWKHFKDUDFWHUSURYLGHGIRU LQWKHVH&RQWUDFW'RFXPHQWV % 1RWLFHE\&RQWUDFWRU ,IWKH&RQWUDFWRUHQFRXQWHUVFRQGLWLRQVLWEHOLHYHVFRQVWLWXWH'LIIHULQJ6LWH &RQGLWLRQVWKHQQRWLFHRIVXFKFRQGLWLRQVVKDOOEHIRUHVXFKFRQGLWLRQVDUHGLVWXUEHGEHSURPSWO\ UHSRUWHGWRWKH'LUHFWRUIROORZHGZLWKLQWZHQW\IRXU KRXUVE\DIXUWKHUZULWWHQQRWLFHVWDWLQJD GHWDLOHGGHVFULSWLRQRIWKHFRQGLWLRQVHQFRXQWHUHG & 7KH'LUHFWRUZLOOSURPSWO\LQYHVWLJDWHWKHFRQGLWLRQVDQG,IKHVKHILQGVWKDWVXFKFRQGLWLRQVGR PDWHULDOO\GLIIHURUGRLQYROYHKD]DUGRXVZDVWHDQGGRFDXVHDQLQFUHDVHRUGHFUHDVHLQWKH &RQWUDFWRU VFRVWRIRUWLPHUHTXLUHGIRUSHUIRUPDQFHRIDQ\SDUWRIWKH:RUNXQGHUWKLV&RQWUDFWDQ HTXLWDEOHDGMXVWPHQWZLOOEHPDGHDVGHWHUPLQHGE\WKH'LUHFWRU ' &KDQJH2UGHU5HTXHVW,I&RQWUDFWRULQWHQGVWRVHHNDQDGMXVWPHQWWRWKH&RQWUDFW6XPRU&RQWUDFW 7LPHEDVHGXSRQ'LIIHULQJ6LWH&RQGLWLRQVLWPXVWZLWKLQWHQ 'D\VDIWHUWKH'LVFRYHU\'DWHUHODWLYH WRVXFKFRQGLWLRQVVXEPLWD&KDQJH2UGHU5HTXHVWVHWWLQJIRUWKDGHWDLOHGFRVWEUHDNGRZQDQG7LPH ,PSDFW$QDO\VLVLQWKHIRUPUHTXLUHGE\$UWLFOHRIWKHVH*HQHUDO&RQGLWLRQVRIWKHDGGLWLRQDO $OORZDEOH&RVWVDQG([FXVDEOH'HOD\UHVXOWLQJIURPVXFK'LIIHULQJ6LWH&RQGLWLRQV ( )DLOXUHWR&RPSO\)DLOXUHE\&RQWUDFWRUWRVWULFWO\FRPSO\ZLWKWKHUHTXLUHPHQWVRIWKLV3DUDJUDSK Western Allied Corporation Page 74 of 221 . . Item 10 Page 74 of 221 FRQFHUQLQJWKHWLPLQJDQGFRQWHQWRIDQ\QRWLFHRI'LIIHULQJ6LWH&RQGLWLRQVRUUHTXHVWIRU DGMXVWPHQWLQ&RQWUDFW6XPRU&RQWUDFW7LPHEDVHGRQ'LIIHULQJ6LWH&RQGLWLRQVVKDOOEHGHHPHG ZDLYHURIDQ\ULJKWE\WKH&RQWUDFWRUIRUDQDGMXVWPHQWLQWKH&RQWUDFW6XPRU&RQWUDFW7LPHE\UHDVRQ RIVXFKFRQGLWLRQV ) )LQDO&RPSOHWLRQ 1RFODLPE\WKH&RQWUDFWRUIRUDGGLWLRQDOFRPSHQVDWLRQIRU'LIIHULQJ6LWH&RQGLWLRQV VKDOOEHDOORZHGLIDVVHUWHGDIWHU)LQDO3D\PHQW * ,QWKHHYHQWRIGLVDJUHHPHQWEHWZHHQWKH&RQWUDFWRUDQGWKH'LUHFWRUZKHWKHUWKHFRQGLWLRQVGR PDWHULDOO\GLIIHURUZKHWKHUDKD]DUGRXVZDVWHLVLQYROYHGRUZKHWKHUWKHFRQGLWLRQVFDXVHDQLQFUHDVH RUGHFUHDVHLQWKH&RQWUDFWRU VFRVWRIRUWLPHUHTXLUHGIRUSHUIRUPDQFHRIDQ\SDUWRIWKH:RUNWKH &RQWUDFWRUVKDOOQRWEHH[FXVHGIURPDQ\FRPSOHWLRQGDWHUHTXLUHGE\WKH&RQWUDFWEXWVKDOOSURFHHG ZLWKDOO:RUNWREHSHUIRUPHGXQGHUWKH&RQWUDFW'RFXPHQWV + 7KH&RQWUDFWRUVKDOOUHWDLQDOOULJKWVSURYLGHGE\DQGVKDOOEHVXEMHFWWRDOOUHTXLUHPHQWVRIWKLV &RQWUDFWZKLFKSHUWDLQWRWKHUHVROXWLRQRIGLVSXWHVDQGSURWHVWV , &RQWUDFWRU5HVSRQVLELOLW\ ([FHSWDVRWKHUZLVHSURYLGHGLQWKLV3DUDJUDSKIRU'LIIHULQJ6LWH &RQGLWLRQV&RQWUDFWRUDJUHHVWRVROHO\EHDUWKHULVNRIDGGLWLRQDOFRVWDQG'HOD\GXHWRFRQFHDOHGRU XQNQRZQFRQGLWLRQVVXUIDFHRUVXEVXUIDFHDWWKH6LWHRULQ([LVWLQJ,PSURYHPHQWVZLWKRXWDGMXVWPHQW WRWKH&RQWUDFW6XPRU&RQWUDFW7LPH 75$)),&5(*8/$7,21 $ 'XULQJWKHSHUIRUPDQFHRIWKH:RUNWKH&RQWUDFWRUVKDOOHUHFWDQGPDLQWDLQQHFHVVDU\WHPSRUDU\ IHQFHVEULGJHVUDLOLQJVOLJKWVVLJQDOVEDUULHUVRURWKHUVDIHJXDUGVDVVKDOOEHDSSURSULDWHXQGHUWKH FLUFXPVWDQFHLQKLVKHUMXGJPHQWIRUWKHSUHYHQWLRQRIDFFLGHQWV DQGKHVKHVKDOO WDNHRWKHU SUHFDXWLRQVDVQHFHVVDU\IRUSXEOLFVDIHW\LQFOXGLQJEXWQRWOLPLWHGWRWUDIILFFRQWURO 7UDIILFFRQWURO VKDOOEHFRQGXFWHGLQDFFRUGDQFHZLWKWKHODWHVWHGLWLRQRIWKH&DOLIRUQLD0DQXDORQ8QLIRUP7UDIILF &RQWURO'HYLFHV 087&' SXEOLVKHGE\%1L%RRNVDQGDVGLUHFWHGDQGDSSURYHGE\WKH&LW\ (QJLQHHU % &RQWUDFWRUVKDOOVXEPLWDWOHDVWWHQ :RUNLQJ'D\VSULRUWR:RUNDGHWDLOHGWUDIILFFRQWUROSODQWKDW LV DSSURYHG E\ DOO DJHQFLHV KDYLQJ MXULVGLFWLRQ DQG WKDW FRQIRUPV WR DOO UHTXLUHPHQWV RI WKH 6SHFLILFDWLRQV & 1RFKDQJHVRUGHYLDWLRQVIURPWKHDSSURYHGGHWDLOHGWUDIILFFRQWUROSODQVKDOOEHPDGHH[FHSW WHPSRUDU\FKDQJHVLQHPHUJHQF\VLWXDWLRQVZLWKRXWSULRUDSSURYDORIWKH&LW\(QJLQHHUDQGDOO DJHQFLHVKDYLQJMXULVGLFWLRQ &RQWUDFWRUVKDOOLPPHGLDWHO\QRWLI\WKH'LUHFWRUWKH&LW\(QJLQHHUDQGWKHDJHQFLHVKDYLQJMXULVGLFWLRQ RIRFFXUUHQFHVWKDWQHFHVVLWDWHPRGLILFDWLRQRIWKHDSSURYHGWUDIILFFRQWUROSODQ ' &RQWUDFWRU¶VIDLOXUHWRFRPSO\ZLWKWKLVSURYLVLRQPD\UHVXOWLQDFWLRQVDVSURYLGHGLQ$UWLFOH ³6XVSHQVLRQRU7HUPLQDWLRQRI&RQWUDFW´RIWKHVH*HQHUDO&RQGLWLRQV 75$)),&&21752/'(9,&(6 $ 7UDIILFVLJQVIODVKLQJOLJKWVEDUULFDGHVDQGRWKHUWUDIILFVDIHW\GHYLFHVXVHGWRFRQWUROWUDIILFVKDOO FRQIRUPWRWKHUHTXLUHPHQWVRIWKH&DOLIRUQLD0DQXDORQ8QLIRUP7UDIILF&RQWURO'HYLFHV 087&' Western Allied Corporation Page 75 of 221 . . Item 10 Page 75 of 221 DQGDVDSSURYHGE\WKH&LW\(QJLQHHU 3RUWDEOHVLJQDOVVKDOOQRWEHXVHGXQOHVVSHUPLVVLRQLVJLYHQLQZULWLQJE\WKHDJHQF\KDYLQJ MXULVGLFWLRQ :DUQLQJVLJQVXVHGIRUQLJKWWLPHFRQGLWLRQVVKDOOEHUHIOHFWRUL]HGRULOOXPLQDWHG 5HIOHFWRUL]HG VLJQVVKDOOKDYHDUHIOHFWRUL]HGEDFNJURXQGDQGVKDOOFRQIRUPWRWKHFXUUHQW6WDWHRI&DOLIRUQLD 'HSDUWPHQWRI7UDQVSRUWDWLRQVSHFLILFDWLRQIRUUHIOHFWLYHVKHHWLQJRQKLJKZD\VLJQV % ,IWKH&RQWUDFWRUIDLOVWRSURYLGHDQGLQVWDOODQ\RIWKHVLJQVRUWUDIILFFRQWUROGHYLFHVUHTXLUHGKHUE\RU RUGHUHGE\WKH&LW\VWDIIVWDIIPD\FDXVHVXFKVLJQVRUWUDIILFFRQWUROGHYLFHVWREHSODFHGE\RWKHUV FKDUJHWKHFRVWVWKHUHIRUHDJDLQVWWKH&RQWUDFWRUDQGGHGXFWWKHVDPHIURPWKHQH[WSURJUHVV SD\PHQW (;(&87,21 $ 7KH&RQWUDFWRUVKDOOSURYLGHZULWWHQQRWLILFDWLRQWRWKH3ROLFH'HSDUWPHQW7UDIILF%XUHDX DWOHDVWWZR ZHHNVSULRUWRWKHEHJLQQLQJRIFRQVWUXFWLRQDWDQ\SDUWLFXODUORFDWLRQ1RWLILFDWLRQ ZLOOLQFOXGHWKHVSHFLILFORFDWLRQSURMHFWGDWHVZKDWODQHVRIWKHURDGZD\ZLOOEHFORVHGDQGZKHQ$OVR WKHFRQVWUXFWLRQSURMHFWPDQDJHU¶VQDPHDQGEXVLQHVVSKRQHQXPEHUDQGWKHFRQVWUXFWLRQLQVSHFWRU¶V QDPHDQGEXVLQHVVSKRQHQXPEHU % 7KH&RQWUDFWRUVKDOOQRWLI\E\WHOHSKRQHWKH3ROLFH'HSDUWPHQW DWWKHFRPSOHWLRQRI DQ\SRVWLQJRIWHPSRUDU\QRSDUNLQJVLJQV 1RWLILFDWLRQZLOOLQFOXGHWKHWLPHVGDWHVDQGORFDWLRQVRI WKHSRVWLQJ:KHQYHKLFOHVPXVWEHWRZHGIRUYLRODWLRQRIWHPSRUDU\QRSDUNLQJVLJQVWKHSHUVRQZKR DFWXDOO\SRVWHGWKHVLJQVRURQYLHZVXSHUYLVRURIWKDWSRVWLQJZLOOEHSUHVHQWWRDQVZHUSHUWLQHQW TXHVWLRQVWKDWPD\EHDVNHGE\WKHSDUNLQJHQIRUFHPHQWRIILFHURUSROLFHRIILFHUWRZLQJWKHYHKLFOHV & 7KH&RQWUDFWRUVKDOOQRWLI\WKH)LUH'HSDUWPHQWRQDGDLO\EDVLVGXULQJWKHHQWLUHSHULRGWKDW FRQVWUXFWLRQLVLQSURJUHVVZKHQHYHUURDGZD\VDUHUHGXFHGLQZLGWKRUEORFNHG1RWLILFDWLRQVKDOOEH PDGHWRWKH)LUH'LVSDWFK DQGWKH&RQWUDFWRUVKDOOSURYLGHWKHLQIRUPDWLRQUHTXLUHGWR LGHQWLI\ZKLFKURDGZD\VZRXOGKDYHDFFHVVLELOLW\SUREOHPVGXHWRKLVKHURSHUDWLRQV7KH&RQWUDFWRU VKDOOVXEPLWWR)LUH'HSDUWPHQWVFKHGXOHRI:RUNIRUWKHLUXVHDQGILOHV ' 5RDGVVXEMHFWWRLQWHUIHUHQFHIURPWKH:RUNFRYHUHGE\WKLV&RQWUDFWVKDOOEHNHSWRSHQDQGWKH IHQFHVVXEMHFWWRLQWHUIHUHQFHVKDOOEHNHSWXSE\WKH&RQWUDFWRUXQWLOWKH:RUNLVILQLVKHG ([FHSW ZKHUHSXEOLFURDGVKDYHEHHQDSSURYHGIRUFORVXUHWUDIILFVKDOOEHSHUPLWWHGWRSDVVWKURXJK GHVLJQDWHGWUDIILFODQHVZLWKDVOLWWOHLQFRQYHQLHQFHDQGGHOD\DVSRVVLEOH ( :KHUHDOWHUQDWLQJRQHZD\WUDIILFKDVEHHQDXWKRUL]HGWKHPD[LPXPWLPHWKDWWUDIILFZLOOEHGHOD\HG VKDOOEHSRVWHGDWHDFKHQGRIWKHRQHZD\WUDIILFVHFWLRQ 7KHPD[LPXPGHOD\WLPHVKDOOEHDSSURYHG E\WKHDJHQF\KDYLQJMXULVGLFWLRQ ) &RQWUDFWRUVKDOOLQVWDOOWHPSRUDU\WUDIILFPDUNLQJVZKHUHUHTXLUHGWRGLUHFWWKHIORZRIWUDIILFDQGVKDOO PDLQWDLQWKHWUDIILFPDUNLQJVIRUWKHGXUDWLRQRIQHHG&RQWUDFWRUVKDOOUHPRYHWKHPDUNLQJVE\DEUDVLYH EODVWLQJZKHQQRORQJHUUHTXLUHG * &RQYHQLHQWDFFHVVWRGULYHZD\VDQGEXLOGLQJVLQWKHYLFLQLW\RI:RUNVKDOOEHPDLQWDLQHGDVPXFKDV SRVVLEOH7HPSRUDU\DSSURDFKHVWRDQGFURVVLQJRILQWHUVHFWLQJWUDIILFODQHVVKDOOEHSURYLGHGDQG Western Allied Corporation Page 76 of 221 . . Item 10 Page 76 of 221 NHSWLQJRRGFRQGLWLRQ + :KHQOHDYLQJD:RUNDUHDDQGHQWHULQJDURDGZD\FDUU\LQJSXEOLFWUDIILFWKH&RQWUDFWRU VHTXLSPHQW ZKHWKHUHPSW\RUORDGHGVKDOOLQDOOFDVHV\LHOGWRSXEOLFWUDIILF )/$**,1* $ &RQWUDFWRUVKDOOSURYLGHIODJJHUVWRFRQWUROWUDIILFZKHUHUHTXLUHGE\WKHDSSURYHGWUDIILFFRQWUROSODQ )ODJJHUVVKDOOSHUIRUPWKHLUGXWLHVDQGVKDOOEHSURYLGHGZLWKWKHQHFHVVDU\HTXLSPHQWLQ DFFRUGDQFHZLWKWKHFXUUHQW,QVWUXFWLRQVWR)ODJJHUVRIWKH6WDWHRI&DOLIRUQLD'HSDUWPHQWRI 7UDQVSRUWDWLRQ )ODJJHUVVKDOOEHHPSOR\HGIXOOWLPHRQWUDIILFFRQWURODQGVKDOOKDYHQRRWKHUGXWLHV 3('(675,$1&$123,(625%$55,&$'(,03529(0(176 5HIHUWR&LW\RI9HUQRQIRUUHTXLUHPHQWVIRUEXLOGLQJRUDFFHVVURDGVDIHW\LPSURYHPHQWVWKDWWKH&RQWUDFWRU VKDOOFRQVWUXFWGXULQJFRQVWUXFWLRQSHULRG 7KHVHGHYLFHVRULPSURYHPHQWVDVWKH&LW\GHHPVQHFHVVDU\RU SUXGHQWVKDOOEHDWWKHH[SHQVHRIWKH&RQWUDFWRU >(1'2)$57,&/(@ Western Allied Corporation Page 77 of 221 . . Item 10 Page 77 of 221 ,1'(01,7< ARTICLE 11 - INDEMNITY 7RWKHPD[LPXPH[WHQWSHUPLWWHGE\ODZWKH&RQWUDFWRUVKDOOIXOO\LQGHPQLI\KROGKDUPOHVVSURWHFWDQGGHIHQG WKH&LW\LWVRIILFHUVHPSOR\HHVDJHQWVUHSUHVHQWDWLYHVDQGWKHLUVXFFHVVRUVDQGDVVLJQV ³,QGHPQLWHHV´ IURP DQGDJDLQVWDQ\DQGDOOGHPDQGVOLDELOLW\ORVVVXLWFODLPDFWLRQFDXVHRIDFWLRQGDPDJHFRVWMXGJPHQW VHWWOHPHQWGHFUHHDUELWUDWLRQDZDUGVWRSQRWLFHSHQDOW\ORVVRIUHYHQXHDQGH[SHQVH LQFOXGLQJDQ\IHHVRI DFFRXQWDQWVDWWRUQH\VH[SHUWVRURWKHUSURIHVVLRQDOVDQGFRVWVRILQYHVWLJDWLRQPHGLDWLRQDUELWUDWLRQOLWLJDWLRQ DQGDSSHDO LQODZRULQHTXLW\RIHYHU\NLQGDQGQDWXUHZKDWVRHYHUDULVLQJRXWRIRULQFRQQHFWLRQZLWKUHVXOWLQJ IURPRUUHODWHGWRRUFODLPHGWREHDULVLQJRXWRIWKH:RUNSHUIRUPHGE\&RQWUDFWRURUDQ\RILWVRIILFHUVDJHQWV HPSOR\HHV6XEFRQWUDFWRUV6XE6XEFRQWUDFWRUVGHVLJQFRQVXOWDQWVRUDQ\SHUVRQIRUZKRVHDFWVDQ\RIWKHP PD\EHOLDEOHUHJDUGOHVVRIZKHWKHUVXFKFODLPVXLWRUGHPDQGLVFDXVHGRUDOOHJHGWREHFDXVHGLQSDUWE\ DQ,QGHPQLWHHLQFOXGLQJEXWQRWOLPLWHGWR $ %RGLO\LQMXU\HPRWLRQDOLQMXU\VLFNQHVVRUGLVHDVHRUGHDWKWRDQ\SHUVRQV % ,QIULQJHPHQWRIDQ\SDWHQWULJKWVOLFHQVHVFRS\ULJKWVRULQWHOOHFWXDOSURSHUW\ZKLFKPD\EHEURXJKW DJDLQVWWKH&RQWUDFWRURU&LW\DULVLQJRXWRI&RQWUDFWRU¶V:RUNIRUZKLFKWKH&RQWUDFWRULVUHVSRQVLEOH & 6WRSQRWLFHVDQGFODLPVIRUODERUSHUIRUPHGRUPDWHULDOVXVHGRUIXUQLVKHGWREHXVHGLQWKH:RUN LQFOXGLQJDOOLQFLGHQWDORUFRQVHTXHQWLDOGDPDJHVUHVXOWLQJWR&LW\IURPVXFKVWRSQRWLFHVDQGFODLPV ' )DLOXUHRI&RQWUDFWRURULWV6XEFRQWUDFWRUVWRFRPSO\ZLWKWKHSURYLVLRQVIRULQVXUDQFH ( )DLOXUHWRFRPSO\ZLWKDQ\*RYHUQPHQWDO$SSURYDORUVLPLODUDXWKRUL]DWLRQRURUGHU ) 0LVUHSUHVHQWDWLRQPLVVWDWHPHQWRURPLVVLRQZLWKUHVSHFWWRDQ\VWDWHPHQWPDGHLQRUDQ\GRFXPHQW IXUQLVKHGE\WKH&RQWUDFWRULQFRQQHFWLRQWKHUHZLWK * %UHDFKRIDQ\GXW\REOLJDWLRQRUUHTXLUHPHQWXQGHUWKH&RQWUDFW'RFXPHQWV + )DLOXUHWRSURYLGHQRWLFHWRDQ\3DUW\DVUHTXLUHGXQGHUWKH&RQWUDFW'RFXPHQWV , )DLOXUHWRSURWHFWWKHSURSHUW\RIDQ\XWLOLW\SURYLGHURUDGMDFHQWSURSHUW\RZQHU RU - )DLOXUHWRPDNHSD\PHQWRIDOOHPSOR\HHEHQHILWV 7KLVLQGHPQLW\SURYLVLRQLVHIIHFWLYHUHJDUGOHVVRIDQ\SULRUFRQFXUUHQWRUVXEVHTXHQWDFWLYHRUSDVVLYH QHJOLJHQFHE\,QGHPQLWHHVH[FHSWWKDWWRWKHOLPLWHGH[WHQWPDQGDWHGE\&DOLIRUQLD&LYLO&RGH6HFWLRQ WKH&RQWUDFWRUVKDOOQRWEHUHVSRQVLEOHIRUOLDELOLWLHVZKLFKDULVHIURPWKHVROHQHJOLJHQFHRUZLOOIXOPLVFRQGXFWRI ,QGHPQLWHHVRUDULVHIURPWKHDFWLYHQHJOLJHQFHRI&LW\ (1)25&(0(17 &RQWUDFWRU¶VREOLJDWLRQVXQGHUWKLV$UWLFOHH[WHQGWRFODLPVRFFXUULQJDIWHUWHUPLQDWLRQRIWKH&RQWUDFWRU¶V SHUIRUPDQFHRIWKH&RQWUDFWRU)LQDO3D\PHQWWR&RQWUDFWRU7KHREOLJDWLRQVDSSO\UHJDUGOHVVRIDQ\DFWXDORU DOOHJHGQHJOLJHQWDFWRURPLVVLRQRI,QGHPQLWHHV &RQWUDFWRUKRZHYHUVKDOOQRWEHREOLJDWHGXQGHUWKLV $JUHHPHQWWRLQGHPQLI\DQ,QGHPQLWHHIRUFODLPVDULVLQJIURPWKHVROHDFWLYHQHJOLJHQFHRUZLOOIXOPLVFRQGXFWRI WKH,QGHPQLWHHRULQGHSHQGHQWFRQWUDFWRUVZKRDUHGLUHFWO\UHVSRQVLEOHWR,QGHPQLWHHV&RQWUDFWRU¶VREOLJDWLRQV XQGHUWKLV$UWLFOHDUHLQDGGLWLRQWRDQ\RWKHUULJKWVRUUHPHGLHVZKLFKWKH,QGHPQLWHHVPD\KDYHXQGHUWKHODZ Western Allied Corporation Page 78 of 221 . . Item 10 Page 78 of 221 RUXQGHUWKH&RQWUDFW'RFXPHQWV,QWKHHYHQWRIDQ\FODLPVXLWRUGHPDQGPDGHDJDLQVWDQ\,QGHPQLWHHVWKH &LW\PD\LQLWVVROHGLVFUHWLRQUHVHUYHUHWDLQRUDSSO\DQ\PRQLHVGXHWRWKH&RQWUDFWRUXQGHUWKH&RQWUDFWIRU WKHSXUSRVHRIUHVROYLQJVXFKFODLPV SURYLGHGKRZHYHUWKDWWKH&LW\PD\UHOHDVHVXFKIXQGVLIWKH&RQWUDFWRU SURYLGHVWKH&LW\ZLWKUHDVRQDEOHDVVXUDQFHRISURWHFWLRQRIWKH&LW\¶VLQWHUHVWV 7KH&LW\VKDOOLQLWVVROH GLVFUHWLRQGHWHUPLQHZKHWKHUVXFKDVVXUDQFHVDUHUHDVRQDEOH 12/,0,7$7,216 &RQWUDFWRU¶VLQGHPQLILFDWLRQDQGGHIHQVHREOLJDWLRQVVHWIRUWKLQWKLV$UWLFOHDUHVHSDUDWHDQGLQGHSHQGHQWIURP WKHLQVXUDQFHSURYLVLRQVVHWIRUWKLQ$UWLFOHKHUHLQ DQGGRQRWOLPLWLQDQ\ZD\WKHDSSOLFDELOLW\VFRSHRU REOLJDWLRQVVHWIRUWKLQWKRVHLQVXUDQFHSURYLVLRQV,QFODLPVVXLWVRUGHPDQGVDJDLQVWDQ\,QGHPQLWHHE\DQ HPSOR\HHRIWKH&RQWUDFWRUD6XEFRQWUDFWRUDQ\RQHGLUHFWO\RULQGLUHFWO\HPSOR\HGE\WKHPRUDQ\RQHIRU ZKRVHDFWVWKH\PD\EHOLDEOHWKH&RQWUDFWRU¶VLQGHPQLILFDWLRQDQGGHIHQVHREOLJDWLRQVVKDOOQRWEHOLPLWHGE\ DOLPLWDWLRQRQDPRXQWRUW\SHRIGDPDJHVFRPSHQVDWLRQRUEHQHILWVSD\DEOHE\RUIRUWKH&RQWUDFWRURUD 6XEFRQWUDFWRUXQGHUZRUNHUV¶FRPSHQVDWLRQDFWVGLVDELOLW\EHQHILWVDFWVRURWKHUHPSOR\HHEHQHILWVDFWV >(1'2)$57,&/(@ Western Allied Corporation Page 79 of 221 . . Item 10 Page 79 of 221 ARTICLE 12 – INSURANCE &21',7,2172&200(1&(0(17 &RQWUDFWRUVKDOOQRWFRPPHQFH:RUNXQGHUWKLV&RQWUDFWXQWLO&RQWUDFWRUKDVREWDLQHGDOOLQVXUDQFHUHTXLUHG KHUHXQGHUIURPDFRPSDQ\RUFRPSDQLHVDFFHSWDEOHWR&LW\QRUVKDOOWKH&RQWUDFWRUDOORZDQ\6XEFRQWUDFWRU WRFRPPHQFH:RUNRQDVXEFRQWUDFWXQWLODOOLQVXUDQFHUHTXLUHGRIVDLG6XEFRQWUDFWRUKDVEHHQREWDLQHG3URRI RILQVXUDQFHLQFOXGLQJLQVXUDQFHFHUWLILFDWHVDQGHQGRUVHPHQWVDVVHWIRUWKLQ([KLELWPXVWEHVXEPLWWHGE\ WKH&RQWUDFWRUSULRUWRWKH&LW\¶VH[HFXWLRQRIWKH&RQWUDFW 0,1,080&29(5$*($1'/,0,76 &RQWUDFWRUVKDOOPDLQWDLQWKHLQVXUDQFHFRYHUDJHDVVHWIRUWKLQ([KLELWWKURXJKRXWWKHWHUPRIWKH&RQWUDFW &21',7,2165(*$5',1*,1685$1&(&29(5$*($1'/,0,76 &LW\DQG&RQWUDFWRUDJUHHDVIROORZV $ $OOLQVXUDQFHFRYHUDJHDQGOLPLWVSURYLGHGSXUVXDQWWRWKH&RQWUDFW'RFXPHQWVVKDOODSSO\WRWKHIXOO H[WHQWRIWKHSROLFLHVLQYROYHGDYDLODEOHRUDSSOLFDEOH1RWKLQJFRQWDLQHGLQWKH&RQWUDFW'RFXPHQWV RUDQ\RWKHUDJUHHPHQWUHODWLQJWR&LW\RULWVRSHUDWLRQVOLPLWVWKHDSSOLFDWLRQRIVXFKLQVXUDQFH FRYHUDJH % 1RQHRIWKHSROLFLHVUHTXLUHGE\WKLV&RQWUDFWVKDOOEHLQFRPSOLDQFHZLWKWKHVHUHTXLUHPHQWVLIWKH\ LQFOXGHDQ\OLPLWLQJHQGRUVHPHQWWKDWKDVQRWEHHQILUVWVXEPLWWHGWR&LW\DQGDSSURYHGLQZULWLQJE\ WKH&LW\¶V5LVN0DQDJHU ,1685$1&(2%/,*$7,21,66(3$5$7()520,1'(01,7<2%/,*$7,21 7KLV$JUHHPHQW¶VLQVXUDQFHSURYLVLRQV $ $UHVHSDUDWHDQGLQGHSHQGHQWIURPWKHLQGHPQLILFDWLRQDQGGHIHQVHSURYLVLRQVLQ$UWLFOHRIWKH $JUHHPHQW DQG % 'RQRWOLPLWLQDQ\ZD\WKHDSSOLFDELOLW\VFRSHRUREOLJDWLRQVRIWKHLQGHPQLILFDWLRQDQGGHIHQVH SURYLVLRQVLQ$UWLFOHRIWKH$JUHHPHQW >(1'2)$57,&/(@ Western Allied Corporation Page 80 of 221 . . Item 10 Page 80 of 221 5(48,5('%21'6 ARTICLE 13 – BONDS $ &RQWUDFWRUVKDOOIXUQLVKWKHIROORZLQJERQGV $3HUIRUPDQFH%RQGLQDQDPRXQWHTXDOWRRQHKXQGUHGSHUFHQW RIWKHWRWDO&RQWUDFWSULFH LQWKHIRUPVKRZQLQ([KLELWDWWDFKHGKHUHWR $3D\PHQW%RQG /DERUDQG0DWHULDO LQDQDPRXQWHTXDOWRRQHKXQGUHGSHUFHQW RIWKH WRWDO&RQWUDFWSULFHLQWKHIRUPVKRZQLQ([KLELWDWWDFKHGKHUHWR $0DLQWHQDQFH%RQGLQDQDPRXQWHTXDOWRWHQSHUFHQW RIWKHWRWDO&RQWUDFWSULFHLQWKH IRUPVKRZQLQ([KLELWDWWDFKHGKHUHWR 32:(52)$77251(< $OOERQGVVKDOOEHDFFRPSDQLHGE\DSRZHURIDWWRUQH\IURPWKHVXUHW\FRPSDQ\DXWKRUL]LQJWKHSHUVRQ H[HFXWLQJWKHERQGWRVLJQRQEHKDOIRIWKHFRPSDQ\,IWKHERQGVDUHH[HFXWHGRXWVLGHWKH6WDWHRI&DOLIRUQLD DOOFRSLHVRIWKHERQGVPXVWEHFRXQWHUVLJQHGE\D&DOLIRUQLDUHSUHVHQWDWLYHRIWKHVXUHW\7KHVLJQDWXUHRIWKH SHUVRQH[HFXWLQJWKHERQGRQEHKDOIRI6XUHW\VKDOOEHDFNQRZOHGJHGE\D1RWDU\3XEOLFDVWKHVLJQDWXUHRIWKH SHUVRQGHVLJQDWHGLQWKHSRZHURIDWWRUQH\ $33529('685(7< $OOERQGVPXVWEHLVVXHGE\D&DOLIRUQLDDGPLWWHGVXUHW\LQVXUHUZLWKWKHPLQLPXP$0%HVW&RPSDQ\ )LQDQFLDOVWUHQJWKUDWLQJRI³$ 9,,´RUEHWWHU %RQGVLVVXHGE\D&DOLIRUQLDDGPLWWHGVXUHW\QRWOLVWHGRQ 7UHDVXU\&LUFXODUZLOOEHGHHPHGDFFHSWHGXQOHVVVSHFLILFDOO\UHMHFWHGE\WKH&LW\ %RQGVLVVXHGIURP DGPLWWHG VXUHW\ LQVXUHUV QRW OLVWHG LQ 7UHDVXU\ &LUFXODU PXVW EH DFFRPSDQLHG E\ DOO GRFXPHQWV HQXPHUDWHGLQ&DOLIRUQLD&RGHRI&LYLO3URFHGXUH6HFWLRQ $OOVXFKERQGVPXVWEHDFFRPSDQLHGE\ DSRZHURIDWWRUQH\IURPWKHVXUHW\FRPSDQ\DXWKRUL]LQJWKHSHUVRQH[HFXWLQJWKHERQGWRVLJQRQEHKDOIRI WKHFRPSDQ\ ,IWKHERQGVDUHH[HFXWHGRXWVLGHWKH6WDWHRI&DOLIRUQLDDOOFRSLHVRIWKHERQGVPXVWEH FRXQWHUVLJQHGE\D&DOLIRUQLDUHSUHVHQWDWLYHRIWKHVXUHW\ 7KHVLJQDWXUHRIWKHSHUVRQH[HFXWLQJWKHERQG RQEHKDOIRI6XUHW\PXVWEHDFNQRZOHGJHGE\D1RWDU\3XEOLFDVWKHVLJQDWXUHRIWKHSHUVRQGHVLJQDWHGLQ WKHSRZHURIDWWRUQH\ 5(48,5('3529,6,216 (YHU\ERQGPXVWGLVSOD\WKHVXUHW\¶VERQGQXPEHUDQGLQFRUSRUDWHWKH&RQWUDFWIRUFRQVWUXFWLRQRIWKH:RUNE\ UHIHUHQFH 7KHWHUPVRIWKHERQGVVKDOOSURYLGHWKDWWKHVXUHW\DJUHHVWKDWQRFKDQJHH[WHQVLRQRIWLPH DOWHUDWLRQRUPRGLILFDWLRQRIWKH&RQWUDFW'RFXPHQWVRUWKH:RUNWREHSHUIRUPHGWKHUHXQGHUVKDOOLQDQ\ZD\ DIIHFWLWVREOLJDWLRQVDQGVKDOOZDLYHQRWLFHRIDQ\VXFKFKDQJHH[WHQVLRQRIWLPHDOWHUDWLRQRUPRGLILFDWLRQRI WKH&RQWUDFW'RFXPHQWV 1(:25$'',7,21$/685(7,(6 ,IGXULQJWKHFRQWLQXDQFHRIWKH&RQWUDFWDQ\RIWKHVXUHWLHVLQWKHRSLQLRQRIWKH&LW\DUHRUEHFRPHQRQ UHVSRQVLEOHRURWKHUZLVHXQDFFHSWDEOHWR&LW\&LW\PD\UHTXLUHRWKHUQHZRUDGGLWLRQDOVXUHWLHVZKLFKWKH &RQWUDFWRUVKDOOIXUQLVKWRWKHVDWLVIDFWLRQRI&LW\ZLWKLQWHQ GD\VDIWHUQRWLFHDQGLQGHIDXOWWKHUHRIWKH &RQWUDFWPD\EHVXVSHQGHGDQGWKHPDWHULDOVPD\EHSXUFKDVHGRUWKH:RUNFRPSOHWHGDVSURYLGHGLQ$UWLFOH KHUHLQ Western Allied Corporation Page 81 of 221 . . Item 10 Page 81 of 221 :$,9(52)02',),&$7,216$1'$/7(5$7,216 1RPRGLILFDWLRQVRUDOWHUDWLRQVPDGHLQWKH:RUNWREHSHUIRUPHGXQGHUWKH&RQWUDFWRUWKHWLPHRISHUIRUPDQFH VKDOORSHUDWHWRUHOHDVHDQ\VXUHW\IURPOLDELOLW\RQDQ\ERQGRUERQGVUHTXLUHGWREHJLYHQKHUHLQ 1RWLFHRI VXFKHYHQWVVKDOOEHZDLYHGE\WKHVXUHW\ $33529$/2)%21'6 7KH&RQWUDFWZLOOQRWEHH[HFXWHGE\&LW\QRUWKH1RWLFHWR3URFHHGLVVXHGXQWLOWKHUHTXLUHGERQGVKDYHEHHQ UHFHLYHGDQGDSSURYHGE\&LW\ &LW\ VGHFLVLRQDVWRWKHDFFHSWDELOLW\RIDOOVXUHWLHVDQGERQGVLVILQDO 1R VXEVWLWXWLRQRIWKHIRUPRIWKHGRFXPHQWVZLOOEHSHUPLWWHGZLWKRXWWKHSULRUZULWWHQFRQVHQWRI&LW\ >(1'2)$57,&/(@ Western Allied Corporation Page 82 of 221 . . Item 10 Page 82 of 221 :25.,1*+2856 ARTICLE 14 - LABOR PROVISIONS $ :RUNRUDFWLYLW\RIDQ\NLQGVKDOOEHOLPLWHGWRWKHKRXUVIURP DPWR SP 1RFRQVWUXFWLRQ QRLVHVKDOOEHSHUPLWWHGEHWZHHQWKHKRXUVRI SPDQG DPRIWKHQH[WGD\ % :RUNLQH[FHVVRIHLJKW KRXUVSHUGD\RQ6DWXUGD\V6XQGD\VRURQ&LW\KROLGD\VUHTXLUHVSULRU FRQVHQWRIWKH'LUHFWRUDQGLVVXEMHFWWR&RVWRI2YHUWLPH&RQVWUXFWLRQ,QVSHFWLRQ & 1LJKW6XQGD\DQG+ROLGD\:RUN1R:RUNVKDOOEHSHUIRUPHGDWQLJKW6XQGD\RUWKHWHQ OHJDO KROLGD\VWRZLW 1HZ<HDU¶V'D\0DUWLQ/XWKHU.LQJ-U'D\3UHVLGHQW¶V'D\&HVDU&KDYH]'D\ 0HPRULDO 'D\ ,QGHSHQGHQFH 'D\ /DERU 'D\ ,QGLJHQRXV 3HRSOH¶V'D\ 9HWHUDQ¶V 'D\ 7KDQNVJLYLQJ'D\&KULVWPDV(YH&KULVWPDV'D\DQG1HZ<HDU¶V(YHH[FHSW:RUNSHUWDLQLQJWR WKHSXEOLFVDIHW\RUZLWKWKHSHUPLVVLRQRIWKH'LUHFWRUDQGDFFRUGDQFHZLWKVXFKUHJXODWLRQVDV KHVKHVKDOOIXUQLVKLQZULWLQJ %HIRUHSHUIRUPLQJDQ\:RUNDWVDLGWLPHVH[FHSW:RUNSHUWDLQLQJWR WKHSXEOLFVDIHW\WKH&RQWUDFWRUVKDOOJLYHZULWWHQQRWLFHWRWKH'LUHFWRUVRWKDWSURSHULQVSHFWLRQ PD\EHSURYLGHG³1LJKW´DVXVHGLQWKLVSDUDJUDSKVKDOOEHGHHPHGWRLQFOXGHWKHKRXUVIURP 30WR $0RIWKHQH[WVXFFHHGLQJGD\ &2672)29(57,0(&216758&7,216(59,&(6$1',163(&7,216 $ 2YHUWLPHFRQVWUXFWLRQ:RUNSHUIRUPHGDWWKHRSWLRQRIRUIRUWKHFRQYHQLHQFHRIWKH&RQWUDFWRUZLOO EHLQVSHFWHGE\WKH&LW\DWWKHH[SHQVHRIWKH&RQWUDFWRU)RUDQ\VXFKRYHUWLPHEH\RQGWKHUHJXODU KRXUGD\DQGIRUDQ\WLPHZRUNHGRQ6DWXUGD\6XQGD\RUKROLGD\VWKHFKDUJHVZLOOEHGHWHUPLQHG E\WKH&LW\DQGVXEPLWWHGWRWKH&RQWUDFWRUIRUSD\PHQW % (TXLSPHQWPDWHULDOVRUVHUYLFHVSURYLGHGE\WKH&LW\LQFRQQHFWLRQZLWK&RQWUDFWRULQLWLDWHGRYHUWLPH FRQVWUXFWLRQ:RUNGHVFULEHGLQ3DUDJUDSK $ ZLOODOVREHDWWKHH[SHQVHRIWKH&RQWUDFWRU 7KH FKDUJHVZLOOEHGHWHUPLQHGE\WKH&LW\DQGVXEPLWWHGWRWKH&RQWUDFWRUIRUSD\PHQW & 7KHUHZLOOEHQRFKDUJHVWRWKH&RQWUDFWRUIRUWKHLQVSHFWLRQRIRYHUWLPH:RUNRUGHUHGE\WKH'LUHFWRU RUUHTXLUHGE\WKH&RQWUDFW'RFXPHQWV &203/,$1&(:,7+67$7(/$%25&2'( $ &RQWUDFWRUVKDOOFRPSO\ZLWKWKHSURYLVLRQVRIWKH/DERU&RGHRIWKH6WDWHRI&DOLIRUQLDDQGDQ\ DPHQGPHQWVWKHUHRI 7KHWLPHRIVHUYLFHRIDQ\ZRUNHUHPSOR\HGXSRQWKH:RUNVKDOOEHOLPLWHGDQGUHVWULFWHGWRHLJKW KRXUVGXULQJDQ\RQHFDOHQGDUGD\DQGKRXUVGXULQJDQ\RQHFDOHQGDUZHHN :RUNSHUIRUPHGE\HPSOR\HHVRIWKH&RQWUDFWRULQH[FHVVRIHLJKW KRXUVSHUGD\DQGKRXUV GXULQJDQ\RQHFDOHQGDUZHHNVKDOOEHSHUPLWWHGXSRQFRPSHQVDWLRQIRUDOOKRXUVZRUNHGLQ H[FHVVRIHLJKW KRXUVSHUGD\DWQRWOHVVWKDQRQHDQGRQHKDOIWLPHVWKHEDVLFUDWHRISD\ 7KH&RQWUDFWRUDQGHYHU\6XEFRQWUDFWRUVKDOONHHSDQDFFXUDWHUHFRUGVKRZLQJWKHQDPHRIDQG WKHDFWXDOKRXUVZRUNHGHDFKFDOHQGDUGD\DQGHDFKFDOHQGDUZHHNE\HDFKZRUNHUHPSOR\HGE\ KLPKHULQFRQQHFWLRQZLWKWKH:RUN WKHUHFRUGVKDOOEHNHSWRSHQDWDOOUHDVRQDEOHKRXUVWRWKH LQVSHFWLRQRIWKH&LW\DQGWRWKH'LYLVLRQRI/DERU6WDQGDUGV(QIRUFHPHQWRIWKH6WDWHRI&DOLIRUQLD Western Allied Corporation Page 83 of 221 . . Item 10 Page 83 of 221 ,QWKHHYHQW&LW\GHHPV&RQWUDFWRULVLQYLRODWLRQRIWKLV3DUDJUDSKWKH&RQWUDFWRUVKDOODV DSHQDOW\IRUIHLW)LIW\'ROODUV IRUHDFKZRUNHUHPSOR\HGLQWKHH[HFXWLRQRIWKH&RQWUDFW E\WKH&RQWUDFWRURUE\DQ\6XEFRQWUDFWRUIRUHDFKFDOHQGDUGD\IRUZKLFKWKHHPSOR\HHZDV XQGHUSDLGLQDGGLWLRQWRDQDPRXQWVXIILFLHQWWRUHFRYHUXQGHUSDLGZDJHV)RUHDFKVXEVHTXHQW YLRODWLRQD RQHKXQGUHGGROODU SHQDOW\VKDOODSSO\IRUHDFKXQGHUSDLGHPSOR\HHIRUHDFK SD\SHULRGIRUZKLFKWKHHPSOR\HHZDVXQGHUSDLGLQDGGLWLRQWRDQDPRXQWVXIILFLHQWWRFRYHU XQGHUSDLGZDJHV7KLVVXESDUDJUDSKLVHIIHFWLYHWRWKHH[WHQWLWGRHVQRWGLUHFWO\FRQIOLFWZLWKWKH RYHUWLPHSHQDOW\SURYLVLRQRI&DOLIRUQLD/DERU&RGH6HFWLRQ,QWKHHYHQWRIVXFKFRQIOLFWWKH &DOLIRUQLD/DERU&RGHJRYHUQVRYHUWKLV3DUDJUDSK $ :$*(5$7(6 $ 3UHYDLOLQJ:DJHV &RQWUDFWRUVKDOOFRPSO\ZLWKWKHJHQHUDOSUHYDLOLQJUDWHVRISHUGLHPZDJHVDQGWKHJHQHUDO SUHYDLOLQJUDWHVIRUKROLGD\DQGRYHUWLPH:RUNLQWKHORFDOLW\LQZKLFKWKH:RUNLVWREHSHUIRUPHG IRUHDFKFUDIWFODVVLILFDWLRQRUW\SHRIZRUNHUQHHGHGWRH[HFXWHWKH&RQWUDFW 7KH'LUHFWRURI WKH'HSDUWPHQWRI,QGXVWULDO5HODWLRQVRIWKH6WDWHRI&DOLIRUQLD SXUVXDQWWR&DOLIRUQLD/DERU &RGH DQGWKH8QLWHG6WDWHV6HFUHWDU\ RI/DERU SXUVXDQWWRWKH 'DYLV%DFRQ$FW KDYH GHWHUPLQHGWKHJHQHUDOSUHYDLOLQJUDWHVRIZDJHVLQWKHORFDOLW\LQZKLFKWKH:RUNLVWREH SHUIRUPHG7KHUDWHVDUHDYDLODEOHIURPWKH&LW\DWLWV3XEOLF:RUNV'HSDUWPHQWZKLFKVKDOOEH PDGHDYDLODEOHWRDQ\LQWHUHVWHGSDUW\XSRQUHTXHVW RURQOLQHDWwww.dir.ca.gov/DLSR/PWD/ 7RWKHH[WHQWWKDWWKHUHDUHDQ\GLIIHUHQFHVLQWKHIHGHUDODQGVWDWHSUHYDLOLQJZDJHUDWHVIRU VLPLODUFODVVLILFDWLRQVRIODERUWKH&RQWUDFWRUDQGLWV6XEFRQWUDFWRUVVKDOOSD\WKHKLJKHVWZDJH UDWH 7KH&RQWUDFWRUVKDOOSRVWDFRS\RIWKHJHQHUDOSUHYDLOLQJUDWHRISHUGLHPZDJHVDWWKHMREVLWH 7KH&RQWUDFWRUDQGDQ\6XEFRQWUDFWRUXQGHUKLPKHUVKDOOSD\QRWOHVVWKDQWKHVSHFLILHG SUHYDLOLQJUDWHRIZDJHVWRDOOZRUNHUVHPSOR\HGLQWKHH[HFXWLRQRIWKH&RQWUDFW 7KHKROLGD\VXSRQZKLFKVXFKUDWHVVKDOOEHSDLGVKDOOEHDOOKROLGD\VUHFRJQL]HGLQWKHFROOHFWLYH EDUJDLQLQJ&RQWUDFWDSSOLFDEOHWRWKHSDUWLFXODUFUDIWFODVVLILFDWLRQRUW\SHRIZRUNHUHPSOR\HGRQ WKHSURMHFW 7KH&RQWUDFWRUVKDOODVDSHQDOW\WRWKH6WDWHRUWKH&LW\IRUIHLWQRWPRUHWKDQ)LIW\'ROODUV IRUHDFKFDOHQGDUGD\RUSRUWLRQWKHUHRIIRUHDFKZRUNHUSDLGOHVVWKDQWKHSUHYDLOLQJUDWHVIRU WKH:RUNRUFUDIWLQZKLFKWKHZRUNHULVHPSOR\HGXQGHUWKH&RQWUDFWE\WKH&RQWUDFWRURUE\DQ\ 6XEFRQWUDFWRUXQGHUKLP 7KHGLIIHUHQFHEHWZHHQWKHSUHYDLOLQJZDJHUDWHVDQGWKHDPRXQW SDLGWRHDFKZRUNHUIRUHDFKFDOHQGDUGD\RUSRUWLRQWKHUHRIIRUZKLFKVXFKZRUNHUZDVSDLGOHVV WKDQWKHVWLSXODWHGSUHYDLOLQJZDJHUDWHVKDOOEHSDLGWRVXFKZRUNHUE\WKH&RQWUDFWRU 7KHVSHFLILHGZDJHUDWHVDUHPLQLPXPUDWHVRQO\DQGWKH&LW\ZLOOQRWFRQVLGHUDQGVKDOOQRWEH OLDEOHIRUDQ\FODLPVIRUDGGLWLRQDOFRPSHQVDWLRQPDGHE\WKH&RQWUDFWRUEHFDXVHRISD\PHQW E\KLPKHURIDQ\ZDJHUDWHLQH[FHVVRIWKHJHQHUDOSUHYDLOLQJUDWHV $OOGLVSXWHVLQUHJDUGWR WKHSD\PHQWRIZDJHVLQH[FHVVRIWKRVHVSHFLILHGKHUHLQVKDOOEHDGMXVWHGE\WKH&RQWUDFWRUDW KLVKHURZQH[SHQVH % 3D\UROO5HFRUGV 3XUVXDQWWR&DOLIRUQLD/DERU&RGH6HFWLRQWKH&RQWUDFWRUDQGHDFK6XEFRQWUDFWRUVKDOO Western Allied Corporation Page 84 of 221 . . Item 10 Page 84 of 221 NHHSDQDFFXUDWHSD\UROOUHFRUGVKRZLQJWKHQDPHDGGUHVVVRFLDOVHFXULW\QXPEHU:RUN FODVVLILFDWLRQVWUDLJKWWLPHDQGRYHUWLPHKRXUVZRUNHGHDFKGD\DQGZHHNDQGWKHDFWXDOSHU GLHPZDJHVSDLGWRHDFKMRXUQH\PDQDSSUHQWLFHZRUNHURURWKHUHPSOR\HHHPSOR\HGLQ FRQQHFWLRQZLWKWKH:RUN7KHSD\UROOUHFRUGVVKDOOEHFHUWLILHGDQGVKDOOEHDYDLODEOHIRU LQVSHFWLRQ 7KH&RQWUDFWRUVKDOOLQIRUPWKH&LW\RIWKHORFDWLRQRIWKHSD\UROOUHFRUGVLQFOXGLQJWKHVWUHHW DGGUHVVFLW\DQGFRXQW\DQGVKDOOZLWKLQILYH :RUNLQJ'D\VSURYLGHDQRWLFHRIFKDQJHLQ ORFDWLRQDQGDGGUHVV 8SRQUHTXHVWE\WKH'LUHFWRUWKH&RQWUDFWRUVKDOOSURYLGHDFRS\RIWKHFHUWLILHGSD\UROOUHFRUGV DORQJZLWKDVWDWHPHQWRIFRPSOLDQFH $335(17,&(6+,367$1'$5'6 $ &RPSOLDQFHZLWK&DOLIRUQLD/DERU&RGH6HFWLRQUHTXLUHVDOOSXEOLFZRUNVFRQWUDFWRUVDQG VXEFRQWUDFWRUVWR 3ULRUWRFRPPHQFLQJZRUNRQDSXEOLFZRUNVFRQWUDFWVXEPLW&RQWUDFW$ZDUGLQIRUPDWLRQ WRWKHDSSOLFDEOHMRLQWDSSUHQWLFHVKLSFRPPLWWHHLQFOXGLQJDQHVWLPDWHRIWKHMRXUQH\PDQ KRXUVWREHSHUIRUPHGXQGHUWKH&RQWUDFWWKHQXPEHURIDSSUHQWLFHVWREHHPSOR\HGDQG WKHDSSUR[LPDWHGDWHVWKHDSSUHQWLFHVZLOOEHHPSOR\HG8VH)RUP'$6IURPWKH6WDWH 'HSDUWPHQWRI,QGXVWULDO5HODWLRQV7KH&LW\UHVHUYHVWKHULJKWWRUHTXLUH&RQWUDFWRUDQG 6XEFRQWUDFWRUVWRVXEPLWDFRS\RIVDLGIRUPVWRWKH&LW\ (PSOR\DSSUHQWLFHVIRUWKHSXEOLFZRUNDWDUDWLRRIQROHVVWKDQRQH KRXURUDSSUHQWLFH ZRUNIRUHYHU\ILYH KRXUVRUODERUSHUIRUPHGE\DMRXUQH\PDQ 7RUHTXHVWGLVSDWFKRI DSSUHQWLFHVXVH)RUP'$6IURPWKH6WDWH'HSDUWPHQWRI,QGXVWULDO5HODWLRQV 7KH &LW\UHVHUYHVWKHULJKWWRUHTXLUH&RQWUDFWRUDQG6XEFRQWUDFWRUVWRVXEPLWDFRS\RIVDLG IRUPVWRWKH&LW\ 3D\ WKH DSSUHQWLFH UDWH RQ SXEOLF ZRUNV SURMHFWV RQO\ WR WKRVH DSSUHQWLFHV ZKR DUH UHJLVWHUHGDVGHILQHGLQ/DERU&RGH6HFWLRQ &RQWULEXWH WR WKH WUDLQLQJ IXQG LQ WKH DPRXQW LGHQWLILHG LQ WKH 3UHYDLOLQJ :DJH 5DWH SXEOLFDWLRQIRUMRXUQH\PDQDQGDSSUHQWLFHV &RQWUDFWRUVZKRFKRRVHQRWWRFRQWULEXWHWR WKHORFDOWUDLQLQJWUXVWIXQGPXVWPDNHWKHLUFRQWULEXWLRQVWRWKH&DOLIRUQLD$SSUHQWLFHVKLS &RXQFLO32%R[6DQ)UDQFLVFR&$ % )DLOXUHWRFRPSO\ZLWKWKHSURYLVLRQVRI&DOLIRUQLD/DERU&RGH6HFWLRQPD\UHVXOWLQWKHORVV RIWKHULJKWWRELGRUSHUIRUPZRUNRQDOOSXEOLFZRUNVSURMHFWVIRUDSHULRGRIRQHWRWKUHH\HDUVDQG WKH LPSRVLWLRQ RI D FLYLO SHQDOW\ RI 2QH +XQGUHG 'ROODUV IRU HDFK FDOHQGDU GD\ RI QRQFRPSOLDQFHIRUWKHILUVWYLRODWLRQDQGXSWR7KUHH+XQGUHG'ROODUV IRUHDFKFDOHQGDU GD\RIQRQFRPSOLDQFHIRUDVHFRQGRUVXEVHTXHQWYLRODWLRQ &RQWUDFWRUVKRXOGPDNHDVHSDUDWH FRS\RIWKLVPDWHULDOIRUHDFKRIKLVKHU6XEFRQWUDFWRUV & 3D\UROO5HFRUGV7KH&RQWUDFWRUDQGHDFK6XEFRQWUDFWRUVKDOONHHSDQDFFXUDWHSD\UROOUHFRUG VKRZLQJWKHQDPHDGGUHVVVRFLDOVHFXULW\QXPEHUZRUNFODVVLILFDWLRQVWUDLJKWWLPHDQGRYHUWLPH KRXUV ZRUNHG HDFK GD\DQGZHHN DQGWKHDFWXDO SHUGLHP ZDJHV SDLGWRHDFKMRXUQH\PDQ DSSUHQWLFHZRUNHURURWKHUHPSOR\HHHPSOR\HGLQFRQQHFWLRQZLWKWKHZRUN 7KHSD\UROOUHFRUGV VKDOOEHFHUWLILHGDQGVKDOOEHVXEPLWWHGWRWKH3URMHFW0DQDJHUHYHU\WZRZHHNV Western Allied Corporation Page 85 of 221 . . Item 10 Page 85 of 221 ' 6WDWHPHQWRI(PSOR\HU)ULQJH%HQHILW3D\PHQWV:LWKLQILYH FDOHQGDUGD\VRIVLJQLQJWKH&RQWUDFW RU6XEFRQWUDFWDVDSSOLFDEOHWKH6WDWHPHQWRI(PSOR\HU3D\PHQWV '/6()RUP3:IURPWKH 6WDWH'HSDUWPHQWRI,QGXVWULDO5HODWLRQV VKDOOEHFRPSOHWHGIRUHDFK&RQWUDFWRUDQG6XEFRQWUDFWRU RIDQ\WLHUZKRSD\VEHQHILWVWRDWKLUGSDUW\WUXVWSODQRUIXQGIRUKHDOWKDQGZHOIDUHEHQHILWV YDFDWLRQ IXQGV RU PDNHV SHQVLRQ FRQWULEXWLRQV 7KH IRUP PXVW FRQWDLQ IRU HDFK ZRUNHU FODVVLILFDWLRQWKHIXQGSODQRUWUXVWQDPHDGGUHVVDGPLQLVWUDWRUWKHDPRXQWSHUKRXUFRQWULEXWHG DQGWKHIUHTXHQF\RIFRQWULEXWLRQV7UDLQLQJIXQGFRQWULEXWLRQVVKDOODOVREHUHSRUWHGLQWKLVIRUP &LW\UHVHUYHVWKHULJKWWRUHTXLUH&RQWUDFWRUVDQG6XEFRQWUDFWRUVWRVXEPLWDFRS\RIVDLGIRUPVWR WKH&LW\ (03/2<0(172)$335(17,&(6 $ ,QWKHSHUIRUPDQFHRIWKLV&RQWUDFWWKH&RQWUDFWRUDQGDQ\6XEFRQWUDFWRUVKDOOFRPSO\ZLWKWKH SURYLVLRQVFRQFHUQLQJWKHHPSOR\PHQWRIDSSUHQWLFHVLQWKH/DERU&RGHRIWKH6WDWHRI&DOLIRUQLD DQGDQ\DPHQGPHQWVWKHUHRI % ,QWKHHYHQWWKH&RQWUDFWRURUDQ\6XEFRQWUDFWRUZLOOIXOO\IDLOVWRFRPSO\ZLWKWKHDIRUHVDLGSURYLVLRQV RI WKH /DERU &RGH VXFK &RQWUDFWRU RU 6XEFRQWUDFWRU VKDOO EH VXEMHFW WR WKH SHQDOWLHV IRU QRQFRPSOLDQFHLQWKH/DERU&RGHRIWKH6WDWHRI&DOLIRUQLDDQGDQ\DPHQGPHQWVWKHUHRI 5(*,675$7,21:,7+7+(67$7('(3$570(172),1'8675,$/5(/$7,216 ,QWKHSHUIRUPDQFHRIWKLV&RQWUDFW&RQWUDFWRUDQGRUDQ\6XEFRQWUDFWRUPXVWEHFXUUHQWO\UHJLVWHUHGDQG TXDOLILHG LQFOXGLQJSD\PHQWRIDQ\UHTXLUHGIHH ZLWKWKH6WDWH'HSDUWPHQWRI,QGXVWULDO5HODWLRQVSXUVXDQW WR/DERU&RGHVHFWLRQ7KLVSURMHFWLVVXEMHFWWRFRPSOLDQFHPRQLWRULQJDQGHQIRUFHPHQWE\WKH6WDWH 'HSDUWPHQWRI,QGXVWULDO5HODWLRQV &+$5$&7(52):25.(56 7KH&RQWUDFWRUVKDOOQRWDOORZKLVKHUDJHQWVRUHPSOR\HHV6XEFRQWUDFWRUVRUDQ\DJHQWRUHPSOR\HHWKHUHRI WRWUHVSDVVRQSUHPLVHVRUODQGVLQWKHYLFLQLW\RIWKH:RUN 2QO\VNLOOHGVXSHUYLVRUVDQGZRUNHUVVKDOOEH HPSOR\HGRQ:RUNUHTXLULQJVSHFLDOTXDOLILFDWLRQVDQGZKHQUHTXLUHGE\WKH'LUHFWRUWKH&RQWUDFWRUVKDOO GLVFKDUJHDQ\SHUVRQZKRFRPPLWVWUHVSDVVRULQWKHRSLQLRQRIWKH'LUHFWRUDFWVLQDGLVRUGHUO\GDQJHURXV LQVXERUGLQDWHLQFRPSHWHQWRURWKHUZLVHREMHFWLRQDEOHPDQQHU$Q\HPSOR\HHEHLQJLQWR[LFDWHGRUEULQJLQJ RUKDYLQJLQWR[LFDWLQJOLTXRUVRUFRQWUROOHGVXEVWDQFHVRQWKH:RUNVKDOOEHGLVFKDUJHG6XFKGLVFKDUJHVKDOO QRWEHWKHEDVLVRIDQ\FODLPIRUFRPSHQVDWLRQRIGDPDJHVDJDLQVWWKH&LW\RUDQ\RILWVRIILFHUVDJHQWVDQG HPSOR\HHV 12602.,1*±67$7(/$%25&2'(6(&7,21 7KH&RQWUDFWRUDQGLWVDJHQWVHPSOR\HHV6XEFRQWUDFWRUVUHSUHVHQWDWLYHVDQGDQ\SHUVRQXQGHU &RQWUDFWRU¶VFRQWURODUHSURKLELWHGIURPVPRNLQJLQ²RUZLWKLQDIRRWGLVWDQFHIURP²WKH6LWHZKLFKLVD SODFHRIHPSOR\PHQWXQGHU&DOLIRUQLD/DERU&RGH >(1'2)$57,&/(@ Western Allied Corporation Page 86 of 221 . . Item 10 Page 86 of 221 ARTICLE 15 - DISPUTE RESOLUTION 68%0,66,212)&/$,06 $ %\&RQWUDFWRU &RQWUDFWRU¶VULJKWWRFRPPHQFHWKH&ODLPV'LVSXWH5HVROXWLRQ3URFHVVVKDOODULVHXSRQWKH'LUHFWRU¶V ZULWWHQUHVSRQVHGHQ\LQJDOORUSDUWRID&ODLP&RQWUDFWRUVKDOOVXEPLWDZULWWHQ6WDWHPHQWRI'LVSXWH WRWKH'LUHFWRUZLWKLQVHYHQ 'D\VDIWHUWKH'LUHFWRUUHMHFWVDOORUDSRUWLRQRI&RQWUDFWRU¶V&ODLP &RQWUDFWRU¶V6WDWHPHQWRI'LVSXWHVKDOOEHVLJQHGXQGHUSHQDOW\RISHUMXU\DQGVKDOOVWDWHZLWK VSHFLILFLW\WKHHYHQWVRUFLUFXPVWDQFHVJLYLQJULVHWRWKH&ODLPWKHGDWHVRIWKHLURFFXUUHQFHDQGWKH HIIHFWLIDQ\RQWKHFRPSHQVDWLRQGXHRUSHUIRUPDQFHREOLJDWLRQVRI&RQWUDFWRUXQGHUWKH&RQVWUXFWLRQ &RQWUDFW 6XFK6WDWHPHQWRI'LVSXWHVKDOOLQFOXGHDGHTXDWHVXSSRUWLQJGDWDWRVXEVWDQWLDWHWKH GLVSXWHG&ODLP $GHTXDWHVXSSRUWLQJGDWDIRUD&ODLPUHODWLQJWRWKHDGMXVWPHQWRIWKH&RQWUDFWRU¶V REOLJDWLRQVUHODWLYHWRWLPHRISHUIRUPDQFHVKDOOLQFOXGHDGHWDLOHGHYHQWE\HYHQWGHVFULSWLRQRIWKH LPSDFWRIHDFKGHOD\RQ&RQWUDFWRU¶VWLPHIRUSHUIRUPDQFH$GHTXDWHVXSSRUWLQJGDWDWRD6WDWHPHQW RI'LVSXWHVXEPLWWHGE\&RQWUDFWRULQYROYLQJ&RQWUDFWRU¶VFRPSHQVDWLRQVKDOOLQFOXGHDGHWDLOHGFRVW EUHDNGRZQDQGVXSSRUWLQJFRVWGDWDLQVXFKIRUPDQGLQFOXGLQJVXFKGHWDLOHGLQIRUPDWLRQDQGRWKHU VXSSRUWLQJGDWDDVUHTXLUHGWRGHPRQVWUDWHWKHJURXQGVIRUDQGSUHFLVHDPRXQWRIWKH&ODLP % %\&LW\ &LW\¶VULJKWWRFRPPHQFHWKH&ODLPV'LVSXWH5HVROXWLRQ3URFHVVVKDOODULVHDWDQ\WLPHIROORZLQJWKH &LW\¶VDFWXDOGLVFRYHU\RIWKHFLUFXPVWDQFHVJLYLQJULVHWRWKH&ODLP 1RWKLQJFRQWDLQHGKHUHLQVKDOO SUHFOXGH&LW\IURPDVVHUWLQJ&ODLPVLQUHVSRQVHWRD&ODLPDVVHUWHGE\&RQWUDFWRU $6WDWHPHQWRI 'LVSXWHVXEPLWWHGE\&LW\VKDOOVWDWHWKHHYHQWVRUFLUFXPVWDQFHVJLYLQJULVHWRWKH&ODLPWKHGDWHVRI WKHLURFFXUUHQFHDQGWKHGDPDJHVRURWKHUUHOLHIFODLPHGE\&LW\DVDUHVXOWRIVXFKHYHQWV & &ODLPV'HILQHG 7KHWHUP³FODLPV´DVXVHGKHUHLQVKDOOEHDVGHILQHGLQ&DOLIRUQLD3XEOLF&RQWUDFW&RGH F &/$,06',6387(5(62/87,21352&(66 7KHSDUWLHVVKDOOXWLOL]HHDFKRIWKHIROORZLQJVWHSVLQWKH&ODLPV'LVSXWH5HVROXWLRQ3URFHVVLQWKHVHTXHQFH WKH\DSSHDUEHORZ (DFKSDUW\VKDOOSDUWLFLSDWHIXOO\DQGLQJRRGIDLWKLQHDFKVWHSLQWKH&ODLPV'LVSXWH 5HVROXWLRQ3URFHVVZKLFKJRRGIDLWKHIIRUWVKDOOEHDFRQGLWLRQSUHFHGHQWWRWKHULJKWRIHDFKSDUW\WRSURFHHG WRWKHQH[WVWHSLQWKH&ODLPV'LVSXWH5HVROXWLRQ3URFHVV $ 'LUHFW1HJRWLDWLRQV 'HVLJQDWHGUHSUHVHQWDWLYHVRI&LW\DQG&RQWUDFWRUVKDOOPHHWDVVRRQDVSRVVLEOH EXWQRWODWHUWKDQ WHQ 'D\VDIWHUUHFHLSWRIWKH6WDWHPHQWRI'LVSXWH LQDJRRGIDLWKHIIRUWWRQHJRWLDWHDUHVROXWLRQ WRWKH&ODLP (DFKSDUW\VKDOOEHUHSUHVHQWHGLQVXFKQHJRWLDWLRQVE\DQDXWKRUL]HGUHSUHVHQWDWLYH ZLWKIXOONQRZOHGJHRIWKHGHWDLOVRIWKH&ODLPRUGHIHQVHVEHLQJDVVHUWHGE\VXFKSDUW\DQGZLWKIXOO DXWKRULW\WRUHVROYHVXFK&ODLPWKHQDQGWKHUHVXEMHFWRQO\WR&LW\¶VULJKWDQGREOLJDWLRQWRREWDLQ&LW\ &RXQFLO>RURWKHU&LW\RIILFLDO@DSSURYDORIDQ\DJUHHGVHWWOHPHQWRUUHVROXWLRQ,QWKH&ODLPLQYROYHVWKH DVVHUWLRQRIDULJKWRUFODLPE\D6XEFRQWUDFWRUDJDLQVW&RQWUDFWRUWKDWLVLQWXUQEHLQJDVVHUWHGE\ &RQWUDFWRUDJDLQVW&LW\WKHQVXFK6XEFRQWUDFWRUVKDOODOVRKDYHDUHSUHVHQWDWLYHDWWHQGVXFK QHJRWLDWLRQVZLWKWKHVDPHDXWKRULW\DQGNQRZOHGJHDVMXVWGHVFULEHG 8SRQFRPSOHWLRQRIWKH PHHWLQJLIWKH&ODLPLVQRWUHVROYHGWKHSDUWLHVPD\HLWKHUFRQWLQXHWKHQHJRWLDWLRQVRUHLWKHUSDUW\ Western Allied Corporation Page 87 of 221 . . Item 10 Page 87 of 221 PD\GHFODUHQHJRWLDWLRQVHQGHG$OOGLVFXVVLRQVWKDWRFFXUGXULQJVXFKQHJRWLDWLRQVDQGDOOGRFXPHQWV SUHSDUHGVROHO\IRUWKHSXUSRVHRIVXFKQHJRWLDWLRQVVKDOOEHFRQILGHQWLDODQGSULYLOHJHGSXUVXDQWWR &DOLIRUQLD(YLGHQFH&RGH6HFWLRQV DQG % 'HIHUUDORI&ODLPV )ROORZLQJWKHFRPSOHWLRQRIWKHQHJRWLDWLRQVUHTXLUHGE\3DUDJUDSK$DOOXQUHVROYHG&ODLPV H[FHSWWKRVHWKDWGRQRWLQYROYHSDUWLHVRWKHUWKDQWKH&RQWUDFWRUDQG&LW\VKDOOEHGHIHUUHGSHQGLQJ )LQDO&RPSOHWLRQRIWKH:RUNVXEMHFWWR&LW\¶VULJKWLQLWVVROHDQGDEVROXWHGLVFUHWLRQWRUHTXLUHWKDW WKHFODLPV'LVSXWH5HVROXWLRQ3URFHVVSURFHHGSULRUWR)LQDO&RPSOHWLRQ,QWKHHYHQWWKDW&LW\GRHV QRWHOHFWWRSURFHHGZLWKWKH&ODLPV'LVSXWH5HVROXWLRQ3URFHVVSULRUWR)LQDO&RPSOHWLRQRIWKH:RUN DOO&ODLPVWKDWKDYHEHHQGHIHUUHGXQWLOVXFK)LQDO&RPSOHWLRQVKDOOEHFRQVROLGDWHGZLWKLQD UHDVRQDEOHWLPHDIWHUVXFK)LQDO&RPSOHWLRQDQGWKHUHDIWHUSXUVXHGWRUHVROXWLRQSXUVXDQWWRWKH&ODLPV 'LVSXWH5HVROXWLRQ3URFHVV 1RWKLQJFRQWDLQHGLQWKLV$UWLFOHVKDOOEHLQWHUSUHWHGDVOLPLWLQJWKH SDUWLHV¶ULJKWVWRFRQWLQXHLQIRUPDOQHJRWLDWLRQVRI&ODLPVWKDWKDYHEHHQGHIHUUHGXQWLOVXFK)LQDO &RPSOHWLRQ SURYLGHGKRZHYHUWKDWVXFKLQIRUPDOQHJRWLDWLRQVVKDOOQRWEHLQWHUSUHWHGDVDOWHULQJWKH SURYLVLRQVRIWKLV$UWLFOHGHIHUULQJILQDOGHWHUPLQDWLRQDQGUHVROXWLRQRIXQUHVROYHG&ODLPVXQWLODIWHU )LQDO&RPSOHWLRQRIWKH:RUN & 5HTXLUHG3URYLVLRQV2Q&RQWUDFW&ODLP5HVROXWLRQ8QGHU&DOLIRUQLD/DZ ,ID&ODLPLVQRWUHVROYHGE\WKHVWHSVGHVFULEHGLQWKLV$UWLFOH $ DQG % 3XEOLF&RQWUDFW&RGH 6HFWLRQ VSHFLILHVUHTXLUHGSURYLVLRQVRQUHVROYLQJFRQWUDFW&ODLPVRIDQ\VL]HDQG3XEOLF&RQWUDFW &RGH6HFWLRQHWVHTVSHFLILHVUHTXLUHGSURYLVLRQVRQUHVROYLQJFRQWUDFW&ODLPVOHVVWKDQ 7KRVHVWDWXWHVFRQVWLWXWHDSDUWRIWKLV&RQWUDFW,QWKHHYHQWDQ\RWKHU&RQWUDFWSURYLVLRQ YLRODWHVVXFKVWDWXWHVWKHDSSOLFDEOHVWDWXWHFRQWUROV3XEOLF&RQWUDFW&RGH6HFWLRQ SURYLGHV x )RUWKHSXUSRVHVRIWKLVVHFWLRQ³&ODLP´PHDQVDVHSDUDWHGHPDQGE\&RQWUDFWRUIRU DWLPH H[WHQVLRQ SD\PHQWRUPRQH\RUGDPDJHVDULVLQJIURP:RUNGRQHE\RURQEHKDOIRI&RQWUDFWRU DULVLQJXQGHUWKHFRQWUDFWGRFXPHQWVDQGSD\PHQWRIZKLFKLVQRWRWKHUZLVHH[SUHVVO\SURYLGHG IRURUWKHFODLPDQWLVQRWRWKHUZLVHHQWLWOHGWRRU DQDPRXQWWKHSD\PHQWRIZKLFKLVGLVSXWHG E\WKH&LW\ x 8SRQUHFHLSWRID&ODLPWKH&LW\VKDOOFRQGXFWDUHDVRQDEOHUHYLHZRIWKH&ODLPDQGZLWKLQ GD\VRULIWKH&LW\¶VJRYHUQLQJERG\PXVWDSSURYHWKH&LW\¶VUHVSRQVHWRWKH&ODLPDQGWKH JRYHUQLQJERG\KDVQRWPHWZLWKLQWKHGD\VWKHQZLWKLQWKUHH GD\VRIWKH$JHQF\¶VPHHWLQJ VKDOOSURYLGH&RQWUDFWRUZLWKDZULWWHQVWDWHPHQWLGHQWLI\LQJZKDWSRUWLRQRIWKH&ODLPLVGLVSXWHG DQGZKDWSRUWLRQLVXQGLVSXWHG 6KRXOGWKH&LW\WDNHQRDFWLRQRQWKH&ODLPZLWKLQGD\VRI VXEPLVVLRQLWVKDOOEHGHHPHGGHQLHG x ,IWKH&RQWUDFWRUGLVSXWHVWKH&LW\¶VUHVSRQVHWRLWV&ODLPLQFOXGLQJDIDLOXUHWRUHVSRQGLWPD\ VXEPLWYLDUHJLVWHUHGPDLORUFHUWLILHGPDLOUHWXUQUHFHLSWUHTXHVWHGDZULWWHQGHPDQGIRUDQ LQIRUPDOFRQIHUHQFHWRPHHWDQGFRQIHUIRUVHWWOHPHQWRIWKHLVVXHVLQGLVSXWH 7KH&LW\VKDOO VFKHGXOHVXFKDPHHWDQGFRQIHUFRQIHUHQFHZLWKLQGD\VIRUVHWWOHPHQWRIWKHGLVSXWH:LWKLQ WHQ GD\VRIWKHPHHWDQGFRQIHUFRQIHUHQFHWKH&LW\VKDOOSURYLGH&RQWUDFWRUZLWKDZULWWHQ VWDWHPHQWLGHQWLI\LQJWKHSRUWLRQRIWKH&ODLPWKDWUHPDLQVLQGLVSXWHDQGWKHSRUWLRQWKDWLV XQGLVSXWHG,IWKH&RQWUDFWRUGLVSXWHVWKH&LW\¶VVWDWHPHQWLWVKDOOLQIRUPWKH&LW\DQGWKH\VKDOO PXWXDOO\DJUHHWRDPHGLDWRUZLWKLQEXVLQHVVGD\VRIWKHZULWWHQVWDWHPHQW x 7KH&LW\VKDOOSD\WKHXQGLVSXWHGSRUWLRQVRIWKH&ODLPZLWKLQGD\VRIWKHLVVXDQFHRIDZULWWHQ VWDWHPHQWLGHQWLI\LQJDQXQGLVSXWHGSRUWLRQ Western Allied Corporation Page 88 of 221 . . Item 10 Page 88 of 221 x $Q\GLVSXWHGSRUWLRQRIWKH&ODLPDVLGHQWLILHGE\WKH&RQWUDFWRULQZULWLQJVKDOOEHVXEPLWWHGWR QRQELQGLQJPHGLDWLRQZLWKWKH&LW\DQGWKH&RQWUDFWRUVKDULQJWKHDVVRFLDWHGFRVWVHTXDOO\7KH &LW\DQG&RQWUDFWRUVKDOOPXWXDOO\DJUHHWRDPHGLDWRUZLWKLQEXVLQHVVGD\VDIWHUWKHGLVSXWHG SRUWLRQRIWKH&ODLPKDVEHHQLGHQWLILHGLQZULWLQJ,IWKHSDUWLHVFDQQRWDJUHHXSRQDPHGLDWRU HDFKSDUW\VKDOOVHOHFWDPHGLDWRUDQGWKRVHPHGLDWRUVVKDOOVHOHFWDTXDOLILHGQHXWUDOWKLUGSDUW\ WRPHGLDWHZLWKUHJDUGWRWKHGLVSXWHGSRUWLRQRIWKH&ODLP(DFKSDUW\VKDOOEHDUWKHIHHVDQG FRVWVFKDUJHGE\LWVUHVSHFWLYHPHGLDWRULQFRQQHFWLRQZLWKWKHVHOHFWLRQRIWKHQHXWUDOPHGLDWRU ,IPHGLDWLRQLVXQVXFFHVVIXOWKHSDUWVRIWKH&ODLPUHPDLQLQJLQGLVSXWHVKDOOEHVXEMHFWWR DSSOLFDEOHSURFHGXUHVRXWVLGHWKLVVHFWLRQ x )RU&ODLPVXQGHUXQOHVVWKHSDUWLHVDJUHHRWKHUZLVHLQZULWLQJPHGLDWLRQSXUVXDQWWR WKHVHSURYLVLRQVVKDOOH[FXVHWKHPHGLDWLRQREOLJDWLRQXQGHU3XEOLF&RQWUDFWLQJ&RGHVHFWLRQ D x 7KHSDUWLHVPD\PXWXDOO\DJUHHLQZULWLQJWRZDLYHWKHPHGLDWLRQUHTXLUHPHQWVRIWKLVVXEVHFWLRQ DQGSURFHHGWRWKHFRPPHQFHPHQWRIDFLYLODFWLRQ x )DLOXUHE\WKH&LW\WRUHVSRQGWRD&ODLPIURP&RQWUDFWRUZLWKLQWKHWLPHSHULRGVGHVFULEHGLQWKLV VXEGLYLVLRQRUWRRWKHUZLVHPHHWWKHWLPHUHTXLUHPHQWVRIWKLVVHFWLRQVKDOOUHVXOWLQWKH&ODLP EHLQJGHHPHGUHMHFWHGLQLWVHQWLUHW\$&ODLPWKDWLVGHQLHGE\UHDVRQRIWKH&LW\¶VIDLOXUHWRKDYH UHVSRQGHGWRD&ODLPRULWVIDLOXUHWRRWKHUZLVHPHHWWKHWLPHUHTXLUHPHQWVRIWKLVVHFWLRQVKDOO QRWFRQVWLWXWHDQDGYHUVHILQGLQJZLWKUHJDUGWRWKHPHULWVRIWKH&ODLPRUWKHUHVSRQVLELOLW\RU TXDOLILFDWLRQVRIWKH&RQWUDFWRU x $PRXQWVQRWSDLGLQDWLPHO\PDQQHUDVUHTXLUHGE\WKLVVHFWLRQVKDOOEHDULQWHUHVWDWSHUFHQWSHU DQQXP x ,ID6XEFRQWUDFWRURUDORZHUWLHUVXEFRQWUDFWRUODFNVOHJDOVWDQGLQJWRDVVHUWD&ODLPDJDLQVWWKH &LW\EHFDXVHSULYLW\RIFRQWUDFWGRHVQRWH[LVWWKH&RQWUDFWRUPD\SUHVHQWWRWKH&LW\D&ODLPRQ EHKDOIRID6XEFRQWUDFWRURUORZHUWLHUVXEFRQWUDFWRU$6XEFRQWUDFWRUPD\UHTXHVWLQZULWLQJHLWKHU RQKLVRUKHURZQEHKDOIRURQEHKDOIRIDORZHUWLHUVXEFRQWUDFWRUWKDWWKH&RQWUDFWRUSUHVHQWD &ODLPIRUZRUNZKLFKZDVSHUIRUPHGE\WKH6XEFRQWUDFWRURUE\DORZHUWLHUVXEFRQWUDFWRURQ EHKDOIRIWKH6XEFRQWUDFWRU7KH6XEFRQWUDFWRUUHTXHVWLQJWKDWWKH&ODLPEHSUHVHQWHGWRWKH SXEOLFHQWLW\VKDOOIXUQLVKUHDVRQDEOHGRFXPHQWDWLRQWRVXSSRUWWKH&ODLP:LWKLQGD\VRIUHFHLSW RIWKLVZULWWHQUHTXHVWWKH&RQWUDFWRUVKDOOQRWLI\WKH6XEFRQWUDFWRULQZULWLQJDVWRZKHWKHUWKH &RQWUDFWRUSUHVHQWHGWKH&ODLPWRWKH&LW\DQGLIWKHRULJLQDO&RQWUDFWRUGLGQRWSUHVHQWWKH&ODLP SURYLGHWKH6XEFRQWUDFWRUZLWKDVWDWHPHQWRIWKHUHDVRQVIRUQRWKDYLQJGRQHVR x 1RWKLQJLQWKLVVHFWLRQVKDOOLPSRVHOLDELOLW\XSRQWKH&LW\WKDWPDNHVORDQVRUJUDQWVDYDLODEOH WKURXJKDFRPSHWLWLYHDSSOLFDWLRQSURFHVVIRUWKHIDLOXUHRIDQDZDUGHHWRPHHWLWVFRQWUDFWXDO REOLJDWLRQV 3XEOLF&RQWUDFW&RGH6HFWLRQHWVHTSURYLGHV x )RUWKHSXUSRVHVRIWKLVVHFWLRQ³&ODLP´PHDQVDVHSDUDWHGHPDQGE\&RQWUDFWRURIRU OHVVIRU DWLPHH[WHQVLRQ SD\PHQWRUPRQH\RUGDPDJHVDULVLQJIURP:RUNGRQHE\RURQ EHKDOIRI&RQWUDFWRUDULVLQJXQGHUWKH&RQWUDFW'RFXPHQWVDQGSD\PHQWRIZKLFKLVQRWRWKHUZLVH H[SUHVVO\SURYLGHGIRURUWKHFODLPDQWLVQRWRWKHUZLVHHQWLWOHGWRRU DQDPRXQWWKHSD\PHQWRI ZKLFKLVGLVSXWHGE\WKH&LW\ &ODLPVWKDWWRJHWKHUWRWDOPRUHWKDQGRQRWTXDOLI\DVD ³VHSDUDWHGHPDQGRIRUOHVV´DQGDUHQRWVXEMHFWWRWKLVVHFWLRQ Western Allied Corporation Page 89 of 221 . . Item 10 Page 89 of 221 x $YRXFKHULQYRLFHSD\PHQWDSSOLFDWLRQRURWKHUURXWLQHRUDXWKRUL]HGIRUPRIUHTXHVWIRUSD\PHQW LVQRWD&ODLPIRUSXUSRVHVRIWKLVVHFWLRQ,IVXFKUHTXHVWLVGLVSXWHGDVWROLDELOLW\RUDPRXQWWKHQ WKHGLVSXWHGSRUWLRQRIWKHVXEPLVVLRQPD\EHFRQYHUWHGWRD&ODLPXQGHUWKLVVHFWLRQE\ VXEPLWWLQJ D VHSDUDWH &ODLP LQ FRPSOLDQFH ZLWK &RQWUDFW 'RFXPHQWV &ODLP VXEPLVVLRQ UHTXLUHPHQWV x &DXWLRQ 7KLVVHFWLRQGRHVQRWDSSO\WRWRUW&ODLPVDQGQRWKLQJLQWKLVVHFWLRQLVLQWHQGHGQRU VKDOOEHFRQVWUXHGWRFKDQJHWKHWLPHSHULRGVIRUILOLQJWRUW&ODLPVRUDFWLRQVVSHFLILHGE\&KDSWHU DQG&KDSWHURI3DUWRI'LYLVLRQRI7LWOHRIWKH&DOLIRUQLD*RYHUQPHQW&RGH x 7KH&ODLPPXVWEHLQZULWLQJVXEPLWWHGLQFRPSOLDQFHZLWKDOOUHTXLUHPHQWVRIWKH&RQWUDFW 'RFXPHQWV x )RU&ODLPVRIILIW\WKRXVDQGGROODUV RUOHVVWKH&LW\VKDOOUHVSRQGLQZULWLQJZLWKLQIRUW\ ILYH GD\VRIUHFHLSWRIWKH&ODLPRUWKH&LW\PD\UHTXHVWLQZULWLQJZLWKLQWKLUW\ GD\VRI UHFHLSWRIWKH&ODLPDQ\DGGLWLRQDOGRFXPHQWDWLRQVXSSRUWLQJWKH&ODLPRUUHODWLQJWRDQ\GHIHQVHV RU&ODLPVWKH&LW\PD\KDYHDJDLQVWFODLPDQW,IDGGLWLRQDOLQIRUPDWLRQLVWKHUHDIWHUUHTXLUHGLWVKDOO EHUHTXHVWHGDQGSURYLGHGLQDFFRUGDQFHZLWKWKLVVHFWLRQXSRQPXWXDODJUHHPHQWRIWKH&LW\DQG FODLPDQW7KH&LW\¶VZULWWHQUHVSRQVHWRWKH&ODLPDVIXUWKHUGRFXPHQWHGVKDOOEHVXEPLWWHGWR FODLPDQWZLWKLQILIWHHQ GD\VDIWHUUHFHLSWRIIXUWKHUGRFXPHQWDWLRQRUZLWKLQDSHULRGRIWLPHQR JUHDWHUWKDQWDNHQE\FODLPDQWLQSURGXFLQJWKHDGGLWLRQDOLQIRUPDWLRQZKLFKHYHULVJUHDWHU x )RU&ODLPVRYHU)LIW\7KRXVDQG'ROODUV DQGOHVVWKDQRUHTXDOWR WKH&LW\ VKDOOUHVSRQGLQZULWLQJZLWKLQVL[W\ GD\VRIUHFHLSWRIWKH&ODLPRUWKH&LW\PD\UHTXHVWLQ ZULWLQJZLWKLQWKLUW\ GD\VRIUHFHLSWRIWKH&ODLPDQ\DGGLWLRQDOGRFXPHQWDWLRQVXSSRUWLQJWKH &ODLPRUUHODWLQJWRDQ\GHIHQVHVRU&ODLPVWKH&LW\PD\KDYHDJDLQVWFODLPDQW,IDGGLWLRQDO LQIRUPDWLRQLVWKHUHDIWHUUHTXLUHGLWVKDOOEHUHTXHVWHGDQGSURYLGHGLQDFFRUGDQFHZLWKWKLV VHFWLRQXSRQPXWXDODJUHHPHQWRIWKH&LW\DQGFODLPDQW WKH&LW\¶VZULWWHQUHVSRQVHWRWKH&ODLP DVIXUWKHUGRFXPHQWHGVKDOOEHVXEPLWWHGWRFODLPDQWZLWKLQWKLUW\ GD\VDIWHUUHFHLSWRIIXUWKHU GRFXPHQWDWLRQRUZLWKLQDSHULRGRIWLPHQRJUHDWHUWKDQWDNHQE\FODLPDQWLQSURGXFLQJWKH DGGLWLRQDOLQIRUPDWLRQZKLFKHYHULVJUHDWHU x 0HHWDQG&RQIHU ,IFODLPDQWGLVSXWHVWKH&LW\¶VZULWWHQUHVSRQVHRUWKH&LW\IDLOVWRUHVSRQGZLWKLQ WKHWLPHSUHVFULEHGDERYHFODLPDQWVKDOOQRWLI\WKH&LW\LQZULWLQJHLWKHUZLWKLQILIWHHQ GD\VRI UHFHLSWRIWKH&LW\¶VUHVSRQVHRUZLWKLQILIWHHQ GD\VRIWKH&LW\¶VIDLOXUHWRWLPHO\UHVSRQGDQG GHPDQGDQLQIRUPDOFRQIHUHQFHWRPHHWDQGFRQIHUIRUVHWWOHPHQWRIWKHLVVXHVLQGLVSXWH8SRQ GHPDQGWKH&LW\ZLOOVFKHGXOHDPHHWDQGFRQIHUFRQIHUHQFHZLWKLQWKLUW\ GD\VIRUVHWWOHPHQW RIWKHGLVSXWH )ROORZLQJWKHPHHWDQGFRQIHUFRQIHUHQFHGHVFULEHGKHUHLQLIWKH&ODLPRUDQ\SRUWLRQUHPDLQVLQ GLVSXWHFODLPDQWPD\ILOHD&ODLPDVSURYLGHGLQ&KDSWHU FRPPHQFLQJZLWK6HFWLRQ DQG&KDSWHU FRPPHQFLQJZLWK6HFWLRQ RI3DUWRI'LYLVLRQRI7LWOHRIWKH&DOLIRUQLD*RYHUQPHQW&RGH )RUSXUSRVHVRIWKRVHSURYLVLRQVWKHUXQQLQJRIWKHSHULRGRIWLPHZLWKLQZKLFKD&ODLPPXVWEHILOHG VKDOOEHWROOHGIURPWKHWLPHFODLPDQWVXEPLWVLWVZULWWHQ&ODLPDVVHWIRUWKKHUHLQXQWLOWKHWLPHWKDW &ODLPLVGHQLHGDVDUHVXOWRIWKHPHHWDQGFRQIHUSURFHVVLQFOXGLQJDQ\SHULRGRIWLPHXWLOL]HGE\WKH PHHWDQGFRQIHUSURFHVV Western Allied Corporation Page 90 of 221 . . Item 10 Page 90 of 221 ' /HJDO3URFHHGLQJV ,IWKH&ODLPLVQRWUHVROYHGE\WKHSURFHGXUHVGHVFULEHGLQWKLV$UWLFOH $ % DQG & DERYH WKHQWKHSDUW\ZLVKLQJWRIXUWKHUSXUVXHUHVROXWLRQRUGHWHUPLQDWLRQRIWKH&ODLPPD\VXEPLWWKH&ODLP IRUGHWHUPLQDWLRQE\FRPPHQFLQJOHJDOSURFHHGLQJVLQDFRXUWRIFRPSHWHQWMXULVGLFWLRQ 12:$,9(5 3DUWLFLSDWLRQLQWKH&ODLPV'LVSXWH5HVROXWLRQ3URFHVVVKDOOQRWFRQVWLWXWHDZDLYHUUHOHDVHRUFRPSURPLVHRI DQ\GHIHQVHRIHLWKHUSDUW\LQFOXGLQJZLWKRXWOLPLWDWLRQDQ\GHIHQVHEDVHGRQWKHDVVHUWLRQWKDWWKHULJKWVRI &RQWUDFWRUWKDWDUHWKHEDVLVRID&ODLPZHUHSUHYLRXVO\ZDLYHGE\&RQWUDFWRUGXHWRIDLOXUHWRFRPSO\ZLWKWKH &RQWUDFW'RFXPHQWVLQFOXGLQJZLWKRXWOLPLWDWLRQ&RQWUDFWRU¶VIDLOXUHWRFRPSO\ZLWKDQ\WLPHSHULRGVIRU SURYLGLQJQRWLFHVRUIRUVXEPLVVLRQRUVXSSRUWLQJGRFXPHQWDWLRQRI&ODLPV >(1'2)$57,&/(@ Western Allied Corporation Page 91 of 221 . . Item 10 Page 91 of 221 ARTICLE 16 - ACCOUNTING RECORDS 0$,17(1$1&(2)5(&25'6 &RQWUDFWRUVKDOONHHSDQGVKDOOLQFOXGHLQLWVFRQWUDFWVZLWKLWV6XEFRQWUDFWRUVSURYLVLRQVUHTXLULQJLWV 6XEFRQWUDFWRUVWRNHHSIXOODQGGHWDLOHGERRNVDQGUHFRUGVLQDFFRUGDQFHZLWKWKHUHTXLUHPHQWVRIWKH &RQWUDFW'RFXPHQWVLQFOXGLQJWKHIROORZLQJ DOOLQIRUPDWLRQPDWHULDOVDQGGDWDRIHYHU\NLQGDQGFKDUDFWHU KDUGFRS\DVZHOODVFRPSXWHUUHDGDEOHGDWDLILWH[LVWV WKDWKDYHDQ\EHDULQJRQRUSHUWDLQWRDQ\PDWWHUV ULJKWVGXWLHVRUREOLJDWLRQVUHODWLQJWRWKH3URMHFWRUWKHSHUIRUPDQFHRIWKH:RUNLQFOXGLQJZLWKRXWOLPLWDWLRQ DJUHHPHQWVSXUFKDVHRUGHUVOHDVHVFRQWUDFWVFRPPLWPHQWVDUUDQJHPHQWVQRWHVFKDQJHRUGHUVFKDQJH RUGHUUHTXHVWVHVWLPDWHVILHOGRUGHUVVFKHGXOHVGLDULHVORJVUHSRUWVVKRSGUDZLQJVVDPSOHVH[HPSODUV 'UDZLQJV 6SHFLILFDWLRQV LQYRLFHV GHOLYHU\ WLFNHWV UHFHLSWVYRXFKHUVFDQFHOOHGFKHFNVPHPRUDQGD DFFRXQWLQJUHFRUGV MREFRVWUHSRUWV MREFRVWILOHV LQFOXGLQJFRPSOHWHGRFXPHQWDWLRQFRYHULQJQHJRWLDWHG VHWWOHPHQWV EDFNFKDUJH JHQHUDOOHGJHUV GRFXPHQWDWLRQRIFDVKDQGWUDGHGLVFRXQWVHDUQHG LQVXUDQFH UHEDWHVDQGGLYLGHQGVDQGRWKHUGRFXPHQWVUHODWLQJLQZD\WR&ODLPVRU&KDQJH2UGHUV&RQVWUXFWLRQ &KDQJH'LUHFWLYHV:RUN'LUHFWLYHVRURWKHUFODLPVIRUSD\PHQWUHODWHGWRWKH3URMHFWDVVHUWHGE\&RQWUDFWRU RUDQ\6XEFRQWUDFWRU ³$FFRXQWLQJ5HFRUGV´ &RQWUDFWRUVKDOOH[HUFLVHVXFKFRQWUROVDVPD\EHQHFHVVDU\ IRUSURSHUILQDQFLDOPDQDJHPHQWRIWKH:RUN6XFKDFFRXQWLQJDQGFRQWUROV\VWHPVVKDOOFRPSO\ZLWK SUHYDLOLQJFXVWRPDQGSUDFWLFHIRUVLPLODUSURMHFWVEHVDWLVIDFWRU\WR&LW\DQGVKDOOLQFOXGHSUHVHUYDWLRQRI VXFKUHFRUGVIRUDSHULRGRIILYH \HDUVDIWHUDSSURYDORIWKH1RWLFHRI&RPSOHWLRQDQG$FFHSWDQFHE\&LW\ RUIRUVXFKORQJHUSHULRGDVPD\EHUHTXLUHGE\DSSOLFDEOHODZV $&&(66725(&25'6 &RQWUDFWRUVKDOODOORZDQGVKDOOLQFOXGHLQLWVFRQWUDFWVZLWKLWV6XEFRQWUDFWRUVSURYLVLRQVUHTXLULQJLWV 6XEFRQWUDFWRUVWRDOORZ&LW\DQGLWVDXWKRUL]HGUHSUHVHQWDWLYH V DXGLWRUVDWWRUQH\VDQGDFFRXQWDQWVXSRQ WZHQW\IRXU KRXUVQRWLFHWR&RQWUDFWRUIXOODFFHVVWRLQVSHFWDQGFRS\DOOERRNVDQGUHFRUGVUHODWLQJWR WKH3URMHFWWKDW&RQWUDFWRULVUHTXLUHGWRPDLQWDLQSXUVXDQWWR3DUDJUDSKDERYH &2175$&725121&203/,$1&(:,7++2/',1* &RQWUDFWRU V FRPSOLDQFH ZLWK 3DUDJUDSKV DQG DERYHVKDOOEHDFRQGLWLRQSUHFHGHQWWR PDLQWHQDQFHRIDQ\OHJDODFWLRQRUDUELWUDWLRQE\&RQWUDFWRUDJDLQVW&LW\,QDGGLWLRQWRDQGZLWKRXWOLPLWDWLRQ XSRQ&LW\ VRWKHUULJKWVDQGUHPHGLHVIRUEUHDFKLQFOXGLQJDQ\RWKHUSURYLVLRQVIRUZLWKKROGLQJVHWIRUWKLQWKH &RQWUDFW'RFXPHQWV&LW\VKDOOKDYHWKHULJKWH[HUFLVHGLQLWVVROHGLVFUHWLRQWRZLWKKROGIURPDQ\SD\PHQW WR&RQWUDFWRUGXHXQGHUDFXUUHQW$SSOLFDWLRQIRU3D\PHQWDQDGGLWLRQDOVXPRIXSWRWHQSHUFHQW RIWKH WRWDODPRXQWVHWIRUWKLQVXFK$SSOLFDWLRQIRU3D\PHQWXQWLO&RQWUDFWRUDQGLWV6XEFRQWUDFWRUVKDYHFRPSOLHG ZLWKDQ\RXWVWDQGLQJDQGXQVDWLVILHGUHTXHVWE\&LW\XQGHUWKLV$UWLFOH 8SRQVXFKFRPSOLDQFHZLWKWKLV $UWLFOHDQ\DGGLWLRQDOPRQLHVZLWKKHOGSXUVXDQWWRWKLV3DUDJUDSKVKDOOEHUHOHDVHGWR&RQWUDFWRU 63(&,),&(1)25&(0(17%<&,7< &RQWUDFWRUDJUHHVWKDWDQ\IDLOXUHE\&RQWUDFWRURUDQ\6XEFRQWUDFWRUWRSURYLGHDFFHVVWRLWVERRNVDQG UHFRUGVDVUHTXLUHGE\WKLV$UWLFOHVKDOOEHVSHFLILFDOO\HQIRUFHDEOHE\LVVXDQFHRIDSUHOLPLQDU\DQGRU SHUPDQHQWPDQGDWRU\LQMXQFWLRQE\DFRXUWRIFRPSHWHQWMXULVGLFWLRQEDVHGRQDIILGDYLWVVXEPLWWHGWRVXFK FRXUWDQGZLWKRXWWKHQHFHVVLW\RIRUDOWHVWLPRQ\WRFRPSHO&RQWUDFWRUWRSHUPLWDFFHVVLQVSHFWLRQDXGLWV DQGRUUHSURGXFWLRQRI VXFKERRNVDQGUHFRUGVRUWRUHTXLUHGHOLYHU\RIVXFKERRNVDQGUHFRUGVWR&LW\IRU LQVSHFWLRQDXGLWDQGRUUHSURGXFWLRQ >(1'2)$57,&/(@ Western Allied Corporation Page 92 of 221 . . Item 10 Page 92 of 221 ARTICLE 17-MISCELLANEOUS PROVISIONS &203/,$1&(:,7+$33/,&$%/(/$:6 $ 1RWLFHV&RPSOLDQFH &RQWUDFWRUVKDOOJLYHDOOQRWLFHVUHTXLUHGE\JRYHUQPHQWDODXWKRULWLHVDQGFRPSO\ZLWKDOODSSOLFDEOH ODZVDQGODZIXORUGHUVRIJRYHUQPHQWDODXWKRULWLHVLQFOXGLQJEXWQRWOLPLWHGWRWKHSURYLVLRQVRIWKH &DOLIRUQLD &RGH RI 5HJXODWLRQV DSSOLFDEOH WR FRQWUDFWRUV SHUIRUPLQJ FRQVWUXFWLRQ DQG DOO ODZV RUGLQDQFHV UXOHV UHJXODWLRQV DQG ODZIXO RUGHUV UHODWLQJ WR VDIHW\ SUHYDLOLQJ ZDJH DQG HTXDO HPSOR\PHQWRSSRUWXQLWLHV % 7D[HV(PSOR\HH%HQHILWV &RQWUDFWRUVKDOOSD\DWLWVRZQH[SHQVHDWQRFRVWWRWKH&LW\DQGZLWKRXWDGMXVWPHQWWRWKH&RQWUDFW 6XPDOOORFDOVWDWHDQGIHGHUDOWD[HVLQFOXGLQJZLWKRXWOLPLWDWLRQDOOVDOHVFRQVXPHUEXVLQHVV OLFHQVHXVHDQGVLPLODUWD[HVRQPDWHULDOVODERURURWKHULWHPVIXUQLVKHGIRUWKH:RUNRUSRUWLRQV WKHUHRISURYLGHGE\&RQWUDFWRURU6XEFRQWUDFWRUVDOOWD[HVDULVLQJRXWRILWVRSHUDWLRQVXQGHUWKH &RQWUDFW'RFXPHQWVDQGDOOEHQHILWVLQVXUDQFHWD[HVDQGFRQWULEXWLRQVIRUVRFLDOVHFXULW\DQG XQHPSOR\PHQWLQVXUDQFHZKLFKDUHPHDVXUHGE\ZDJHVVDODULHVRURWKHUUHPXQHUDWLRQSDLGWR &RQWUDFWRU VHPSOR\HHV,IXQGHUIHGHUDOH[FLVHWD[ODZDQ\WUDQVDFWLRQKHUHXQGHUFRQVWLWXWHVDVDOH RQZKLFKDIHGHUDOH[FLVHWD[LVLPSRVHGDQGWKHVDOHLVH[HPSWIURPVXFKH[FLVHWD[EHFDXVHLWLVD VDOHIRULWVH[FOXVLYHXVHWKHQ&LW\XSRQUHTXHVWZLOOH[HFXWHGRFXPHQWVQHFHVVDU\WRVKRZWKDWLVD SROLWLFDOVXEGLYLVLRQRIWKH6WDWHIRUWKHSXUSRVHVRIVXFKH[HPSWLRQDQGWKDWWKHVDOHLVIRUWKHH[FOXVLYH XVHRIWKH&LW\LQZKLFKFDVHQRH[FLVHWD[IRUVXFKPDWHULDOVVKDOOEHLQFOXGHGLQWKH%LGRU&RQWUDFW 6XP & 1RWLFHRI9LRODWLRQV &RQWUDFWRUVKDOOLPPHGLDWHO\QRWLI\WKH&LW\DQG'LUHFWRULQZULWLQJRIDQ\LQVWUXFWLRQUHFHLYHGIURPWKH &LW\'LUHFWRU$UFKLWHFWRURWKHUSHUVRQRUHQWLW\WKDWLILPSOHPHQWHGZRXOGFDXVHDYLRODWLRQRIDQ\ DSSOLFDEOHODZRUODZIXORUGHURIDJRYHUQPHQWDODXWKRULW\,I&RQWUDFWRUIDLOVWRSURYLGHVXFKQRWLFH WKHQ'LUHFWRUVKDOOEHHQWLWOHGWRDVVXPHWKDWVXFKLQVWUXFWLRQLVLQFRPSOLDQFHZLWKDSSOLFDEOHODZVDQG ODZIXORUGHUVRIJRYHUQPHQWDODXWKRULWLHV,I&RQWUDFWRUREVHUYHVWKDWDQ\SRUWLRQRIWKH'UDZLQJVDQG 6SHFLILFDWLRQVRU:RUNDUHDWYDULDQFHZLWKDSSOLFDEOHODZVRUODZIXORUGHUVRIJRYHUQPHQWDODXWKRULWLHV RUVKRXOG&RQWUDFWRUEHFRPHDZDUHRIFRQGLWLRQVQRWFRYHUHGE\WKH&RQWUDFW'RFXPHQWVZKLFKZLOO UHVXOWLQ:RUNEHLQJDWYDULDQFHWKHUHZLWK&RQWUDFWRUVKDOOSURPSWO\QRWLI\'LUHFWRULQZULWLQJ,IZLWKRXW VXFKQRWLFHWR'LUHFWRU&RQWUDFWRURUDQ\6XEFRQWUDFWRUSHUIRUPVDQ\:RUNZKLFKLWNQHZRUWKURXJK WKHH[HUFLVHRIUHDVRQDEOHFDUHVKRXOGKDYHNQRZQZDVFRQWUDU\WRODZIXORUGHUVRIJRYHUQPHQWDO DXWKRULWLHVRUDSSOLFDEOHODZVWKHQ&RQWUDFWRUVKDOOEHDUDOOUHVXOWLQJORVVHVDWLWVRZQH[SHQVHDWQR FRVWWR&LW\DQGZLWKRXWDGMXVWPHQWWRWKH&RQWUDFW6XP 2:1(56+,32)'(6,*1'2&80(176 $ 3URSHUW\RI&LW\ $OO'HVLJQ'RFXPHQWV&RQWUDFW'RFXPHQWVDQG6XEPLWWDOV LQFOXGLQJZLWKRXWOLPLWDWLRQDOOFRSLHV WKHUHRI DQGDOOGHVLJQVDQGEXLOGLQJGHVLJQVGHSLFWHGWKHUHLQDUHDQGVKDOOUHPDLQWKHVROHDQG H[FOXVLYHSURSHUW\RIWKH&LW\DQGWKH&LW\VKDOOVROHO\DQGH[FOXVLYHO\KROGDOOFRS\ULJKWVWKHUHWR :LWKRXWGHURJDWLRQWKH&LW\¶VULJKWVXQGHUWKLV3DUDJUDSKWKH&RQWUDFWRUDQG6XEFRQWUDFWRUVDUH Western Allied Corporation Page 93 of 221 . . Item 10 Page 93 of 221 JUDQWHGDOLPLWHGQRQH[FOXVLYHOLFHQVHUHYRFDEOHDWZLOORI&LW\WRXVHDQGUHSURGXFHDSSOLFDEOH SRUWLRQVRIWKH&RQWUDFW'RFXPHQWVDQG6XEPLWWDOVDVDSSURSULDWHWRDQGIRUXVHLQWKHH[HFXWLRQRI WKH:RUNDQGIRUQRRWKHUSXUSRVH % 'RFXPHQWVRQ6LWH &RQWUDFWRUVKDOONHHSRQWKH3URMHFWVLWHDWDOOWLPHVDQGIRUXVHE\&LW\'LUHFWRU,QVSHFWRUVRI5HFRUG DQG&LW\¶V&RQVXOWDQWVDFRPSOHWHVHWRIWKH&RQWUDFW'RFXPHQWVWKDWKDYHEHHQDSSURYHGE\ DSSOLFDEOH*RYHUQPHQWDO$XWKRULWLHV & 'HOLYHU\WR&LW\ $OO'HVLJQ'RFXPHQWV&RQWUDFW'RFXPHQWVDQG6XEPLWWDOVLQWKHSRVVHVVLRQRI&RQWUDFWRURU 6XEFRQWUDFWRUVVKDOOEHUHWXUQHGWRWKH&LW\XSRQWKHHDUOLHURI)LQDO&RPSOHWLRQRUWHUPLQDWLRQRIWKH &RQVWUXFWLRQ&RQWUDFW SURYLGHGKRZHYHUWKDW&RQWUDFWRUDQGHDFK6XEFRQWUDFWRUVKDOOKDYHWKHULJKW WRUHWDLQRQH FRS\RIWKH&RQWUDFW'RFXPHQWVDQG6XEPLWWDOVIRULWVSHUPDQHQWUHFRUGV ' 6XEFRQWUDFWRUV &RQWUDFWRUVKDOOWDNHDOOQHFHVVDU\VWHSVWRDVVXUHWKDWDSURYLVLRQLVLQFOXGHGLQDOOVXEFRQWUDFWVZLWK 6XEFRQWUDFWRUVRIHYHU\WLHUZKRSHUIRUP:RUNRQWKH3URMHFWHVWDEOLVKLQJSURWHFWLQJDQGSUHVHUYLQJ WKH&LW\¶VULJKWVVHWIRUWKLQWKLV3DUDJUDSK $0(1'0(176 7KH&RQWUDFW'RFXPHQWVPD\EHDPHQGHGRQO\E\DZULWWHQLQVWUXPHQWGXO\H[HFXWHGE\WKHSDUWLHVRUWKHLU UHVSHFWLYHVXFFHVVRUVRUDVVLJQV :$,9(5 (LWKHUSDUW\ VZDLYHURIDQ\EUHDFKRUIDLOXUHWRHQIRUFHDQ\RIWKHWHUPVFRYHQDQWVFRQGLWLRQVRURWKHU SURYLVLRQVRIWKH&RQWUDFW'RFXPHQWVDWDQ\WLPHVKDOOQRWLQDQ\ZD\OLPLWRUZDLYHWKDWSDUW\ VULJKWWKHUHDIWHU WRHQIRUFHRUFRPSHOVWULFWFRPSOLDQFHZLWKHYHU\WHUPFRYHQDQWFRQGLWLRQRURWKHUSURYLVLRQDQ\FRXUVHRI GHDOLQJ RU FXVWRP RI WKH WUDGH QRWZLWKVWDQGLQJ )XUWKHUPRUH LI WKH SDUWLHV PDNH DQG LPSOHPHQW DQ\ LQWHUSUHWDWLRQRIWKH&RQWUDFW'RFXPHQWVZLWKRXWGRFXPHQWLQJVXFKLQWHUSUHWDWLRQE\DQLQVWUXPHQWLQZULWLQJ VLJQHGE\ERWKSDUWLHVVXFKLQWHUSUHWDWLRQDQGLPSOHPHQWDWLRQWKHUHRIZLOOQRWEHELQGLQJLQWKHHYHQWRIDQ\ IXWXUHGLVSXWHV ,1'(3(1'(17&2175$&725 &RQWUDFWRULVDQLQGHSHQGHQWFRQWUDFWRUDQGQRWKLQJFRQWDLQHGLQWKH&RQWUDFW'RFXPHQWVVKDOOEHFRQVWUXHG DVFRQVWLWXWLQJDQ\UHODWLRQVKLSZLWK&LW\RWKHUWKDQWKDWRI3URMHFWRZQHUDQGLQGHSHQGHQWFRQWUDFWRU,QQR HYHQWVKDOOWKHUHODWLRQVKLSEHWZHHQ&LW\DQG&RQWUDFWRUEHFRQVWUXHGDVFUHDWLQJDQ\UHODWLRQVKLSZKDWVRHYHU EHWZHHQ&LW\DQG&RQWUDFWRU VHPSOR\HHV1HLWKHU&RQWUDFWRUQRUDQ\RILWVHPSOR\HHVLVRUVKDOOEHGHHPHG WREHDQHPSOR\HHRI&LW\([FHSWDVRWKHUZLVHVSHFLILHGLQWKH&RQWUDFW'RFXPHQWV&RQWUDFWRUKDVVROH DXWKRULW\DQGUHVSRQVLELOLW\WRHPSOR\GLVFKDUJHDQGRWKHUZLVHFRQWUROLWVHPSOR\HHVDQGKDVFRPSOHWHDQG VROHUHVSRQVLELOLW\DVDSULQFLSDOIRULWVDJHQWVIRUDOO6XEFRQWUDFWRUVDQGIRUDOORWKHU3HUVRQVWKDW&RQWUDFWRU RUDQ\6XEFRQWUDFWRUKLUHVWRSHUIRUPRUDVVLVWLQSHUIRUPLQJWKH:RUN Western Allied Corporation Page 94 of 221 . . Item 10 Page 94 of 221 68&&(66256$1'$66,*16 7KH&RQWUDFW'RFXPHQWVVKDOOEHELQGLQJXSRQDQGLQXUHWRWKHEHQHILWRI&LW\DQG&RQWUDFWRUDQGWKHLU SHUPLWWHGVXFFHVVRUVDVVLJQVDQGOHJDOUHSUHVHQWDWLYHV $ &LW\PD\DVVLJQDOORUSDUWRILWVULJKWWLWOHDQGLQWHUHVWLQDQGWRDQ\&RQWUDFW'RFXPHQWVLQFOXGLQJ ULJKWVZLWKUHVSHFWWRWKH3D\PHQWDQG3HUIRUPDQFH%RQGVWR D DQ\RWKHUJRYHUQPHQWDOSHUVRQ DVSHUPLWWHGE\JRYHUQPHQWDOUXOHVSURYLGHGWKDWWKHVXFFHVVRURUDVVLJQHHKDVDVVXPHGDOORI &LW\ VREOLJDWLRQVGXWLHVDQGOLDELOLWLHVXQGHUWKH&RQWUDFW'RFXPHQWWKHQLQHIIHFW DQG E DQ\RWKHU 3HUVRQZLWKWKHSULRUZULWWHQDSSURYDORI&RQWUDFWRU % &RQWUDFWRUPD\FROODWHUDOO\DVVLJQLWVULJKWVWRUHFHLYHSD\PHQWXQGHUWKH&RQWUDFW'RFXPHQWV &RQWUDFWRUPD\QRWGHOHJDWHDQ\RILWVGXWLHVKHUHXQGHUH[FHSWWR6XEFRQWUDFWRUVDVH[SUHVVO\ RWKHUZLVHSHUPLWWHGLQWKH&RQWUDFW'RFXPHQWV&RQWUDFWRU VDVVLJQPHQWRUGHOHJDWLRQRIDQ\RILWV :RUNXQGHUWKH&RQWUDFW'RFXPHQWVVKDOOEHLQHIIHFWLYHWRUHOLHYH&RQWUDFWRURILWVUHVSRQVLELOLW\IRU WKH:RUNDVVLJQHGRUGHOHJDWHGXQOHVV&LW\LQLWVVROHGLVFUHWLRQKDVDSSURYHGVXFKUHOLHIIURP UHVSRQVLELOLW\ $Q\DVVLJQPHQWRIPRQH\VKDOOEHVXEMHFWWRDOOSURSHUVHWRIIVDQGZLWKKROGLQJVLQIDYRURI&LW\DQG WRDOOGHGXFWLRQVSURYLGHGIRULQWKH&RQWUDFW$OOPRQH\ZLWKKHOGZKHWKHUDVVLJQHGRUQRWVKDOOEH VXEMHFWWREHLQJXVHGE\&LW\IRUFRPSOHWLRQRIWKH:RUNVKRXOG&RQWUDFWRUEHLQGHIDXOW & ([FHSWIRUWKHOLPLWHGFLUFXPVWDQFHVVHWIRUWKLQ3DUDJUDSK%DERYH&RQWUDFWRUPD\QRW ZLWKRXWWKHSULRUZULWWHQFRQVHQWRI&LW\LQLWVVROHGLVFUHWLRQYROXQWDULO\RULQYROXQWDULO\DVVLJQ FRQYH\WUDQVIHUSOHGJHPRUWJDJHRURWKHUZLVHHQFXPEHULWVULJKWVRULQWHUHVWVXQGHUWKH&RQWUDFW 'RFXPHQWV1RSDUWQHUMRLQWYHQWXUHUPHPEHURUVKDUHKROGHURI&RQWUDFWRUPD\DVVLJQFRQYH\ WUDQVIHUSOHGJHPRUWJDJHRURWKHUZLVHHQFXPEHULWVRZQHUVKLSLQWHUHVWLQ&RQWUDFWRUZLWKRXWWKH SULRUZULWWHQFRQVHQWRI&LW\LQ&LW\¶VVROHGLVFUHWLRQ 6859,9$/ &RQWUDFWRU¶VUHSUHVHQWDWLRQVDQGZDUUDQWLHVWKHGLVSXWHUHVROXWLRQSURYLVLRQVFRQWDLQHGLQ$UWLFOHDQGDOO RWKHUSURYLVLRQVZKLFKE\WKHLULQKHUHQWFKDUDFWHUVKRXOGVXUYLYHWHUPLQDWLRQRIWKH&RQWUDFWDQGRU)LQDO $FFHSWDQFHVKDOOVXUYLYHWKHWHUPLQDWLRQRIWKH&RQWUDFWDQGWKH)LQDO$FFHSWDQFH'DWH /,0,7$7,21217+,5'3$57<%(1(),&,$5,(6 ,WLVQRWLQWHQGHGE\DQ\RIWKHSURYLVLRQVRIWKH&RQWUDFW'RFXPHQWVWRFUHDWHDQ\WKLUGSDUW\EHQHILFLDU\ KHUHXQGHURUWRDXWKRUL]HDQ\RQHQRWDSDUW\KHUHWRWRPDLQWDLQDVXLWIRUSHUVRQDOLQMXU\RUSURSHUW\GDPDJH SXUVXDQWWRWKHWHUPVRUSURYLVLRQVKHUHRIH[FHSWWRWKHH[WHQWWKDWVSHFLILFSURYLVLRQV VXFKDVWKHZDUUDQW\ DQGLQGHPQLW\SURYLVLRQV LGHQWLI\WKLUGSDUWLHVDQGVWDWHWKDWWKH\DUHHQWLWOHGWREHQHILWVKHUHXQGHU7KH GXWLHVREOLJDWLRQVDQGUHVSRQVLELOLWLHVRIWKHSDUWLHVWRWKH&RQWUDFW'RFXPHQWVZLWKUHVSHFWWRVXFKWKLUG SDUWLHVVKDOOUHPDLQDVLPSRVHGE\ODZ7KH&RQWUDFW'RFXPHQWVVKDOOQRWEHFRQVWUXHGWRFUHDWHDFRQWUDFWXDO UHODWLRQVKLSRIDQ\NLQGEHWZHHQ&LW\DQGD6XEFRQWUDFWRURUDQ\RWKHU3HUVRQH[FHSW&RQWUDFWRU 3(5621$//,$%,/,7<2)&,7<(03/2<((6 &LW\¶VDXWKRUL]HGUHSUHVHQWDWLYHVDUHDFWLQJVROHO\DVDJHQWVDQGUHSUHVHQWDWLYHVRI&LW\ZKHQFDUU\LQJRXW WKHSURYLVLRQVRIRUH[HUFLVLQJWKHSRZHURUDXWKRULW\JUDQWHGWRWKHPXQGHUWKH&RQWUDFW7KH\VKDOOQRWEH OLDEOHHLWKHUSHUVRQDOO\RUDVHPSOR\HHVRI&LW\IRUDFWLRQVLQWKHLURUGLQDU\FRXUVHRIHPSOR\PHQW Western Allied Corporation Page 95 of 221 . . Item 10 Page 95 of 221 1RDJHQWFRQVXOWDQW&RXQFLOPHPEHURIILFHURUDXWKRUL]HGHPSOR\HHRI&LW\VKDOOEHSHUVRQDOO\UHVSRQVLEOH IRUDQ\OLDELOLW\DULVLQJXQGHUWKH&RQWUDFW 12(67233(/ &LW\VKDOOQRWQRUVKDOODQ\RIILFHUWKHUHRIEHSUHFOXGHGRUHVWRSSHGE\DQ\PHDVXUHPHQWHVWLPDWHRU FHUWLILFDWHPDGHRUJLYHQE\WKH&LW\UHSUHVHQWDWLYHRURWKHURIILFHUDJHQWRUHPSOR\HHRI&LW\XQGHUDQ\ SURYLVLRQVRIWKH&RQWUDFWIURPDWDQ\WLPH HLWKHUEHIRUHRUDIWHUWKHILQDOFRPSOHWLRQDQGDFFHSWDQFHRIWKH :RUNDQGSD\PHQWWKHUHIRU SXUVXDQWWRDQ\VXFKPHDVXUHPHQWHVWLPDWHRUFHUWLILFDWHVKRZLQJWKHWUXHDQG FRUUHFWDPRXQWDQGFKDUDFWHURIWKHZRUNGRQHDQGPDWHULDOVIXUQLVKHGE\&RQWUDFWRURUDQ\SHUVRQXQGHU WKH&RQWUDFWRUIURPVKRZLQJDWDQ\WLPHWKDWDQ\VXFKPHDVXUHPHQWHVWLPDWHRUFHUWLILFDWHLVXQWUXHDQG LQFRUUHFWRULPSURSHUO\PDGHLQDQ\SDUWLFXODURUWKDWWKHZRUNDQGPDWHULDOVRUDQ\SDUWWKHUHRIGRQRWLQ IDFWFRQIRUPWRWKH&RQWUDFW'RFXPHQWV1RWZLWKVWDQGLQJDQ\VXFKPHDVXUHPHQWHVWLPDWHRUFHUWLILFDWHRU SD\PHQWPDGHLQDFFRUGDQFHWKHUHZLWK&LW\VKDOOQRWEHSUHFOXGHGRUHVWRSSHGIURPUHFRYHULQJIURP &RQWUDFWRUDQGLWV6XUHWLHVVXFKGDPDJHVDV&LW\PD\VXVWDLQE\UHDVRQRI&RQWUDFWRU¶VIDLOXUHWRFRPSO\RU WRKDYHFRPSOLHGZLWKWKH&RQWUDFW'RFXPHQWV *29(51,1*/$: 7KHODZVRIWKH6WDWHRI&DOLIRUQLDJRYHUQWKHFRQVWUXFWLRQDQGLQWHUSUHWDWLRQRIWKH&RQWUDFW'RFXPHQWV ZLWKRXWUHJDUGWRFRQIOLFWRIODZSULQFLSOHV 8QOHVVWKH&RQWUDFW'RFXPHQWVSURYLGHRWKHUZLVHDQ\UHIHUHQFH WRODZVRUGLQDQFHVUXOHVRUUHJXODWLRQV LQFOXGH WKHLU ODWHUDPHQGPHQW PRGLILFDWLRQV DQG VXFFHVVRU OHJLVODWLRQ ,I&RQWUDFWRURU&LW\EULQJVDODZVXLWWRHQIRUFHRULQWHUSUHWRQHRUPRUHSURYLVLRQVRIWKH&RQWUDFW 'RFXPHQWVMXULVGLFWLRQLVLQWKH6XSHULRU&RXUWRIWKH&RXQW\RI/RV$QJHOHV&DOLIRUQLDRUZKHUHRWKHUZLVH DSSURSULDWHLQWKH8QLWHG6WDWHV'LVWULFW&RXUW&HQWUDO'LVWULFWRI&DOLIRUQLD&RQWUDFWRUDQG&LW\DFNQRZOHGJH WKDWWKH&RQWUDFW'RFXPHQWVZHUHQHJRWLDWHGHQWHUHGLQWRDQGH[HFXWHG²DQGWKH:RUNZDVSHUIRUPHG²LQ WKH&LW\RI9HUQRQ&DOLIRUQLD )857+(5$6685$1&(6 &RQWUDFWRU VKDOO SURPSWO\ H[HFXWH DQG GHOLYHU WR &LW\ DOO VXFKLQVWUXPHQWV DQG RWKHU GRFXPHQWV DQG DVVXUDQFHVDVDUHUHDVRQDEO\UHTXHVWHGE\&LW\WRIXUWKHUHYLGHQFHWKHREOLJDWLRQVRI&RQWUDFWRUKHUHXQGHU LQFOXGLQJDVVXUDQFHVUHJDUGLQJDVVLJQPHQWVRI6XEFRQWUDFWRUVFRQWDLQHGKHUHLQ 6(9(5$%,/,7< ,IDQ\FODXVHSURYLVLRQVHFWLRQSDUDJUDSKRUSDUWRIWKH&RQWUDFWLVUXOHGLQYDOLGE\DFRXUWKDYLQJSURSHU MXULVGLFWLRQWKHQWKHSDUWLHVVKDOO D SURPSWO\PHHWDQGQHJRWLDWHDVXEVWLWXWHIRUVXFKFODXVHSURYLVLRQ VHFWLRQSDUDJUDSKRUSDUWZKLFKVKDOOWRWKHJUHDWHVWH[WHQWOHJDOO\SHUPLVVLEOHHIIHFWWKHRULJLQDOLQWHQWRI WKHSDUWLHVLQFOXGLQJDQHTXLWDEOHDGMXVWPHQWWRWKH&RQWUDFW3ULFHWRDFFRXQWIRUDQ\FKDQJHLQWKH:RUN UHVXOWLQJIURPVXFKLQYDOLGDWHGSRUWLRQ DQG E LIQHFHVVDU\RUGHVLUDEOHDSSO\WRWKHFRXUWRURWKHUGHFLVLRQ PDNHU DVDSSOLFDEOH ZKLFKGHFODUHGVXFKLQYDOLGLW\IRUDQLQWHUSUHWDWLRQRIWKHLQYDOLGDWHGSRUWLRQWRJXLGH WKHQHJRWLDWLRQV7KHLQYDOLGLW\RUXQHQIRUFHDELOLW\RIDQ\VXFKFODXVHSURYLVLRQVHFWLRQSDUDJUDSKRUSDUW VKDOOQRWDIIHFWWKHYDOLGLW\RUHQIRUFHDELOLW\RIWKHEDODQFHRIWKH&RQWUDFWZKLFKVKDOOEHFRQVWUXHGDQG HQIRUFHGDVLIWKH&RQWUDFWGLGQRWFRQWDLQVXFKLQYDOLGRUXQHQIRUFHDEOHFODXVHSURYLVLRQVHFWLRQSDUDJUDSK RUSDUW Western Allied Corporation Page 96 of 221 . . Item 10 Page 96 of 221 +($',1*6 7KHFDSWLRQVRIWKHVHFWLRQVRIWKH&RQWUDFWDUHIRUFRQYHQLHQFHRQO\DQGVKDOOQRWEHGHHPHGSDUWRIWKH &RQWUDFWRUFRQVLGHUHGLQFRQVWUXLQJWKH&RQWUDFW (17,5($*5((0(17 7KH&RQWUDFW'RFXPHQWVFRQWDLQWKHHQWLUHXQGHUVWDQGLQJRIWKHSDUWLHVZLWKUHVSHFWWRWKHVXEMHFWPDWWHU KHUHRIDQGVXSHUVHGHDOOSULRUDJUHHPHQWVXQGHUVWDQGLQJVVWDWHPHQWVUHSUHVHQWDWLRQVDQGQHJRWLDWLRQV EHWZHHQWKHSDUWLHVZLWKUHVSHFWWRLWVVXEMHFWPDWWHU &2817(53$576 7KLVLQVWUXPHQWPD\EHH[HFXWHGLQWZRRUPRUHFRXQWHUSDUWVHDFKRIZKLFKVKDOOEHGHHPHGDQRULJLQDOEXW DOORIZKLFKWRJHWKHUVKDOOFRQVWLWXWHRQHDQGWKHVDPHLQVWUXPHQW >(1'2)$57,&/(@ Western Allied Corporation Page 97 of 221 . . Item 10 Page 97 of 221 #ö>-ö d ./ <ö 6x ö)eö^[ õD"T TôTTö ö[ö #_öEr 3ö*ö K"c Wc""/ö £ï8C2öÉöG& Q 8 ö d-n ö ööo ö ÃP ö!~ ,ö ö4 öö °¤=@)i²eö Z+&ö 5 2ö0 Q öK" ;öf &8ö 5Rö? öfö?Q s+ö05ö<;D !>ö öö ö ö Jö !:;", < U;/ .!6 ,öö ö ! ö] ,ö zö öHÓöö %öö Ä4ö 0 Sö F wö F´50ö ?S+Oö ¨OQ& ROöU 0 Sö 0 â 8ö ¬ -ö "" W<ö ( Æ ö M-öµ¶[· pA11AA 111111Iö öo ö)Vö 6 ö ö Þé ö ö ö ö ö ö ööö ö yö öÊö ö! ö* ,ö öö½ö ö6 Üö ö öö öHàv- V N ö öö ö* ö öö öööö ö ö ö ö#ö öö öÂöËö%ö Ìö - '#iLY)NL'ö @§EmEg'mEö ö3ö 39öH9ö¯ öö Gtö F R&ö ©+C& 8ö 0 OÝ ñö öj 8 ö?&öZ &8+&öl5öK;:/ö !>yö ö»ö ö ö(Jö ¸!}D 7. },7 7 .7:U7/7W7 "öI\¹$$$$$$$$$$$$º\\IIIqö!(ê ,ë ö ö öö `ö4öööP4ö #ö ö#9öHöÒ öö3ö% öÖö% öÛ{ 3öÚö öá Ï3ö Á öð 9ö 9öî ö ö ööö ö ööìö ö X CöFC22öG|òö® öGu í+ 2öG| öFC2&2ö X &SöX Rö 2ö .ö p AABBBBBBAqö*ö ^ ö "<" :ö ö !] ö#ö(Jö öö ööö ö öö ö(ö ö4{ööö ö³ ö(öö) -ö @ ök ö)örP ö(ö ö l &t ö¥ ó +aö ;//öZö :uö ?aö ?C ö ."böj +ö5sÔ+bö 05ö<D .ö !Mö öö ¾ö ,ö ± ö)ö ö*zöö= öªÐ ö>-ö ¢/DK:ö nhEö'M*=@L'>ö'gö@h=(ö#'>*(ö'#k=Y)NL'Mö =(ö@¦)Nö ö6 ö öö È Õö ö ö èv ö ö 3×ö Øööö ö ö öö ö* ö! öö öööxÙçäJ9ö ¼ö4 ö ö öö ö ö ö ö ö ö Çö ö ö% ö% öwöö3 Vö' 4 ö ö#ö ö öö ööÅ öö ö4 ö åöö ööö ö#¡ö . Íæö #ö ö ö 6 `öã öö ö % öö ö% ö ö ö ö ö* öö öö%ö¿ööö ö%öö öö6 _ö % Îö P ö ß À öH öY ö öö« ö% Ñöö ö ö ö öö Western Allied Corporation Page 98 of 221 . . Item 10 Page 98 of 221 8~FsKx¥K¢FK¥X?¥=K£¥~?i¥~¥¥[W?Z~x¥?¥HKFZAKH¥XKK¥¡cji¥x~¥K¢FKKH¥XK¥6~yHKH¥=s ¥ ) 9~¥X~K¥~Bj[¥?Z~x¥~M¥<[xF[?j¥X?¥ZK¥9[x?i¥7~tjK[~x¥XK¥>~h¥HKFZBKH¥[y¥XK¥7~x?F¥?yH¥7~y?F¥8~FsKx XK¥W??xKK¥[z¥X[¥6~xH¥?j~¥ZK¥9Zy?i¥7~t¥K[~y¥~L¥XK¥>~h * >XKy¥ 7[£¥ HKFj?K¥X?¥ <[xF[?k¥ [¥ Zx¥HKSi¥ yHK¥XK¥7~x?F¥ ~¥ 7~y?F¥ 8~FsKx¥ ~¥B~X¥=K£¥ X@ii ~tl£0¥ ?¥KtKH£¥XK¥HKM?i2¥ B¥F~siKK¥XK¥<~gKF¥?FF~¥ ¤yW¥~¥XK¥7~x?F¥8~FsKx¥Kt¥?yH¥F~yHZ[~x¥XKx \x¥KTKF3¥~¥ F¥]yW¥?¥~FKsKx¥tKX~H~l~W£¥?~KH¥B£¥7Z£¥KmKF¥?¥F~x?F~¥~¥F~x?F~¥?FFK?BiK¥~¥7Z£¥~ F~tjKK¥?jj¥~M¥XK¥>~h¥?xH¥??yWK¥Q~¥?¥F~x?F¥BK¡KKx¥XK¥F~x?F~ ¥?xH¥7[£ ¥ =K£¥X?rq¥s?hK¥? ?n¥CoK¥?¥XK >~h¥~WKK¥VF[Kx¥MxH¥~¥?£¥XK¥F~¥~O¥F~tiKZ~x¥iK¥XK¥B?j?xFK¥~M¥XK¥7y?F¥=t¥?yH¥~¥?£¥?xI¥K~t ?li¥~BldW?Z~y¥~M¥<[yF[?i¥yHK¥XK¥7~x?F¥?xH¥7~x?F¥8~FsK{¥[yFiHZxW¥~XK¥F~¥?xH¥H?u?WK¥M~¥¡X[FY¥=K£ [¥iZ?BpK¥xHK¥X[¥6~yH¥K¢FK¥X?¥=K£¥~?i¥~BjZW?[~x¥?¥HKFZBKH¥XKK¥¡[jk¥x~¥K¢FKKH¥XK¥6~yHKH¥=s! +"5x¥ ?iK?[~x¥ t~H[MZF?^~x¥FX?yWK¥?HH[Z~x¥ HKiK[~y¥ ~s[[~y¥ ?WKKtKx¥ ~¥ jKsKy¥ ~¥XK¥7~x?F¥ 7~x?F 8~FtKy¥~¥XK¥y?K¥~M¥XK¥>~h¥KR~sKH¥xJK¥XK¥7~y?F¥~¥7~y?F¥8~FsKx¥_yFrH[xW¥¡[X~¥i`tZ?_~y¥?x K¢K{[~y¥~O¥ZtK¥M¥KM~s?xFK¥H~K¥x~¥Zy¥?y£¥¡?£¥?UKF¥=K£¥~Bi[W?[~x¥xHK¥X[¥6~xH#¥=K£¥¡?ZK¥?y£¥y~ZFK ~M¥?iK?[~x¥s~H[LZF?Z~x¥GX?yWK¥?HH[[~x¥HKmK[~x¥vZZ~x¥?WKKwKy¥iKtKy¥~¥K¢KxZ~x¥~L¥ZtK# , =K£¥~DqZW?[~x¥xHK¥X[¥6~yH¥?K¥K??K¥[xHKKyHKx¥L~t ¥?xH¥|~¥F~yaxWKx¥~x¥?x£¥~XK¥K£¥W??xKK[xW <[xFe?j ¥N?[XMq¥KL~t?xFK¥~M¥XK¥>~h$ - ;~¥[WX¥~O¥?F[~x¥?FFK¥~y¥X[¥6~xH¥~¥?y£¥Kx[£¥~XK¥X?y¥7Z£¥~¥[¥FFK~¥?}H¥?ZWx% . :O¥?y¥?F[~y¥?¥i?¡¥~¥by¥K[£¥[¥xKFK?£¥~¥KxMFK¥~¥[xKK¥X[¥6~xH¥Ks¥=K£¥t¥?£¥Zx¥?HH[Z~x¥~¥XK¥6~xHKH =s¥7Z£¥K?~x?BlK¥?~yK£¥MKK¥?xH¥i[ZW?[~x¥F~¥[y¥?x¥?s~y¥XK¥F~¥PZ¢K! /&=K£¥X?kj¥t?[i¥7Z£¥¡ZKx¥x~[FK¥?¥ K?¥*(¥H?£¥BKO~K1¥?¥XK¥KOOKF[K¥H?K¥~x¥¡X[FX¥XK¥=K£¥¡fij¥F?yFKi¥KsZx?K ~¥¡[XH?¡¥M~t¥X[¥6~yH4¥~¥E¥X[¥6~xH¥BKF~tK¥~ZH¥~¥yKyM~FK?BjK¥O¥?y£¥K?~x' Western Allied Corporation Page 99 of 221 . . Item 10 Page 99 of 221 <v¤ia¤^Va¤a¤g}i¤Yao{¤>kv[lVp¤Vv^¤@a ¤^o ¤aa[a^¤ik¤ ¤li¤ia¤vVsa¤{e¤aV[i¤V ¤VaV lwh¤ Yap{¤Vv^¤khva^¤Y ¤l¤aaavVla¤v^a¤ia¤Vi{k ¤{f¤k¤h{a vlvh¤Y{^ ¤ (Va ¤ )b\btZb¤ ¤¤ >?3:%4>"6 ¤ Jbbx¤#rokb_¤&||Wl|x¤ {sVv ¤;Vsa¤ @khvVa¤ ~`cA*¤¤ ¤d¤ ;Vsa¤Xv^¤Dkoa¤ "^^ a¤g}¤@alvh¤;{]a¤{¤<ia¤({[sav ¤ (&8 8 0&(8 84 0(8 8."1 8) @G?,FL ¤ Cjb¤2Wx|b¤5xWx\b¤&|tWx¡¤ $ ¤ 8WjW¤1|x£Wpb ¤#|xb¢lx.W\¤ ;Vsa¤Vv^¤Elpa¤ "^^a¤g{ ¤@akvh¤;{m[a¤{ ¤<ia ¤({[uav ¤ ¤7my\|qy¤Bbb¤ J|\bb¤ 8#¤¤ 2 8 0&(8 8 8(+8 8 8(8 0( $(58 8 58"$& 8& 8 &8 (( $ 6 - (8 (,!$ 6 *'8& (0$8 0&(8 8 ( $7 8 $" %8(8& 8 0&(8 8 "$&&8 8(&8 $ 83 8(8"$ # 8 $8(8&0$/8 $8 )8 $8 $" $ ( ">>?<H-+¤"@¤F<¤@G?,DL¤";(¤ "9<G;F¤</¤$<;+-(¤@G9 ¤ $ ¤NOOOOOOPPQQQQR +Vz¤KVpo ¤>Ypl[¤K{n¤+la[{ ¤ ">>?<I,(¤"@¤D=¤0<?9 ¤ $ !¤NOSOOOOOOOOOT¤U¤ MV vVi¤:¤9{V¤'l ¤"{va ¤ Western Allied Corporation Page 100 of 221 . . Item 10 Page 100 of 221 ( %% ( #$ ( % $'( !& %( 51¾-16N.'0 1D¾ "7?¾ BL@ EOB¾JK8?2 P (¾ #F¾ CGH ¾5$¾¾ $9A3)¾ 7M4FO¾8%¾ ¾¦¦¾ ¾ 5¾§tz¦¾RST¾bW¹¾l SSSSS T¾¾¾UV¾¾ ]fqh¾g¾ ½ Xh¾W¾1¨W£¹¾;´]z`¾m£¾¦W{b¾°©¹¾h¦W¹¾ YhWhc¾Wh¾¸t¾µhb¾§¾i¾¾§uh¾]W¦z¦¾l¾ ¦Z§|¦lW_© ¹¾h¶}bh`h¾©¾]h¾©tg¾h¦¾ ·v¦h¾[h¾z¦¾¦±]¦a z^jb¾©¾©w~¦¾|¦©±hª¾W¦¾§th¾W©©£hº¾z¾lW`§¾m¾ Wd¾W`¸hbrhb¾§¾h¾§vW©¾th¦vh¾¦²]¦`]he¾ ©vh Wh¾n¾«vhh§¾W¦¾ ~`zW ¾Wb¾t¦xh¾¸¾Wh¾\¦¾ W¾++¾¾£¾k¾»¾z¾oW`©¾ *¾`h£©p¼¾³bg¡¾< 2/¾IQ¾:&¾=!?,M?O¾±bh¢¾©vh¾ W¸¦¾l¾©¯¾ B¬W©h¾l¾W zp¥~W¾yW©¾§th¾phrzr¾W£Ws£Ww¾¦¾§±h¾ Wb¾`¤£h`®¾ 1©Wº¾>´] |`¾ Western Allied Corporation Page 101 of 221 . . Item 10 Page 101 of 221 £{@£Dj\G££TK£MMiEK£Fq kK\{R£U]£GKhM\GAK£K^M\K£yl£VK£\IKz\£M£TK£h{I__IAm£T£\R{KI£VK£ IGrK|££W`GX£W\£GK\M\GAK£\£AAGXKI£A{I£{£YK£ZMm{K£AGGAG££Am_I_£M£TA£JGsK{£ 1zCzHnJ78 9C:a;VK<n=qi> V >C????@@A n~iznK *nx iPHaHx .iBBB **EHKnqHeH)CzR 0,CWq-nzCw/~Ed_F #2&2&+)/2 -" 2%2 , 212 ',)02 .! 2 oHqxniCbaCooHCqHG,CqzRC%niCbHy $*2& 2 %(*2 RnoqnHGznfHni{RHECxVxnLxC{XxKCFznrHYGHjFHznEHzRHoHqxnixRnxHkCeHxVxCqH x~ExFsXEHGznzRHXzRXiXix{q~fHi|CiGCF`lnbHGQHG|nfHzRC{RHxRHzRHHHF}HG{RHxCfH ZiSVxTHq zRHXtC~zRnuVHGFCoCFX{[Hx CiG{RC{ERXxTHq{RH\qxXQiC{~sHynj{RH]ixzq~gIi{ {RHpHqxnix nq{THHi|X{~oniEHRCaKnMR^FRzUHoHsxnixCF{HG HHFzHG{RHXix{q~hHi{ & FHqz^L ~iGHq /!- +26 .$ /"0(406~jGHq zRH cCx nL|RH1zC{H nN CaVKnvXC {RDz zTH OnsHQnVmQoCqCQqCoRVxzq~HCiGFnqqHFz 5'3-#11fRCiGCiGnKMVFXCbxHCb ,TRV£T\£KGa{£b£ c{Am£GtnK\{R£T]£\{MqA\{£GB{£IKK£AmKA\{£M£XK£IGuK{££ NAJmK{£KAAGXvK{£M£[_£Ou££A{£{d}K{JKI£IGqKz£ %$#& ! *"*'&* "( &* -]mK££. K£M£GuK{£3456455555577775833333333333£9£ GwK{£ AK£555555555:5;33333<£&uDK£M£*ASK£3333334£=£ +eR{K£)TK£/WA{£'AxKI£DK£3333333333333333333333334£5£ # &) %* *)* $%* +\R{K£(CuK£%ATA£ {¡AmK£ AK£)PQ\HK£ 0\oK£333333£>£*A~K #fq\KI£ K{KAm£!{I]fIAj£¢£ K _ AG£ 1KK£ AI\A{££{KA£ )TK£ +\R{K£&AqK£777777777777£=£ AK£)PM_GK£ 2\pjL£57?7738£>£*A{K£ $_qfKI£ K~KA£ "{IghIAm£ {K \{ AG£ /KK£ AIhA{££{KA£ )WK£ Western Allied Corporation Page 102 of 221 . . Item 10 Page 102 of 221 "ú1T¯ú --:/Eú ? (ú$(´úgú "ú5Ò 4ú% °ú .ª^«..:ú ¸õHJ =ú úP! e Ï&ú ?$Ây51)ú",ú %ú 8O$",Fú$1%úy$)5F0$O #ú po )ú úú} ú ' ú9 #úú2 úú F50)$O ±ú b7 !Yú>X=ú ; !ç !& Yú-./Dú Mc ! Hú>Z£úG&Y &úMúGè! Ô7ú;>úEDU 91Aú Aúúú'ú% l" # Ã9C~D<.<#<E/</<mÄD:Å/~-ú66666**Æú 8? [# ú 8 ú f#úIúúQ Sú R+ú æÛ2`ú ; Kú N&cú NÁ>;úGK7 dú 0de ZÞ ú; Kú; !&H ú { nú ../^E Ó ú1¤ú 6Ç È@@@@@6ú ú} ú$T qT ? ú ú ú ú ' ú 4 úú Rú_]]L_]ssúú ú ú'ú ú úúcú ú ú ú ú9 ú% f#úú úú+ú ú? R ú ú (3ú3ú ú ú ú' ú2 Sú+ úë ú( ú ú ú ú úíúXú úQIS¥ ro )ú úú ú% Aú ã ú ú ú(Ñúúú 3úIú ú ú ú"ú (úú úú ú+úRú \ ,"O0u$)0,1²ú )v5F5t,F5úIú4ú 4iúQú? úú PWú N& Z!úº 7J!& Hú; de& KBú //ú ½X H ú G ! Bú b !H7!Búz>ú-DC:ú 81(ú!úú úú #ú ¢9U<-</¡#ú </-ÉCÊmV:^V V.ú**********66Ë*Vú 8 [#júú ú ú äî ú ú ' hú2jú úú'2`ú "ú ú"iúQúÚ å úú4 Üú+ Õúú+ ú 4kúú ú 4ú Iú 3ú ú kú Ðú ú úú úúú (úú M J!úNJ = =úP Kú { úPW J7&Y=ú P úNï =!=úM Kú M Zú& =ú¬-ú Ì@ @ ÍÎú% 9gú /.E©.C¦ú ú9 ú"ú ðß[#Aú ú( ú × ú úúúúú ú ñ3ú ú2'úúú ú a ú úú$ Tú )úO ú$ ú ú öú `ú z& W&ú ¹ ù&7úD::úb\úC WúG ! BúGJ ú -.Bú¼ 7ú> Ö7Bú ;>úEU-ú 9|à3ú úú ú F R ú$ ú ú% áú'úxò ú ¨Xú|\ú ·:U-Cú )w5ú,1%0)0,1ú,túÀv0 ú",1%h ú,"¾»u$)0,1úx ú)w$)Aú ú¿ ú úú+ ú ú úú 8#ú ú úú ú ' ú ôØúú Ùú_®LLAú úú ú µú8+#úúúúó ú 'I úaé÷ ú0 ú 3ú ú ú ú ú ú2 Sú ú+ ú ú ú ú ú ú ú% ¶ú ú8#úúú ú aêø(ú0 úú ú prLqLú úú ú 3ú ú? ú úú+ úú 3ú 2 úúú4 úú ú5 ú%4ú% ú úú2 úú ú(ú ú2 Sú ú+ ú ' ú úú ú ú ú%úú ú úú ú úâú úú úl ú ú"ú §ú , ì 3ú ú+ ú+(úÝúú4 núQ ú ú"ú ( ú ú'ú úúúú'2 ú (úú ú úú ú"³ú Western Allied Corporation Page 103 of 221 . . Item 10 Page 103 of 221 '>@gr![T-rATkc1grh[rh>1r+1T16@ir[5r)Tqr[5rh>1r`1cg[TgrT)N1-r@Tr")F@5^cTA)r"An@Gr"[-1r&1,hA[Tr r[cr)Tqrgl,,1gg[crH1<@gI)i@[T =@nAT<ri>[g1r`1cg[Tgr[cr i>1@cr)ggA<Tgr)reA<>ir[5r),iA[Ur@Tr)TqrgmAhr+c[l<>irl`[Trh>Agr![T-rlTJ1ggr")F@:cTA)r"AnAIr"[-1r&1,i@[Tr [cr)Tqrgm,,1gg[crF2<@gF)hA[Tr)``F@1g Tr )Ii1c)hA[Tr O[-A5@,)i@[Tr ,>)T<1r )--Ai@[Tr -1I1iA[Tr [OAggA[Tr )<c11O1Tir [cr gm``F1O1Thr i[r i>1r "[Tic),jr "[Tic),h #_mO1Tigr[cri>1rT)hlc1r[6ri>1r([cEr`1c6[cO1-rlT-1crh>1r"[Tic),ir[cr "[Thc),ir$[,lP1TigrAT,Ll-@T<roAi>[lhrIAQ@i)hA[Tr)T 1pi1Tg@[Tr[5ri@O1r5[cr`1c5[cO)T,1r-[1grT[ir@Tr)Tqro)qr)91,ir&lc1iqgr[+IA<)h@[TgrmT.1crh>Bgr!\r -r &lc1iqro)@n1gr)UqrT[iA,1 [6r)Fh1c)i@[TrO[-@5A,)hA[T r,>)T<1 r)-/@i@[Tr-1F1i@[Tr[OAgg@[Tr)<c11R1Zir gm`aF3O1Tir[cr1pi1Tg@[Tr[5ri@O1 &mc1iqgr[+FA<)iA[TgrlT-1cri>Agr ![T-r)c1rg1`)c)i1rAT-1`1T-1Thr;[Sr)T-rT[hr,[ThAV<1Thrk`[Tr)Tqr[i>1crglc1iqgr`)q@T<r,r)AOg -1O)T-grF@1Tg r[crgl@hgr8]dr)Tqro[cErF)+[cr g1cn@,1gr O)i1c@)Igr[cr1bm@`O1Thr6mcT@g>1-r[crlg1-rDTri>1r([cE %6r)Tr),h@[r )irI*or[cr@Tr1blAhqr@grT1,1gg)fqri[r1T5[c,1r[cr @Ti1c`c1irh>Agr![T-grh1cOg r&lc1iqrOlgir`)qrATr)-0Ah@[Tri[ri?1r![T-1- &mOr"Aiqgrc1)g[T)+F1r)ii[cT1qgr511gr)T-rFAh@<)h@[Tr,[gigrATr)Tr)O[lWhri>1r,[lchr7Cp1g &mc1hqrg>)MFrO)AFr "@iqroc@hh1TrT[h@,1r)ir 1)gr r-)qgr+15[c1 r)ri>1r1551,hAn1r-)h1r[Tro>@,>ri>1r&mc1iqroAFIr,)T,4K ri1cOAT)h1 [croAi>-c)or5c]Ori>@gr![T- r[cr +ri>@gr![T-r+1,[O1grn[@-r[crlT1X6[c,1)+I1r6[cr)Tqre1)g[Y Western Allied Corporation Page 104 of 221 . . Item 10 Page 104 of 221 7¬rf¬dYf¬f¬m r¬[fw £¬8ucuYx¬Yd¬<f¥¬dx¥¬f¤f^fd¬rt¬¬£tr¬rf¬Y|f¬ m¬fY^r¬Y¥¬YfYtq¬[fw £¬ Yd¬uqfd¬[¥¬u¬fffYu¡f¬df¬rf¬Yr t¥¬ l¬t¬q ¡ftq¬[ d¥¬ 'Yf¬(g_g{\g¬¬¬ 8:.6$.8!2¬ Fgg¬"wwuge¬%Zu¬ <¬f¬ #¥ ¬oK&0jL¬©ªh =9p¬M¬ H`kN«¬ 6Y~f¬Yd¬@twf¬ !ddf¬m ¬<fuq¬6 t^f¬ ¬7rf¬' ^f¬ Oai b1¬nP ¬ " 4 4+ "4 4/ +"44( , 4! <C:)B ¬ ?sg¬-Z¢g¬/ Z_g¬%}Z¦¬ $ |Y¥¬6Y|f¬ <uqY¬ #¥ ¬4ZsZ¬,¨Zwg¬"g§ t *Z_¬ 6Y|f¬Yd¬Atzf¬ !ddf¬m ¬<ftq¬6 t^f¬¬7rf¬' ^f¬ ¬3t_w¬>gg¬ F_gg ¬4"¬¬ - 4+ "4 4 4"$4 4 4"4 +" *4 4 04 4 4 4 "% 1 & "4 "" 1 # 4 4) 4+ "4 4 " 3 4 "4 4+ "4 4 4 4" 4 4.4"4 4 4"4 + "24 4 !4 4 ' !88;7E)'¬!<¬ 7¬<C:)¬ I¬!6'¬ !57D6@¬7+¬#76')'¬<C5 ¬ #¥¬QRSSSSSSSS¬T¬ 'Y¬GYxw¬8]yt^¬G v¬'uf^¬ !88:7E)'¬!<¬@7¬+7:5¬ #¥ ¬UVVUVVVUUUWSS¬X¬ JY¥Yr¬6¬5 Y ¬$t¥¬! f¥¬ Western Allied Corporation Page 105 of 221 . . Item 10 Page 105 of 221 *&"/4,%ª /=,9@ªª /,ª(,/>)#+ ,7ª !/4ª 6=4 ;?6ª<7/5, @ $-!8ª ªª ª /{ªfjBCDª_ªEFGHHC DªªªIJªª T]` ]ªy] ªBCCKCLFFFMMMMNª~Pw] ªPª,P§ª1¡TskWªdªPkXª¡|§ ª]~Pvv§ª P]P]Xª~Px] ª¦fª¥]Xªªy]ª~ªf]ªTPlªaª Om_PW¨ª]¥kY]}U]ªªT]ªfª]~ª¦f]ª~Py]ªlª¡TVlT]Xªªfnªl~¡y]~ªPªf]ªP~]¨ªk~ªbPVªb ª P~XªPWr~¦t]Xe]Xªªz]ªgPªf]ª h]ª¢TVlT]Xªf]ª~Py]ª_ªBCCCCCCCCCCJªf]]ª PªkWoPt ªQ~Zªfki]ª¦~ª~Ry^ªSªP~^§ªl~ª_PW ª %ªW]lc©ª£~[^ª2 .*ª:@ª0"ª3 4'=4Aª¡\]ªªsP¦ªbªf]ª6P]ªbªPtp_~kPªfPªf]ªb]el~eªPPePfªqª¡]ª P~XªW]Wª -P§ª1¤TulWª Western Allied Corporation Page 106 of 221 . . Item 10 Page 106 of 221 v|E ~HkgI | |^K |QR`IL I|rlKgwU Z` IK`QiIEK KaO`L |um ^K aJLva |O ^L `vJ``JEl ^| aYvKJ [K J|IsLv } \bI^ ]` IKcQgIEK ` EEI^MJ FvJ v| [K ^OkvK EIIEI | Fl`J` }O ^E J|IsKv &T.T2dK3d .G?3KNI@.d KXIU`dK3d KRdI62E2Rd #Id /25KN2dH2d .T9ad%d !.?Nd"KT.Qd$Y/E@0d 4 & 4* 4 +/-34 2$!4(4 !0% 4 *1,34 2%"4 M2NRKI.FE`d.MM2.N21d !.NV9.d KJb.E2R ' .4* 4# ) ,.4 ^9Kd MNK\21dTKdH2dLIdT92d/.R?Rd K3dR.T?R3.0TKN`d2]@12I02dTKd/2dT92dM2NRKIRd^9KR2dI.H2Rd@S.N2d RZ/R0N?/21d VKdT92d ^@T9?Id?IRUNXH2ITd .I1d.0DIK^E21721dTKdH2dT9.Td 92R92T92`d2_20XT21dT:2d R.H2d @Id9AR92NT92@Nd .YT9KO@c21d0.M.0BT`@2Rd .I1dT9.Td/`d9?R92NT92@NdRC8I.TXN2RdLJd T92d?IRUNXH2ITd W;2d M2NRKIdRddKNdT<2d2IU?T`d[MKId/2=.G3dK3d^9?09dT=2dM2NRKIdRd.0T21d2_20[T21dT92d@IRTNXH2ITd d 02NT@3`d XI12Nd $" d'+d #d $% )%,d XJ12Pd T92d G.^Rd K3d T:2d &T.T2d L3d .G@3KNI@.d T9.Td T>2d 4KN27KAI7d M.N.8N.M9d?RdUNX2d.I1d0KNN20Td * ("&&dH`d9.I1d.I1dK33?0?.Gd R2.Ed ,^|V[ ^` MIe|v ` |`|vEn I|rlM`uW ^` `vQ|sE`|u IEv JMM ElLEd|v |O ^M J|ItMw | QEJlMx MEEI^rMv |P ^a Q|r | Ex w`uMvJMJ J}ItMx -alM | .~M |O }IrMv 00122222230001200000000013000 4 |IsMv EM 22522226227A2222228 %sHM |Q )EXM 22222222 9 +eYyL '^M /^Eu &ErMJ H|M 2::;<:::2::::222:2::::22::2 +fYyK %GrL $E^E }xElM | ~|EK 'QO`IM /dlK 0===== > )ExM "js`MJ LvMEl uJ`dJEo -d |{N gw EI ,MM EJaEv | }vME| '_K +hYvL %ErM ?222200@0 A20B C |~|EL (ST`IK ,`kM 0====== D *EzL #`s`LJ MxLEp !vJ``JEq |uL gv EI ,MM EJ`Ev | |vLE| '^M Western Allied Corporation Page 107 of 221 . . Item 10 Page 107 of 221 9-ĆD(*=¬->Ć;*.G>(*0-Ć0=<c(*HĆ <(..(0DG.-99.Ć(HĆ;*.G>(*0-Ć0=<c(*HĆ 0;9&-*.Ć&*.G>(*0-Ć0=<¡(*HĆ=Ć(<->;0(Ć 9D&.Ć 8B,<F8-F??8<7,DF4162?>F?0,F(*?>F8.F?08>,F7(6,+F0,<,27F(7+F?0,DF0(A,F78F(@?08<2?DF?8F)27+F?0,F869(7DF,C*,:?FÂáĆ?0,F6(77,<F(7+F?8F?0,F ,C?,7?F0,<,27F>?(?,+F &FF !" "F'F9D-.-Ć !" #"F EĆ28)Ć7 ')!Ć&4!)Ć 13ĆĆ ¤84)E2Ć53Ć&4!6Ć +3WĆĆ Ć ï Ć/ĆĆ" Ć ĆĆ Ć ĆĆĆ ĆĆ7 $Ć ĆaFa®PĆ#4!)Ć +3Ć Ć )!&%ĆĆ Ć /ĆĆ" Ć ĆĆĆ ĆĆĆ Ć $Ćx Ć ĆĆ ĆĆs tVĆĆ Ć ĆĆ%Ć ,*0,44,F (=327F DF @(F(?0DF!F (2<F!,/27(F!(7/,4F<,7+(F&87/F#,7E,<F%F@7727/0(6F (<?0(F87E(4,>F8(;@27F ,<,EF(7+ 8=F "830(FA(7>F Ć (=>0F $"F7* F8.F8>F7/,4,>FF Ć ¨ }Ć Ć ĆĆ ĆĆĆ,ĆĆĆ ĆĆÕ ĀÖĆ S y{A ĆĆ ,Ć" %Ć ,Ć i×ĆéĆĆ Ć ì ,ĆĆ ĆĆj $ĆĆĆÃĆ ĆĆĆ ĆnĆ Ć¾ÄĆĆ©fĆ~Ć ĆâĆjÛĆU ĆĆ Å/ ĆúR$Ć Ć Ćā? ĆvwĆ YĆ¥Ć" Ć Ćq Ć U Ć$Ć Æ/ ,ĆûÓĆ Ć ĆĆ %Ć Ć Ć ĆĆð@ĆĆĆĆ Ć ĆĆ ĆĆ Ć ĆĆãĆ ĆÇĆ ĆĆ ĆĆĆ ĆĆ Ć ĆĆ $Ć ĆĆĆ Ć KĆ1 Ć IĆ Ć ĆoĆ Ć Ć ĆĆ Ć ĆĆĆ]ĆĆ Ć ĆĆ T ĆĆĆĆ Ć" ĆĆĆ ĆĆĆĆĆ"?Ć Ć Ć à ĆĆĆCĆ 7DF>@*0F8)42/(?187>F27F?0,F$72?,+F"?(?,>F78?F?8F,C*,,+F#,7F 144287F(7+F 8 F F27F(7DF>27/5,F27>?(7*,F dĆ Ć Ć ĆĆĆ" ĆĆĆĆ Ć ĆĆ Ü eĆ! ĆĆ ĆĆ5 Ć Ć^È Ć Ć Ć @ĆĆĆ!Ć ĆÐĆ Ć ĆĆ CĆ !) '6_CĆ ¦¿ĆĆ+ ĆĆ Ć' Ć+,ĆĆ h ĆĆ Ć' Ć+ $ĆĆĆ Ć Ć Ć /ĆĆ ·ĆĆ Ć A A Ć ĆĆ %Ć Ć ĆĆĆĆ Ć @ĆĆ" ĆĆ ÔkĆ: ĆäĆĆ Ć ĆĆT $Ć ĆĆ Ć Ć %Ć / $Ć Ć Ć Ć Ć Ć ĆĆÝĆ Ć Ć Ć ĆĆ Ć :,ĆÉĆ ĆĆ? ĆĆĆ Ć ĆĆ n YĆ Ć r Ć Ć Ć" Ć Ć Ć A Ć Ć Ć Ć Ć Ć ĆĆ Ć ĆĆ ´Ć Ø Ć " Ć Ć RĆ ĆÀĆ l ĆÙ Ć Ć ĆĆ ĆĆ ĆĆ ĆñKĆ £6 '^CĆ2Ć ĆĆ Ć1Ć Ć ĆĆ Ć Ć Ć Ć+ Ć Ć ĆĆ ù ÒSĆ Ć í Ć IĆ ¸ĆĆ " Ć ĆĆ1 ĆĆ' Ć1 ĆĆ¶Ć hĂ ĆĆ Ć' Ć+ Ć ĆĆ WĆ;ĆĆêåĆĆĆ ĆĆĆĆ"ÿĆ Ć Ć Ć ĆòĆĆ Ć :"Ć JĆ ĆĆĆ Ć Ć Ć Ć Ć ĆĆ ĆĆ ĆzĆ ĆZ%ĆN\[MĆX FĆ8 óĆ# Ć ĆĆ ÚĆNO%ĆM\[BĆX Ć5 Ć#Ć »Ć ]Ć¼ĆĆZ,ĆBLLMĆ /Ć& Ć Ć Ć Ć Ć Ć Ć Ć ĆĆ ĆBO%Ć BLNOVĆ #ĆQ#§`ĆQ8P! Ć $Ć28PĆ7 ')!Ć&4!6Ć 13,Ć ª)2dĆ53Ć#4!)Ć ¢3ĆĆ#E#¯6Ć#4!)Ć 13Ć Ć )!#Ć Ć ĆĆ ĆĆĆ ĆĆ Ć Ć ĆJĆ ĆĆ ĆĆ' Ć + Ê$ĆĄĆ Ć Ć (DF F 22`Ć Ć 2#4FĆ «Ć 3Ć Ć7!E !_Ć |ĆĆ ĆĆ Ć Ć (DF F pĆĆ ĆĆĆ ĆĆ6" Ć'Ë Ć+ ĆmĆ' Ć1 gĆ Ć Ć7 Ćbp Ć Ć U?Ć 5 Ć # Ć Ć Ć /mĆ #ô Ć Ć Ć @Ć Ć Ć ĆRĆ Ć Ć Ć gĆ Ć Ć Ć Ć Ć Ć i ĆĆĆ Ć: "ĆĆĆ eĆ ĆĆĆ Ć Ć Ć2Ć8 Ć& Ć %Ć Ć 5 Ć& Ć Ć Ć Ć /Ć & Ć Ć Ć %Ć ,Ć ĆĆĆ Ć ĆĆ Ć Ć ĆĆ Ć Ć k Ć : "ĆĆ ąßµüĆ Ć Ć æý Ć þĆĆ Ć Ć ĆÌ ½î°øÑĆ Ć Ćoõ KĆ &%Ć Ć Ć'Í Ć + ¹çĆ ĆFĆ7 Ć# Ć IĆ ?Ć5 Ć& Ć ĆºĆÎ/Ć br Ć Ć Ć $Ć Ć ĆĆÁĆĆ ĆĆ Ć ÏĆ ĆĆ Þ$Ć ĆSĆ Ć ë Ć ĆĆ u Ć1öĆ Ć ĆăĆ ĆĆ$ĆĆĆ Ć ÷Ć Tf Ć Ć Ć Ć+Ć Ć ĆĆ l Ć Ć ĆĆ: Ć #'Ć q Ć ĆĆ ĆèĆĆ Ć ĆĆ%ĆĆQ JĆ Ć ³ Ć ±Ć ² Ć Ć Western Allied Corporation Page 108 of 221 . . Item 10 Page 108 of 221 % ě&¥ě 92$:lě C ě ¬\ě¶6qûG//ě6ěyíěÁČü(6qěâ/ % ^ě¯ *ě4¦ě U#bVb¡#2ě °ĖR{rě)ěà FR(đě MQ ěðěěměXě IH ě ě ě <O5ě P!§ě Æ>?0)ě;rě3,0F,0(,)Jě U#$Běd,0)Rě;|ěD()(ědě DF )t>Jě3;ě :BN AB#:$$B2$U IC ä ě &7ě ě ě ěě Z ě ě ě ěI ě ě ě'+ě ċ ěěv ¨ě 3[ěg(Xě gÅ;3ěD[>?wě ·ýF0,|w)ě 3ñ[ě3,)0(R?ě»,`ě##$V:ě ! ì ě&8ě ÈÉ"ÊËěěmTě aě ¢C ěěS 0 ě ě ěěě ě þåěě ě ě ěěěě ě4 H Ę ëĔě ěě ě' +ě ě ě ěě ě ěěě¼ ěěěě ě' +ěěé ěě ě ě ěY ěº ěS ěěě ě Mc] ěě ěě ěě ě ě' ě ě ě ě ě ěěě M ěěě ě ě ěě&ò ěě ě ě ěě ě'+ěěē ě ě ě z < Jěěè ě ě1ěě ěZ ěě ě ěě + Ąě ě ě8 £8 = ě ě ě ě4 ě ěě ě ě ě ùěě ěě ě% ě ěě ěsěě ě ě 8 -%P¸f ě 5-&©ě =jO<O²-<Oě ě* ě * ě'7ěC ě ě ěě  ě Ì Nę9Í$ Ě$Î9ÏAÐ2ÑVÒ#ě..ÓÔÕ...EEEEÖ...×EØÙÚÛě I! H ě ě 1ě ě ě ěß ěěěs ªě %1ě ě% Kě'ě÷ě ě*1ě ě ě ó ě *ěÿ ě ąě *ě ě@ ě xě _ě ěěěě1ě ěĀúě ěě ´ăGěhG6/ĆæěW}āy~ě½ĂěWîGĐp6/ěW}ěhG6//ěeč~ěeôĕě p6/ěLLLLě """""""noÜÝ"""noÞě4 \ě $ # : # $ A ě ě ě % ě! H Tě ě ě Fěěě àěě ě Mc] ěě ěě ě! _ěě ěěě ěÄçě!ěě 8ě = ěP ě ěYě! ě«ě l(Ďu(ěµ,)ė(>ěB22ěÇ`ěA?uěD0?Jě D{?ě9#7ě¹,>ě;)tX>ě 3;ě:N9ě ¾ě Kě ě ě < ě ^ěě4 ěěk ě õ ě&8ě ®2N9Aě =i±ě-&4kQ5-&ě-³ě=j5!ě%-&4!ě-%P5f Q5À¿ě5!ě=i Qěě ě ěCZ ěćě1ěě ě ě ěxěě 7ěě ě ě @ ě ě Ĉěĉěě ěěěKě7ě ě ěě ě věěě@ ě ěě ě á ěěTěěěě ě ě*ě ¤ ě 1ě ěě ě ě ěě ěěěě ě ě ě ěě ěě'+ě ě ěě ě ø ě'Ċ+ě ã ěě ě ě ěě ě ě *ězě ě *ěěě +ïě ě ěê ě ě ěěě ě ě @ ě ě ďě S ěě ě ěě ěY ěě ě ěě ě ě ě ě& ěěě ě ě ěS *Kěě ě ě ě ě< ě ě ě ě ě ě ě ěě ě @ ě ě ěĒě ě' +ě ě 7ě ě! ě ě ě1ěě ěěěě ěě @ ě ě ě ěöě ě% aě Western Allied Corporation Page 109 of 221 . . Item 10 Page 109 of 221 0C;Tp(Ehop8;6P1^;gp hC1hp.^FT6F[1KpFgpETp8;=1jKhp jT8;^phC;p (YTh^16h p Y^p)YTh^16hp +Y6jQ;Thg pY^p3YhC p/j^;hopgC1KKp [^YQ[hLo ^;Q;8ophC;p8;<1jLhpjgFTBp1p[^Y6j^;Q;ThpQ;hCY8YKYBop1[[^Yl;8p3op)Eho pg;K;6hp1p6YTi^16hY_pY^p6YTh^16hY^gp166;[h13K;phYp(Eho hYp6YQ[K;h;p1KKpY<phC;p0Y^J p 1T8p1^^1TB;p=Y^p1p6YTh^16hp3;hm;;TphC;p6YTh^16hY^g p 1T8p(Ehop /j^;hopgC1KNp Q1J;p1l1FL13K; gj<<F6F;Thp<jT8gphYp[1ophC;p6YghpY<p^;[1F^pY^p^;[K16;Q;ThpY=p1Top1T8p1KKp0Y^Jp1T8phYp[1op1T8p[;^=Y^Qp1LLpY3KEB1hFYTgpY<p.^ET6F[1L jT8;^phC;p(YTh^16hp1T8p(YTh^16hp+Y7jQ;ThgpFT6Kj9FTBpYhC;^p6Yghgp 1T8p81R1B;gp<Z^pmCE6Cp/j^;hopFgp LF13K;pjT8;^phCGgp 'YT8 ;n6;[hphC1hp/j^;hogphYh1KpY4OEB1hEYT p1gp8;g6`F3;8pC;^; pmFKKpTYhp;n6;;8phC;p'YT8;8p/jQ /CYjK8phC;p6YT8FhEYTpY<phCFgp3YT8p3;p<jLLop[;^<Y^Q;8 phC;TphCFgpY3LFB1hEYUpgC2LLp3;6YQ;pTjKKp1T8plYF8 pYhC;fEg;pFhpgC1LLp3;p1T8 ^;Q1FTpFTp=jKLp@Y^6;p1T8p;<>;6h /j^;ho p<Z^pl1Kj;p^;6;Fl;8 pC;^;5opghE[jM1h;gp1T8p1B^;;gphC1hpTYp6C1TB; p;nh;TgFYTpY<phEQ; p1Kh;^1hFYT pY^p188FhFYTphYphC;ph;^Qg Y<pg1F8p(YTh^16hpY^phYphC;p0Y^JphYp3;p[;dY^Q;8phC;^;jT8;^pY^phC;pg[;6F<E61hEYTgp166YQ[1ToFTBphC;pg1Q;pgC1KLpFTp1TopQ1TT;^ 1<?;6hpHhgpY3KIB1hFYTgpYTphDFgp3YT: p1T8pFhp8Y;gpC;^;3opm1Fl;pTYhF6;pY<p1Topgj6Cp6C1TB; p;nh;TgEYT p1Kh;^1hFYTpY^p188FhFYT /j^;hogpY3LFB1hEYTgpjT8;^phCFgp'YT8p1^;pg;[1^1h;pET8;[;T8;Thp<^YQ p1T8pTYhp6YThFTB;Thpj[YTp1TopYhC;^pgj^;hogpBj1^1Th;;ETB .^FT6E[1Kgp<1EhC=jKp\;^=Y^Q1T6;pY=phC;p0Y^J !-Yp^FBChpY=p16hFYTp166^j;gpYTphCEgp'YT8phYp1Top;ThFhopYhC;^phC1Tp(FhopY^pEhgpgj66;ggY^gp1Vp 1ggFBTg ",=p1Tp16hFYTp1hpK1mpY^pETp;]jFhopFgpW;6;gg1cophYp;T=Z^6;pY^pFTh;^[^;hphCEgp'YT8gph;^Qgp/j^;hopQjghp[1opFXp188FhEYp hYphC;p'YT:;8 /jS p*Ehogp^;1gYT13L;p1hhY^T;ogp<;;gp1T8pLFhEB1hFYTp6YghgpETp1Tp1QYjThphC;p6Ykep<Fn;g #/j^;hopgC1KKpQ1EKp(Fhopm^Fhi;TpTYhF6;p1hpK;1ghp p81ogp3;=Y^;%p 1 phC;p;A;6hFl;p81h;pYTpmCF6CphC;p/j^;hopmFLKp61T6;L ph;^QFT1h; Y^pmFhC8^1mp=bYQphCFgp'YT8&pY^p 3 phCFgp'YT8p3;6YQ;gplYE:pY^pjT;T<Z^6;13K;p<Z^p1Top^;1gYT $+;1hCpY=phC;p.aET6E[1KpgC1LLpTYhp^;KE;l;p/j^;iopY<pFhgpY3KFB1hFYTgpC;^;jT8;^ Western Allied Corporation Page 110 of 221 . . Item 10 Page 110 of 221 CëxnÃj`«nén«Ãv£«xÃdn·ÃF zfzaà `jÃH²n«¹Ãj²¹Ãn¸nf²«njëxz©Ã ÷z«xëxnÃ`nÃsÃn`fxÃ`§¹Ã`n`{wà dn·Ã`kézwnjÃd¹Ãz«©Ã n¥n©n«`«{´n©Ã²jn ëxnÃ`²«x¡z«¹ÃsÃz«©Ãw´n{wÃdj¹Ã /`«n à 0ogoeo à Ãà FG8>,8F): à Roª¬o¢Ã *|olÃ-¢ b«}à ¿Àà Á9à +¶ Eh ¦Và IcmpJDà W~qþr&à ?`nÃ`jÃMz«nà )jj n©©Ãt£ÃHn¨{wÃ>«{i©ÃÃC«xnÃ1f²n«©!à 7!<9>u'(± = '&> " > 0&'> >0'> >'%$ ( HOG2MT à LyoÃ7bµo à 8ª³ bgoÃ.bºÃ ,`»Ã>`nà +¹"à <b¢°ybÃ6½boª Ã*®¯ o¼|3bg°Ã @`nÃ`jÃN{«nà )jj£n©©ÃsÃHn¨zwà «{fn©ÃÃC«xn Ã/f²n¬©#à Ã;g ÃK¬ oo°Ã R¤goª«o Ã<*Ãà 1 > 0&'> > . >">'> 0'"%/>"> 3>$%&" >& > &> *'"% 4 - '> >'+#% 4 8:;>& '0%> 0&'> > "' %6 >"%$"% '>& > 0&)> > $%&&>" >'&>"% >2 >'>$% $ >"%>'>&0%,5>"%> "(> %> "%$"% '" )FFGCP2/Ã)HÃNCÃHOG2NTÃ)>/à )=COANÃC4Ã+Cà /2/ÃHO="à +¹$à XYZZZZ[[XXXÃ\à /`ÃS` à F²dzfÃS ©Ã/{ nf«Ã )FFGCQ2/Ã)HÃNCÃ5CG=%à +¹"à X]]]]]^]]]]]]Ã_à U`¹`xÃBÃ=²©©`Ã,{«¹Ã)««n¹Ã Western Allied Corporation Page 111 of 221 . . Item 10 Page 111 of 221 ?B»»@ »5%»/*» 4F1BH»5&» 41»,25G- (0 1@» #5:» >E; CH?»DB5:1 I )1$A» » ¦¦» » 5»§v}¦KKL»»»MN»» ]lrl»l »KKKKOL»PKLKKKN»Zl »Z»3¨Z¹»6^~`»n»¦Z}e»®¨¹ »l¦Z¹ [lZlf»\l »·w»µlg»¨»l»»©xl»^Z¦¦»o» ¦Z§}¦qZaªº»l¶glcl»ª»_l»ªyl»l¦» ·v¦l»Zl»¦»¦²^¦b]lg»ª»ªw¦»}¦¨¯l«»Z¦»¨wl»Z§«lº»}»sZc©»p» QKKRSTTTUT KK»»KOV» »Zg»Zc·lhulh»©»l»©zZ¨»vl¦wl»¦°^¦c¥]lg»§{m Zl»q»WTXLLLLXKL»Y»KOLKK»ªvll©»Z¦»}`}Z »Zi»|~¦wl»·»Zl»Z¦ Z§§l¹»~»oZb©» )»dl¨o¹»±gl »7!1.»BH»5'»8"<+E=J»²jl¡»§vl» Z¸¦»o»l»?¨Zªl»o»Zt}Z»¨|Z©»¬|l»oluu»Z¢ZuZv»}¦»¨¤´l» Zk»c£lc¨» 1§Z¹»9³^}c» Western Allied Corporation Page 112 of 221 . . Item 10 Page 112 of 221 bTU[<W`bV\=LG?bUXbU[FAWb UBBG?AWb ?URVMA[HTEb[FHYb ?AX[GBG?<[Ab^AWIBGAYbUTN`b[FAb G@AT[G[`bUBb [FAbGT@H^G@\<Ob_FUb YIETA@b[FAb @U?\RAT[b[Ub_FH?Fb[FGYb?AW[HCG?<[AbHYb<[[<?FA@b <T@bTU[b [FAb[X\[FB\LTAZYb<??\W<?`bUWb^<MH @I[`bUBb[F<[b@U?\RAT[ b &N6N:XF;X+,XW6B-@; .FK.E.@6X/000123XX FPENTXF;X FMXE=:C:MX X GEX4445X 7:;IK:XD:X 6N?UX%X 6@KX"FN6LX$P7C@8 2 "2&2 &,*2/! 2$2 .!2 '-)120! 2 J:KMFE6CCTX6JJ:6K:9X !6KN?6X FEV6C:M #+2&2 %(+2 R?FXJKFQ:9XNFXD:XFEXN?:X 76M@MXF;XM6N@M;68NFKTX:Q@9:E8:XNFX7:XN?:XJ:KMHEMXR?FM:XE6D:MX@M6K:X MP7M8K@7:9XNFXN?:XR@N?@EX@EMNKPD:ENX 6E9X 68AEFRC:9>:9XNFXD:XN?6NX?:M?:N?:TX:S:8PN:9XN?:XM6D:X @EX?@M?:KN?:@KX6PN?FK@V:9X86J68@NT@:MX 6E9XN?6NX7TX?@M?:KN?:@KXM@>E6NPK:MXHEXN?:X@EMNKPD:ENX N?:XJ:KMFEMXFKX N?:X:EN@NTXPJFEX7:?6B;XH;XR?@8?XN?:XJ:KMFEMX68N:9X:S:8PN:9XN?:X@EMNKPD:ENX X 8:KO@;TX PE9:KX $" X'*X #X $% (%*X PE9:KX N?:X C6RMX F;X N?:X &N6N:X F;X 6C@;FKE@6X N?6NX N?:X ;FK:>H@E>XJ6K6>K6J?X@MXNKP:X 6E9X 8FKK:8NX ) '"&&XDTX?6E9X6E9XF<@8@6CXM:6CX FU\EFb [FGYb YA?[GUTbGYb UV[HUT<Pb?URVMA[JTEb [FGYb HTCUXS<[GUTb?<Tb@A[AXb <M[AW<[HUTbUBb[FAb@U?\RAT[bUWb CW<\@\MAT[bXA<[[<?FRAT[bUBb[FGYbBUXRb[Ub<Tb]TGT[AT@A@b@U?\RAT[ b G[MAbUXb!`VAbUBb U?\RAT[b ###$%&&&&%'(%)#*+###########b,b U?\RAT[b<[A b%%%%%& &&-.'######/b\R>AWbUBb <EAY b #$%%%0 01b GETAWYb [FAWb F<Tb<RA@b>U^Ab%%2324#############$%&&%2b5b GETAWYb<RAb <X[F<bUTa<MAYb UXVUW<[Ab BBG?AXb "H[MAYb ######b6b <W[TAWbHRH[A@b ATAW<MbT@G^G@\<Lb [[UWTA`GT<?[b X\Y[AAb \<X@G<TbUXbUTYAW^<[UWb [FAWb GETAWYb<RAb /7%%%%%%&&8#b9 UWVUX<[Ab DG?AWb H[PAYb #:#####b;b <W[TAW GRG[A@b ATAW<MbT@G^K@\<Qb [[UWTA` GT<?[b X\Y[AAb \<W@H<TbUWbUTYAW^<[UWb [FAWb Western Allied Corporation Page 113 of 221 . . Item 10 Page 113 of 221 DO3ĥ O(-=±3>ĥC-4F>(-/3ĥ/=<P(-Gĥ <(44(/OF43DD4ĥ (Gĥ C-4F>(-/3ĥ/=<P(-Gĥ /aDa²3-4ĥC-4F>(-/3ĥ/=<P(-Gĥ=ĥ(<3>C/(ĥ ) (N&=I2AN=3NDD=B<2KN96;6DCNE52N.0ECN=3NE5=C2N<.;21N52A26<N.<1ND52KN5.H2N<=N.FE5=A6EKNE=N/6<1NE52N=;>.<KN2J02?DN6<ND52N;.<<2BN.<1NE=NE52N 2JE2<DN52A26<NCE.E21 N $%,N !N&'(%$(N-N)(N&'($)(N E ĥQ)ĥ)* %"ĥ.* :"*ĥ ! *1ĥĥ 2ĥ! ): E ĥ51ĥ.+ f"*ĥ ! +1,ĥ ĥ ĥ ĥ8ĥĥ#ĥ ĥ ĥ ìĥĥ ĥ ĥĥ*ĥ) $ĥĥb§bg+ ĥ 0* ®"+ĥ ! ¢1ĥ ;ĥ!"0'ĥĥ ĥ 8ĥĥ# ĥĥ 2 ĥ ĥíĥĥ ĥ ĥĥ ! 'ĥ r É ĥ & ¹ ĥĥ ô & ĥ ĥpI qJĥ ĥ ĥ Îĥĥ ,ĥ #20529:2N .B86<N#KNG.N .D5KN' N#.7BN '246<.N'.<429 NB2<1.N,=<4N)2<L2BN+ NG<<6<45.;N#.BD5.N=<M.92CN =.@G6<N&2B2MN.<1=BN (=85.NH.<CN ĥ #.BC5N*(N <0 N=3N"=CN<4292C NN ĥÏ&Ðõö vĥĥ ĥĥ ĥ ĥĥwĥĥ ĥTĥĥĘ ĥ m su ĥĖĥKĥ # xĥîKĥ Hï2ĥmĥð7 ĥ 'ĥĥĥ?ĥ $ĥºĥĥ ĥ ĥĥ ĥ ĥ ĥ ĥ ĥfÑĥ yĥ ĥĥ÷øĥ ĥ,ĥ ÒV Wĥę H SWĥ ĥ Uĥ 6 ĥÓYĥE ĥ#ĥ Ě ĥĥ ĥ 6 ĥ$ĥ ć8 zĥĔéĥĥ6 ĥ¸ 'ĥĥ ĥĥ ĥ 'ĥ ĥĥĥ ĥ ĥ ĥ ĥĥ Ôĥ ĥ ĥĥ ĥ ĥ ĥ ĥ ĥĥĥ ĥ ĥ ĥĥ ĥ {ĥ ĥ čĥ ĥ ĥ Yĥ & ĥ ĥ &'ĥ ĥ ĥ ĥĥ ĥ ĥ ĥ ĥĥ ĥĥ Nĥĥ ĥ 7ĥĥ ĥĥ ĥ ĥ ĥ# ĥĥ ĥü ĥĥĥĥ ĥ#6ĥĥ ĥ ĥĥ ĥ <KNCG05N=/964.D6=<CNÕþĥE52N*<6D21N(D.D2C N<=DND=N2J0221N)2<N#6:96=<N.<1N$=NN6<N.<KNC6<492N6<CD.<02N 9 ĥ ĥĎĥ ĥĥĥ# ĥĥ ěĥĥ ĥ 6 ĥÃĥ ĥ Öĥ" ĥĥ ĥ ĥ5ĥĥ ĥĥĥ ,ĥĥĥ" ĥ ĥĥÄ ĥ ĥĥ ^ĥ "e %`^ĥ 9 ĥ ĥ ĥ ĥ ĥ% ĥ $ĥ ĥ lĜ ĥ ĥ ĥ% ĥ ĥ ×@ĥĥÿĥ ĥ ĥ ĥ ď 8ĥĥĥĥ ĥ XXÅ ĥĥ ĥ @ĥĥ ĥĥĥĥ ĥ $ĥĥ# ĥĥ êĥ ĥĥĥ ĥ ĥĥ ,ĥ ĥĥ ĥ|ĥ h8 $ĥ ĥĥąØ6 $ĥ7 ĥĥ ĥĥ ĥ ĥĐĥ ĥ ĥ ĥ ĥ ĥ Kĥ ĥĥĥ ĥ ĥ ĥĥĥ ĥ ĉ Aĥ ĥ ĥ ĥĥ # ĥ ĥ ĥ ĥ ĥĥĀĥĥ ĥ ĥĥĥ ĥ ĥ āĥ2 ĥ# ĥĥ ëĥ ĥ ĥ ĥTĢ ĥ ĥ ĥĥ ĥ ĥ?ĥ ĥĥ ĥČđAĥ ¦e %ĥ9 ĥ ĥĥ ĥ ĥjĥ ĥ ĥ 2ĥ ĥĥ ĥ ĥĥoĒ ĥĥ ĥĥ ĥ }ĥ ĥĥ # ĥ ĥ ĥ nĥĥ% ĥ ĥĥ l ĥ ĥ ĥ%Ù ĥ ĥĥ ĥ $ĥ ĥĥ ĥĥ ĥ ĥĥ ĥIĥ#ĥ ĥĥĥÚ ĥ ĥ ĥùģĥ #,ĥ&ĥ ĥĥĥĥĥ ĥ ĥ ĥ Âĥ ĥĥ Aĥtĥ ĥ['ĥZ]\ĥ E ĥ)& ĥ. ĥ Nĥoĥ ĥM$ĥ]\B ! nĥ5 ĥ. ĥ NĥÁĥ ĥ[@ĥBLLZĥ 8Sĥ ĥ ĥĥ ĥĂĥ ĥ ĥ ĥ ĥĥ! ĥBM,ĥBLMJĥ 0£ĥR.Q* ĥR" ;~ĥ )ĥ)* %"ĥc* ¯"¤_ĥ ! +1$ĥ! ): ĥ ĥ51ĥ0ĥ :"+ĥ ! +1ĥĥ090gĥ ĥ+ °"+ĥ ! +1ĥ ĥ!"cĥ &ĥ 2ĥ ĥĥĥĥ ĥ Êĥ ĥ &ĥ ĥ ,ĥ ĥ6»ĥ ĥĥ% ĥ Û¼@ĥ ĥ ĥĥ#.KNN 9¨ĥ ;ĥ +*.:©ĥ _ :+ª1ĥ ;ĥ)"Q; "`ĥ JĥAĥ ĥËÜĥ ĥjĥ#.KNN ĥĥ Iĥ ĥ7ĥĥ# &ĥ%Ý ĥ ?2ĥĥ% ĥ Þĥ¬ ĥ)Ĉ7 ĥd ĥ $ĥ¡ ĝĥ 5 ĥ0ĥ ¾ĥ ĥ ĥ 8ĥ . ¿ĥ ĥ ĥ U 'ĥ ĥĥ ú ĥ Hĥ ĥĥ ĥ & ĥ ĥ kè ĥ ?ĥ 'ĥ ĥ Hñiĥ ĥ ĥòĥ #ĥĥ ĥ ĥ ĥ ĥ ĥ ĥĥĥ« ĥ)&ĥ . ĥ ,ĥ ! ĥ5 ĥ 0 ĥ ĥĥVĥ . ĥ ĥĥ ß ,ĥ & $ĥĥ ĥ ĥ ĥ ĥĥĥ ĥ ĥĥ ĥĥĞ ĥ #ĥĥ Ĥė ĥ ĥ Àĥ àĥ ĥ ĥ Iĥ ĥ ĥ ¶ ĥ ĥ2³ µ ´ĥĊĥĥ ĥ .ĥ ĥ áiĥ%â ĥ ãăĥÆĥ9 ĥ)7 ĥTS ĥ 'ĥ!· Ìğĥ5 ĥdhĥ ĥĥä?VĥĠ ĥċý ĥkĥ ĥ ĥ ē ĥ ĥ ĥ7ĥĆĥÇ ĥ ĥĥ 'ĥ ġĥĥ ĥ ĥĥ ĥ Ąóĥ ĥĥ ĥå½ĥ ĥæ2ĥ $ĥĥĥ ĥÈU ĥ ĥ ĥ ĥĕĥ¥ĥĥ ĥĥçû ĥ ĥ ĥĥ ĥ 0%*ĥ ĥ ĥ ĥĥ ĥ ĥĥ ĥ,ĥĥR $ĥ! 'ĥÍ ĥ ĥĥ Western Allied Corporation Page 114 of 221 . . Item 10 Page 114 of 221 (;+,%,7 ,1685$1&(5(48,5(0(176 5(48,5(',1685$1&(32/,&,(6 $WLWVRZQH[SHQVH&RQWUDFWRUVKDOOREWDLQSD\IRUDQGPDLQWDLQ±DQGVKDOOUHTXLUHHDFKRILWV 6XEFRQWUDFWRUVWRREWDLQDQGPDLQWDLQ±IRUWKHGXUDWLRQRIWKH$JUHHPHQWSROLFLHVRILQVXUDQFHPHHWLQJWKHIROORZLQJ UHTXLUHPHQWV $ :RUNHUV¶&RPSHQVDWLRQ(PSOR\HU¶V/LDELOLW\,QVXUDQFHVKDOOSURYLGHZRUNHUV¶FRPSHQVDWLRQVWDWXWRU\ EHQHILWVDVUHTXLUHGE\ODZ (PSOR\HU¶V/LDELOLW\LQVXUDQFHVKDOOEHLQDQDPRXQWQRWOHVVWKDQ D 21(0,//,21'2//$56 SHUDFFLGHQWIRUERGLO\LQMXU\RUGLVHDVH E 21(0,//,21'2//$56 SHUHPSOR\HHIRUERGLO\LQMXU\RUGLVHDVH DQG F 21(0,//,21'2//$56 SROLF\OLPLW % &RPPHUFLDO*HQHUDO/LDELOLW\ ³&*/´ SULPDU\ &LW\DQGLWVHPSOR\HHVDQGDJHQWVVKDOOEHDGGHGDV DGGLWLRQDOLQVXUHGVQRWOLPLWLQJFRYHUDJHIRUWKHDGGLWLRQDOLQVXUHGWR³RQJRLQJRSHUDWLRQV´RULQDQ\ZD\H[FOXGLQJ FRYHUDJHIRUFRPSOHWHGRSHUDWLRQV&RYHUDJHVKDOODSSO\RQDSULPDU\QRQFRQWULEXWLQJEDVLVLQUHODWLRQWRDQ\RWKHU LQVXUDQFHRUVHOILQVXUDQFHSULPDU\RUH[FHVVDYDLODEOHWR&LW\RUDQ\HPSOR\HHUHSUHVHQWDWLYHRUDJHQWRI&LW\ &RYHUDJHVKDOOQRWEHOLPLWHGWRWKHYLFDULRXVOLDELOLW\RUVXSHUYLVRU\UROHRIDQ\DGGLWLRQDOLQVXUHG&RYHUDJHVKDOO FRQWDLQQRFRQWUDFWRUV¶OLPLWDWLRQRURWKHUHQGRUVHPHQWOLPLWLQJWKHVFRSHRIFRYHUDJHIRUOLDELOLW\DULVLQJIURPH[SORVLRQ FROODSVHRUXQGHUJURXQGSURSHUW\GDPDJH &*/LQVXUDQFHPXVWQRWEHZULWWHQIRUOHVVWKDQWKHOLPLWVRIOLDELOLW\VSHFLILHGDVIROORZV D 7:20,//,21'2//$56 SHURFFXUUHQFHIRUERGLO\LQMXU\ LQFOXGLQJ DFFLGHQWDOGHDWK WRDQ\RQHSHUVRQ E 7:20,//,21'2//$56 SHURFFXUUHQFHIRUSHUVRQDODQG DGYHUWLVLQJLQMXU\WRDQ\RQHSHUVRQ F 7:20,//,21'2//$56 SHURFFXUUHQFHIRUSURSHUW\GDPDJH DQG G )2850,//,21'2//$56 JHQHUDODJJUHJDWHOLPLW &*/LQVXUDQFHPXVWLQFOXGHDOOPDMRUGLYLVLRQVRIFRYHUDJHDQGPXVWFRYHU D 3UHPLVHV2SHUDWLRQV LQFOXGLQJ([SORVLRQ&ROODSVHDQG8QGHUJURXQG>³;&8´@ FRYHUDJHVDVDSSOLFDEOH E ,QGHSHQGHQW&RQWUDFWRU¶V3URWHFWLYH Western Allied Corporation Page 115 of 221 . . Item 10 Page 115 of 221 F ,QGHSHQGHQW&RQWUDFWRUV G 3URGXFWVDQG&RPSOHWHG2SHUDWLRQV PDLQWDLQVDPHOLPLWVDVDERYHXQWLOILYH \HDUVDIWHUUHFRUGDWLRQRI1RWLFHRI&RPSOHWLRQ H 3HUVRQDODQG$GYHUWLVLQJ,QMXU\ ZLWK(PSOR\HU¶V/LDELOLW\([FOXVLRQGHOHWHG I &RQWUDFWXDO/LDELOLW\ LQFOXGLQJVSHFLILHGSURYLVLRQIRU&RQWUDFWRU¶VREOLJDWLRQXQGHU $UWLFOHRIWKH*HQHUDO&RQGLWLRQV DQG J %URDG)RUP3URSHUW\'DPDJH 8PEUHOODRU([FHVV/LDELOLW\,QVXUDQFH RYHUSULPDU\ LISURYLGHGVKDOOEHDWOHDVWDVEURDG DVDQ\XQGHUO\LQJFRYHUDJH&RYHUDJHVKDOOEHSURYLGHGRQD³SD\RQEHKDOI´EDVLVZLWK GHIHQVHFRVWVSD\DEOHLQDGGLWLRQWRSROLF\OLPLWV7KHUHVKDOOEHQRFURVVOLDELOLW\H[FOXVLRQ DQGQRFRQWUDFWRU¶VOLPLWDWLRQHQGRUVHPHQW7KHSROLF\VKDOOKDYHVWDUWLQJDQGHQGLQJGDWHV FRQFXUUHQWZLWKWKHXQGHUO\LQJFRYHUDJHV7KH1DPHG,QVXUHGPD\GHWHUPLQHWKHOD\HULQJ RISULPDU\DQGH[FHVVOLDELOLW\LQVXUDQFHSURYLGHGWKDWLIVXFKOD\HULQJGLIIHUVIURPWKDW GHVFULEHGKHUHWKHDFWXDOFRYHUDJHSURJUDPPHHWVWKHPLQLPXPWRWDOUHTXLUHGOLPLWVDQG FRPSOLHVZLWKDOORWKHUUHTXLUHPHQWVOLVWHGKHUH & %XVLQHVV$XWRPRELOH/LDELOLW\,QVXUDQFH %XVLQHVV$XWRPRELOH/LDELOLW\,QVXUDQFHPXVWFRYHUDOOYHKLFOHVZKHWKHUUHQWHGOHDVHG KLUHGVFKHGXOHGRZQHGRUQRQRZQHG ,I&RQWUDFWRUGRHVQRWRZQDQ\YHKLFOHVWKLV UHTXLUHPHQWPD\EHVDWLVILHGE\DQRQRZQHGYHKLFOHHQGRUVHPHQWWRWKHJHQHUDODQG XPEUHOODOLDELOLW\SROLFLHV %XVLQHVV$XWRPRELOH/LDELOLW\,QVXUDQFHFRYHUDJHDPRXQWVVKDOO QRWEHOHVVWKDQWKHIROORZLQJ D 21(0,//,21'2//$56 SHURFFXUUHQFHIRUERGLO\LQMXU\ LQFOXGLQJ DFFLGHQWDOGHDWK WRDQ\RQHSHUVRQ DQG E 21(0,//,21'2//$56 SHURFFXUUHQFHIRUSURSHUW\GDPDJH RU F 7:20,//,21'2//$56 FRPELQHGVLQJOHOLPLW &, &RQWUDFWRUV3ROOXWLRQ/LDELOLW\,QVXUDQFH &3/ &RQWUDFWRURU6XEFRQWUDFWRUVKDOOREWDLQSD\IRUDQGPDLQWDLQIRUWKHGXUDWLRQRIWKH &RQWUDFW&RQWUDFWRUV3ROOXWLRQ/LDELOLW\LQVXUDQFHWKDWSURYLGHVFRYHUDJHIRUOLDELOLW\FDXVHG E\SROOXWLRQFRQGLWLRQVDULVLQJRXWRIWKHRSHUDWLRQVRIWKH&RQWUDFWRU&RYHUDJHVKDOOEH LQFOXGHGRQEHKDOIRIWKHLQVXUHGIRUFRYHUHGFODLPVDULVLQJRXWRIWKHDFWLRQVRILQGHSHQGHQW FRQWUDFWRUV,IWKHLQVXUHGLVXVLQJ6XEFRQWUDFWRUVWKHSROLF\PXVWLQFOXGHZRUNSHUIRUPHG ³E\RURQEHKDOI´RIWKHLQVXUHG 7KHSROLF\OLPLWVKDOOSURYLGHFRYHUDJHRIQROHVVWKDQRQHPLOOLRQGROODUV SHU FODLPDQGLQWKHDJJUHJDWH&RYHUDJHVKDOODSSO\WRERGLO\LQMXU\ SURSHUW\GDPDJH LQFOXGLQJORVVRIXVHRIGDPDJHGSURSHUW\RURISURSHUW\WKDWKDVQRWEHHQSK\VLFDOO\LQXUHG FOHDQXSFRVWV DQGFRVWVRIGHIHQVHLQFOXGLQJFRVWVDQGH[SHQVHVLQFXUUHGLQWKH Western Allied Corporation Page 116 of 221 . . Item 10 Page 116 of 221 LQYHVWLJDWLRQGHIHQVHRUVHWWOHPHQWRIFODLPV $OODFWLYLWLHVFRQWHPSODWHGLQWKH&RQWUDFWVKDOOEHVSHFLILFDOO\VFKHGXOHGRQWKH&3/SROLF\ DV³FRYHUHGRSHUDWLRQV´,QDGGLWLRQWKHSROLF\VKDOOSURYLGHFRYHUDJHIRUWKHKDXOLQJRI ZDVWHIURPWKH3URMHFWVLWHWRWKHILQDOGLVSRVDOORFDWLRQLQFOXGLQJQRQRZQHGGLVSRVDOVLWHV 7KHSROLF\VKDOOVSHFLILFDOO\SURYLGHIRUDGXW\WRGHIHQGRQWKHSDUWRIWKHLQVXUHU&LW\LWV RIILFHUVHPSOR\HHVDQGDJHQWVVKDOOEHDGGHGWRWKHSROLF\DVDGGLWLRQDOLQVXUHGVE\ HQGRUVHPHQW ( %XLOGHU¶V5LVN,QVXUDQFH %XLOGHU¶V5LVN,QVXUDQFHFRYHULQJDOOUHDODQGSHUVRQDOSURSHUW\IRU³DOOULVNV´RIORVVRU ³FRPSUHKHQVLYHSHULOV´FRYHUDJHLQFOXGLQJEXWQRWOLPLWHGWRWKHSHULOVRIHDUWKPRYHPHQW LQFOXGLQJHDUWKTXDNHDQGIORRGIRUDOOEXLOGLQJVVWUXFWXUHVIL[WXUHVPDWHULDOVVXSSOLHV PDFKLQHU\DQGHTXLSPHQWWREHXVHGLQRULQFLGHQWDOWRWKHFRQVWUXFWLRQDWWKHVLWHRIIVLWH RULQWUDQVLWIRUWKHIXOOUHSODFHPHQWYDOXHRIVXFKSURSHUWLHV&RYHUDJHVKDOOEHLQFOXGHGIRU SURSHUW\RIRWKHUVLQWKHFDUHFXVWRG\RUFRQWURORIWKHLQVXUHGIRUZKLFKDQ\LQVXUHGPD\EH OLDEOH7KH&LW\ZLOOSXUFKDVHDEXLOGHU¶VULVNSROLF\IRUWKH3URMHFWLQVWHDGRIDFRQWUDFWRU SXUFKDVHGSROLF\%LGGHUVKRXOGQRWLQFOXGHFRVWIRUWKLVFRYHUDJHLQKLVKHUELG *(1(5$/5(48,5(0(176²$//32/,&,(6 $ 4XDOLILFDWLRQVRI,QVXUHU$WDOOWLPHVGXULQJWKHWHUPRIWKLV&RQWUDFW&RQWUDFWRU¶VLQVXUDQFH FRPSDQ\PXVWPHHWDOORIWKHIROORZLQJUHTXLUHPHQWV ³$GPLWWHG´LQVXUHUE\WKH6WDWHRI&DOLIRUQLD'HSDUWPHQWRI,QVXUDQFHRUEHOLVWHGRQWKH &DOLIRUQLD'HSDUWPHQWRI,QVXUDQFH¶V³/LVWRI6XUSOXV/LQH,QVXUHUV´ ³/(6/,´ 'RPLFLOHGZLWKLQDQGRUJDQL]HGXQGHUWKHODZVRID6WDWHRIWKH8QLWHG6WDWHV DQG &DUU\DQ$0%HVW &RPSDQ\PLQLPXPUDWLQJRI³$ 9,,´ % &RQWLQXDWLRQ&RYHUDJH)RULQVXUDQFHFRYHUDJHVWKDWDUHUHTXLUHGWRUHPDLQLQIRUFHDIWHUWKH )LQDO3D\PHQWDQGLIUHDVRQDEO\DYDLODEOH&RQWUDFWRUVKDOOVXEPLWWR&LW\ZLWKWKHILQDO$SSOLFDWLRQIRU3D\PHQWDOO FHUWLILFDWHVDQGDGGLWLRQDOLQVXUHGHQGRUVHPHQWVHYLGHQFLQJWKHFRQWLQXDWLRQRIVXFKFRYHUDJH & 'HGXFWLEOHVRU6HOI,QVXUHG5HWHQWLRQV$OOGHGXFWLEOHVRUVHOILQVXUHGUHWHQWLRQVDUHVXEMHFWWR &LW\¶VUHYLHZDQGDSSURYDOLQLWVVROHGLVFUHWLRQ ' &RPPHUFLDO*HQHUDO/LDELOLW\DQG%XVLQHVV$XWRPRELOHLQVXUDQFHSROLFLHVPXVWEHZULWWHQRQDQ ³RFFXUUHQFH´EDVLVDQGPXVWDGGWKH&LW\RI9HUQRQDQGLWVRIILFHUVDJHQWVHPSOR\HHVDQGUHSUHVHQWDWLYHVDV DGGLWLRQDOLQVXUHGV ( &RQWUDFWRU¶V,QVXUDQFH3ULPDU\2WKHULQVXUDQFH ZKHWKHUSULPDU\H[FHVVFRQWLQJHQWRUVHOI LQVXUDQFHRUDQ\RWKHUEDVLV DYDLODEOHWR&LW\RULWVUHSUHVHQWDWLYHVRUERWKLVH[FHVVRYHU&RQWUDFWRU¶VLQVXUDQFH &LW\¶VLQVXUDQFHRUVHOILQVXUDQFHRUERWKZLOOQRWFRQWULEXWHZLWK&RQWUDFWRU¶VLQVXUDQFHSROLF\ ) :DLYHURI6XEURJDWLRQ&RQWUDFWRUDQG&RQWUDFWRU¶VLQVXUDQFHFRPSDQ\ZDLYH²DQGVKDOOQRW H[HUFLVH²DQ\ULJKWRIUHFRYHU\RUVXEURJDWLRQWKDW&RQWUDFWRURUWKHLQVXUHUPD\KDYHDJDLQVW&LW\RULWV UHSUHVHQWDWLYHVRUERWK Western Allied Corporation Page 117 of 221 . . Item 10 Page 117 of 221 * 6HSDUDWLRQRI,QVXUHGV&RQWUDFWRU¶VLQVXUDQFHSROLF\DSSOLHVVHSDUDWHO\WRHDFKLQVXUHGRU DGGLWLRQDOLQVXUHGZKRLVVHHNLQJFRYHUDJHRUDJDLQVWZKRPDFODLPLVPDGHRUVXLWLVEURXJKWH[FHSWWKDWWKH QDPLQJRIPXOWLSOHLQVXUHGVZLOOQRWLQFUHDVHDQLQVXUDQFHFRPSDQ\¶VOLPLWVRIOLDELOLW\ + &ODLPVE\2WKHU,QVXUHGV&RQWUDFWRU¶VLQVXUDQFHSROLF\DSSOLHVWRDFODLPRUVXLWEURXJKWE\DQ DGGLWLRQDOLQVXUHGDJDLQVWD1DPHG,QVXUHGRURWKHULQVXUHGDULVLQJRXWRIERGLO\LQMXU\SHUVRQDOLQMXU\DGYHUWLVLQJ LQMXU\RUSURSHUW\GDPDJH , 3UHPLXPV &LW\LVQRWOLDEOHIRUDSUHPLXPSD\PHQWRUDQRWKHUH[SHQVHXQGHU&RQWUDFWRU¶VSROLF\ - $WDQ\WLPHGXULQJWKHGXUDWLRQRIWKLV&RQWUDFW&LW\PD\GRDQ\RQHRUPRUHRIWKHIROORZLQJ 5HYLHZWKLV$JUHHPHQW¶VLQVXUDQFHFRYHUDJHUHTXLUHPHQWV 5HTXLUHWKDW&RQWUDFWRUREWDLQSD\IRUDQGPDLQWDLQPRUHLQVXUDQFHGHSHQGLQJRQ&LW\¶V DVVHVVPHQWRIDQ\RQHRUPRUHRIWKHIROORZLQJIDFWRUV D &LW\¶VULVNRIOLDELOLW\RUH[SRVXUHDULVLQJRXWRIRULQDQ\ZD\FRQQHFWHGZLWKWKH VHUYLFHVRI&RQWUDFWRUXQGHUWKLV$JUHHPHQW E 7KHQDWXUHRUQXPEHURIDFFLGHQWVFODLPVRUODZVXLWVDULVLQJRXWRIRULQDQ\ZD\ FRQQHFWHGZLWKWKHVHUYLFHVRI&RQWUDFWRUXQGHUWKLV$JUHHPHQW RU F 7KHDYDLODELOLW\RUDIIRUGDELOLW\RUERWKRILQFUHDVHGOLDELOLW\LQVXUDQFHFRYHUDJH 2EWDLQSD\IRURUPDLQWDLQDERQG DVDUHSODFHPHQWIRUDQLQVXUDQFHFRYHUDJH IURPD &DOLIRUQLDFRUSRUDWHVXUHW\JXDUDQWHHLQJSD\PHQWWR&LW\IRUOLDELOLW\RUFRVWVRUERWK WKDW&LW\LQFXUVGXULQJ&LW\¶VLQYHVWLJDWLRQDGPLQLVWUDWLRQRUGHIHQVHRIDFODLPRUDVXLW DULVLQJRXWRIWKLV$JUHHPHQW RU . &RQWUDFWRUVKDOOPDLQWDLQWKHLQVXUDQFHSROLF\ZLWKRXWLQWHUUXSWLRQIURPWKH3URMHFW¶V FRPPHQFHPHQWGDWHWRWKH)LQDO3D\PHQWGDWHRUXQWLODGDWHWKDW&LW\VSHFLILHVIRUDQ\FRYHUDJHWKDW&RQWUDFWRU PXVWPDLQWDLQDIWHUWKH)LQDO3D\PHQW / &RQWUDFWRUVKDOOQRWDOORZDQ\LQVXUDQFHWRH[SLUHFDQFHOWHUPLQDWHODSVHRUQRQUHQHZ &RQWUDFWRU¶VLQVXUDQFHFRPSDQ\VKDOOPDLO&LW\ZULWWHQQRWLFHDWOHDVWWKLUW\ GD\VLQDGYDQFHRIWKHSROLF\¶V FDQFHOODWLRQWHUPLQDWLRQQRQUHQHZDORUUHGXFWLRQLQFRYHUDJHDQGWHQ GD\VEHIRUHLWVLQVXUDQFHSROLF\¶V H[SLUDWLRQFDQFHOODWLRQWHUPLQDWLRQRUQRQUHQHZDO&RQWUDFWRUVKDOOGHOLYHUWR&LW\HYLGHQFHRIWKHUHTXLUHG FRYHUDJHDVSURRIWKDW&RQWUDFWRU¶VLQVXUDQFHSROLF\KDVEHHQUHQHZHGRUUHSODFHGZLWKDQRWKHULQVXUDQFHSROLF\ ZKLFKGXULQJWKHGXUDWLRQRIWKLV$JUHHPHQWPHHWVDOORIWKLV$JUHHPHQW¶VLQVXUDQFHUHTXLUHPHQWV 0 $WDQ\WLPHXSRQ&LW\¶VUHTXHVW&RQWUDFWRUVKDOOIXUQLVKVDWLVIDFWRU\SURRIRIHDFKW\SHRI LQVXUDQFHFRYHUDJHUHTXLUHG²LQFOXGLQJDFHUWLILHGFRS\RIWKHLQVXUDQFHSROLF\RUSROLFLHV FHUWLILFDWHVHQGRUVHPHQWV UHQHZDOVRUUHSODFHPHQWV DQGGRFXPHQWVFRPSULVLQJ&RQWUDFWRU¶VVHOILQVXUDQFHSURJUDP²DOOLQDIRUPDQGFRQWHQW DFFHSWDEOHWRWKH&LW\$WWRUQH\RU&LW\¶V5LVN0DQDJHU 1 ,I&RQWUDFWRUKLUHVHPSOR\VRUXVHVRQHRUPRUH6XEFRQWUDFWRU V WRSHUIRUPZRUNVHUYLFHV RSHUDWLRQVRUDFWLYLWLHVRQ&RQWUDFWRU¶VEHKDOI&RQWUDFWRUVKDOOHQVXUHWKDWWKH6XEFRQWUDFWRUFRPSOLHVZLWKWKH IROORZLQJ 0HHWVDQGIXOO\FRPSOLHVZLWKWKLV$JUHHPHQW¶VLQVXUDQFHUHTXLUHPHQWV DQG Western Allied Corporation Page 118 of 221 . . Item 10 Page 118 of 221 )XUQLVKHV&LW\DWDQ\WLPHXSRQLWVUHTXHVWZLWKDFRPSOHWHFRS\RIWKH6XEFRQWUDFWRU¶V LQVXUDQFHSROLF\RUSROLFLHVIRU&LW\¶VUHYLHZRUDSSURYDORUERWK)DLOXUHRI&LW\WR UHTXHVWFRSLHVRIVXFKGRFXPHQWVVKDOOQRWLPSRVHDQ\OLDELOLW\RQ&LW\RULWVHPSOR\HHV 2 &RQWUDFWRU¶VIDLOXUHWRFRPSO\ZLWKDQLQVXUDQFHSURYLVLRQLQWKLV$JUHHPHQWFRQVWLWXWHVDPDWHULDO EUHDFKXSRQZKLFK&LW\PD\LPPHGLDWHO\WHUPLQDWHRUVXVSHQG&RQWUDFWRU¶VSHUIRUPDQFHRIWKLV$JUHHPHQWRU LQYRNHDQRWKHUUHPHG\WKDWWKLV$JUHHPHQWRUWKHODZDOORZV$WLWVGLVFUHWLRQDQGZLWKRXWZDLYLQJDQ\RWKHUULJKWVLW PD\KDYHSXUVXDQWWRODZ&LW\KDVWKHULJKWEXWQRWDGXW\WRREWDLQRUUHQHZWKHLQVXUDQFHDQGSD\DOORUSDUWRIWKH SUHPLXPV8SRQGHPDQG&RQWUDFWRUVKDOOUHSD\&LW\IRUDOOVXPVRUPRQLHVWKDW&LW\SDLGWRREWDLQUHQHZRU UHLQVWDWHWKHLQVXUDQFHRU&LW\PD\RIIVHWWKHFRVWRIWKHSUHPLXPDJDLQVWDQ\VXPVRUPRQLHVWKDW&LW\PD\RZH &RQWUDFWRU &2175$&725¶668%0,77$/2)&(57,),&$7(6$1'(1'256(0(176 $ &RQWUDFWRUVKDOOKDYHLWVLQVXUDQFHFDUULHU V RUVHOILQVXUDQFHDGPLQLVWUDWRU V FRPSOHWHDQG H[HFXWHWKHIROORZLQJLQVXUDQFHGRFXPHQWVDQGVKDOOGHOLYHUVDLGGRFXPHQWVDWWKHVDPHWLPH&RQWUDFWRUGHOLYHUV WKLV$JUHHPHQWWR&LW\&LW\ZLOOQHLWKHUVLJQWKLV$JUHHPHQWQRULVVXHD³1RWLFHWR3URFHHG´XQWLOWKH&LW\$WWRUQH\RU &LW\¶V5LVN0DQDJHUKDVUHYLHZHGDQGDSSURYHGDOOLQVXUDQFHGRFXPHQWV&LW\ VGHFLVLRQDVWRWKHDFFHSWDELOLW\RIDOO LQVXUDQFHGRFXPHQWVLVILQDO6DPSOHLQVXUDQFHGRFXPHQWVLQWKH&LW\¶VDSSURYHGIRUPDWDUHVHWIRUWKLQWKLV % 5HTXLUHG6XEPLWWDOVIRU&RPPHUFLDO*HQHUDO/LDELOLW\DQG%XVLQHVV$XWRPRELOH,QVXUDQFHDQG &RQWUDFWRU¶V3ROOXWLRQ/LDELOLW\,QVXUDQFH7KHIROORZLQJVXEPLWWDOVPXVWEHRQIRUPVVDWLVIDFWRU\WRWKH&LW\$WWRUQH\RU &LW\¶V5LVN0DQDJHUDQGVLJQHGE\WKHLQVXUDQFHFDUULHURULWVDXWKRUL]HGUHSUHVHQWDWLYH±ZKLFKIXOO\PHHWWKH UHTXLUHPHQWVRIDQGFRQWDLQSURYLVLRQVHQWLUHO\FRQVLVWHQWZLWKDOORIWKHLQVXUDQFHUHTXLUHPHQWVVHWIRUWKKHUHLQ ³&HUWLILFDWHRI,QVXUDQFH´ ³$GGLWLRQDO,QVXUHG(QGRUVHPHQW´ 6XEURJDWLRQ(QGRUVHPHQW ³:DLYHURI7UDQVIHUWR5LJKWVRI5HFRYHU$JDLQVW2WKHUV´ %RWK&HUWLILFDWHVRI,QVXUDQFHDQG$GGLWLRQDO,QVXUHG(QGRUVHPHQWVPXVWUHDGDVIROORZV ³7KH&LW\RI9HUQRQ DQGLWVRIILFHUVDJHQWVHPSOR\HHVDQGUHSUHVHQWDWLYHVDUHLQFOXGHGDVDGGLWLRQDOLQVXUHGVXQGHUWKHSROLF\ V 7KLV LQVXUDQFHLVSULPDU\WRDOORWKHULQVXUDQFHRIWKH&LW\7KH&LW\¶VLQVXUDQFHDQGVHOILQVXUDQFHZLOODSSO\LQH[FHVVRI DQGZLOOQRWFRQWULEXWHZLWKWKLVLQVXUDQFH7KLVLQVXUDQFHDSSOLHVVHSDUDWHO\WRHDFKLQVXUHGRUDGGLWLRQDOLQVXUHGZKR LVVHHNLQJFRYHUDJHRUDJDLQVWZKRPDFODLPLVPDGHRUDVXLWLVEURXJKW7KHLVVXLQJFRPSDQ\VKDOOPDLOWKLUW\ GD\VDGYDQFHQRWLFHWRWKH&LW\IRUDQ\SROLF\FDQFHOODWLRQWHUPLQDWLRQQRQUHQHZDORUUHGXFWLRQLQFRYHUDJH´ & 5HTXLUHG6XEPLWWDOVIRU:RUNHUV¶&RPSHQVDWLRQ,QVXUDQFH &RQWUDFWRUVKDOOSURYLGH&LW\ZLWKD FHUWLILFDWHRILQVXUDQFHDQGDVXEURJDWLRQHQGRUVHPHQWRQIRUPVVDWLVIDFWRU\WRWKH&LW\$WWRUQH\RU&LW\¶V5LVN 0DQDJHUDQGVLJQHGE\WKHLQVXUDQFHFDUULHURULWVDXWKRUL]HGUHSUHVHQWDWLYH±ZKLFKIXOO\PHHWWKHUHTXLUHPHQWVRI DQGFRQWDLQSURYLVLRQVHQWLUHO\FRQVLVWHQWZLWKWKLV&RQWUDFW¶VZRUNHUVFRPSHQVDWLRQLQVXUDQFHUHTXLUHPHQWV,I &RQWUDFWRULVVHOILQVXUHGIRUZRUNHUV¶FRPSHQVDWLRQDFRS\RIWKH³&HUWLILFDWHRI&RQVHQWWR6HOILQVXUH´IURPWKH 6WDWHRI&DOLIRUQLDLVUHTXLUHG RULI&RQWUDFWRULVODZIXOO\H[HPSWIURPZRUNHUV¶FRPSHQVDWLRQODZVDQ³$IILUPDWLRQRI ([HPSWLRQIURP/DERU&RGH´IRUPLVUHTXLUHG ' 5HTXLUHG(YLGHQFHRI%XLOGHU¶V5LVN&RYHUDJH&LW\ZLOOSURYLGHDFHUWLILFDWHRILQVXUDQFHDQGD GHFODUDWLRQVSDJHRQDIRUPVDWLVIDFWRU\WRWKH&LW\$WWRUQH\RU&LW\¶V5LVN0DQDJHUDQGVLJQHGE\WKHLQVXUDQFHFDUULHU RULWVDXWKRUL]HGUHSUHVHQWDWLYH7KHSROLF\WHUPVPXVWIXOO\PHHWWKHUHTXLUHPHQWVRIDQGFRQWDLQSURYLVLRQVHQWLUHO\ FRQVLVWHQWZLWKDOORIWKHLQVXUDQFHUHTXLUHPHQWVVHWIRUWKKHUHLQ 7KH&LW\VKDOOEHQDPHGDVDORVVSD\HHRQWKH LQVXUDQFHSROLF\IRUWKHIXOOUHSODFHPHQWYDOXHRIDOOEXLOGLQJVVWUXFWXUHVIL[WXUHVDQGPDWHULDOVWREHFRQVWUXFWHG PDLQWDLQHGUHSDLUHGRUVXSSOLHGSXUVXDQWWRWKLV&RQWUDFW ( &RQWUDFWRUDJUHHVWRPRQLWRUDQGUHYLHZDOOVXFKFRYHUDJHDQGDVVXPHVDOOUHVSRQVLELOLW\IRU Western Allied Corporation Page 119 of 221 . . Item 10 Page 119 of 221 HQVXULQJWKDWDOOUHTXLUHGFRYHUDJHLVSURYLGHG&RQWUDFWRUDJUHHVWRREWDLQFHUWLILFDWHVHYLGHQFLQJVXFKFRYHUDJH ) &RQWUDFWRUDJUHHVWRSURYLGHLPPHGLDWHQRWLFHWR&LW\RIDQ\FODLPRUORVVDJDLQVW&RQWUDFWRUWKDW LQFOXGHV&LW\RUDQ\RWKHULQGHPQLWHHDVDGHIHQGDQW&LW\DVVXPHVQRREOLJDWLRQRUOLDELOLW\E\VXFKQRWLFHEXWKDVWKH ULJKW EXWQRWWKHGXW\ WRPRQLWRUWKHKDQGOLQJRIDQ\VXFKFODLPRUFODLPVLIWKH\DUHOLNHO\WRLQYROYH&LW\ * 1ROLDELOLW\SROLF\VKDOOFRQWDLQDQ\SURYLVLRQRUGHILQLWLRQWKDWZRXOGVHUYHWRHOLPLQDWHVRFDOOHG³WKLUG SDUW\DFWLRQRY HU´FODLPVLQFOXGLQJDQ\H[FOXVLRQIRUERGLO\LQMXU\WRDQHPSOR\HHRIWKHLQVXUHGRURIDQ\FRQWUDFWRURU VXEFRQWUDFWRU + $Q\³VHOILQVXUHGUHWHQWLRQ´PXVWEHGHFODUHGDQGDSSURYHGE\&LW\&LW\UHVHUYHVWKHULJKWWRUHTXLUH WKHVHOILQVXUHGUHWHQWLRQWREHHOLPLQDWHGRUUHSODFHGE\DGHGXFWLEOH6HOIIXQGLQJSROLF\IURQWLQJRURWKHUPHFKDQLVPV WRDYRLGULVNWUDQVIHUDUHQRWDFFHSWDEOH,I&RQWUDFWRUKDVVXFKDSURJUDP&RQWUDFWRUPXVWIXOO\GLVFORVHVXFKSURJUDP WR&LW\ Western Allied Corporation Page 120 of 221 . . Item 10 Page 120 of 221 Western Allied Corporation Page 121 of 221 . . Item 10 Page 121 of 221 Western Allied Corporation Page 122 of 221 . . Item 10 Page 122 of 221 (;+,%,7% 63(&,$/3529,6,216 63(&,),&)257+,6352-(&7 Western Allied Corporation Page 123 of 221 . . Item 10 Page 123 of 221 EXHIBIT B – SPECIAL PROVISIONS Contract No 2023XXXX EXHIBIT B – SPECIAL PROVISIONS SPECIFIC FOR THIS PROJECT CITY HALL HVAC SYSTEM IMPROVEMENTS Contract No. 20240089 Western Allied Corporation Page 124 of 221 . . Item 10 Page 124 of 221 EXHIBIT B – SPECIAL PROVISIONS Contract No 2023XXXX Table of Contents A. General .................................................................................................................................................. 3 1. Scope of Work .................................................................................................................................. 3 2. Length of Contract ............................................................................................................................ 4 3. Liquidated Damages ......................................................................................................................... 4 4. Delays and Extensions of time .......................................................................................................... 4 5. Quality of Work ................................................................................................................................ 5 6. Unit Prices ........................................................................................................................................ 5 7. Extra Work ........................................................................................................................................ 5 8. Compliance with Laws, Regulations, and Safe Practices .................................................................. 5 B. Construction Phase Specifications ......................................................................................................... 6 1. Scheduling of Work .......................................................................................................................... 6 2. Material Submittals .......................................................................................................................... 6 3. Weather Limitations ......................................................................................................................... 6 4. Construction Hours .......................................................................................................................... 6 5. Notification of Affected Residents/Businesses ................................................................................. 6 6. Notification of Utilities ..................................................................................................................... 7 7. Protection of the Public .................................................................................................................... 7 8. Noise Restrictions ............................................................................................................................. 7 9. Construction Order of Work ............................................................................................................. 8 10. Character of Workers ....................................................................................................................... 8 11. Examination of Site........................................................................................................................... 8 12. Mobilization...................................................................................................................................... 8 13. Dust Control ..................................................................................................................................... 9 14. Best Management Practices (BMP’s) ............................................................................................... 9 15.Temporary Water Meter .................................................................................................................. 9 16. Cleaning of Site During Construction ................................................................................................ 9 17. Sanitary Facilities .............................................................................................................................. 9 18. Final Cleaning of Site and Restoration ............................................................................................ 10 19. Contractor Responsibility ............................................................................................................... 10 C. Technical Specification ........................................................................................................................ 11 D. Contractor Qualifications .................................................................................................................... 19 E. DDC Reference List .............................................................................................................................. 19 Western Allied Corporation Page 125 of 221 . . Item 10 Page 125 of 221 EXHIBIT B – SPECIAL PROVISIONS Contract No 2023XXXX A.General 1. Scope of Work This project consists of requesting proposals to perform the design / build a retrofit portion of an existing HVAC controls at City of Vernon City Hall. 1. Controls Retrofit a. The 13 Zones served by the Trane Intellipac rooftop AC unit as well as the unit itself is an obsolete version of Trane Tracker. Some areas of the facility have recently been updated to a LON/BACnet Multi-protocol system. This project will expand the LON/BACnet Multi-protocol system to incorporate the following. i. Trane SXHFC50 rooftop packaged unit on the east end of the building. 1. A new 20HP Variable Frequency Drive shall be provided and installed external to the RTU in a NEMA 3R enclosure. A shaft grounding device shall be added to the existing supply fan motor and the existing inlet guide vanes shall be locked in the fully open position. 2. All relevant points for enabling and controlling the RTU shall be brought into the BMS. 1. Outside Air Temperature 2. Return Air Temperature 3. Mixed Air Temperature 4. Supply Air Temperature 5. Building Static Pressure 6. Supply Fan Motor Status 7. Supply Fan VFD Status 8. Supply Fan motor amp draw 9. Supply Fan VFD fault 10. Supply Fan VFD speed 11. Relief Fan Status 12. Compressor Status 13. Hi Static Switch 14. Rooftop Unit Alarm ii.(13) VAV zones served by the Trane RTU above 1. Space temperature 2. Leaving air temperature (where heating is present) 3. Airflow 4. Airflow set point. 5. Damper position Western Allied Corporation Page 126 of 221 . . Item 10 Page 126 of 221 EXHIBIT B – SPECIAL PROVISIONS Contract No 2023XXXX 6. Reheat valve position. iii. The rooftop boiler plant which is adjacent to the Trane SXHFC50 1. Boiler enable. 2. Boiler status 3. Hot water supply & return temperature. b. The multi-protocol system shall integrate seamlessly with the recently installed DDC system serving the City Hall basement, Council Chambers and 911 Dispatch. i.Any brand of equipment may be used as long as it is multi-protocol compatible. ii.Parts must be available on the open market. iii.Support must be available from any multi-protocol certified contractor, without regard to manufacturer/ dealer affiliations. c. Contractor shall provide all necessary cabling for the installation of the new system. Conduit shall be provided were exposed to view or outdoors. d. MSTP backbone will not be allowed. The technical specifications, contractor qualifications and references required are an integral part of the scope and will be a critical aspect to the evaluation of the proposals received. Proposals that do not comply with the required technical specification, references or qualification will be disqualified and deemed non-responsive. 2. Length of Contract All work in this project shall be completed within thirty (30) calendar days as specified in the Bidder's Proposal. 3. Liquidated Damages In accordance with Section 6-9 of the Standard Specifications, for each consecutive calendar day in excess of the time specified for completion of the work, as adjusted in accordance with Section 6-9 of the Standards Specifications, the Contractor shall pay to the agency, or have withheld from monies due it, the sum of two hundred and fifty ($250) per calendar day. 4. Delays and Extensions of time The provisions of Section 6-4 entitled "Delays and Extensions of Time" of the Standard Specifications shall apply except as modified and supplemented below. The second paragraph of subsection 6-4.1 is hereby deleted and the following paragraph shall be inserted in its place: No extension of time will be granted for a delay caused by the inability of the Contractor to obtain materials, equipment and labor, except as authorized by the City's Project Manager. The length of contract time stipulated includes any time which may be required to obtain materials, equipment and labor, and the Contractor in submitting a bid shall be deemed to have ascertained Western Allied Corporation Page 127 of 221 . . Item 10 Page 127 of 221 EXHIBIT B – SPECIAL PROVISIONS Contract No 2023XXXX the availability of materials, equipment and labor and considered same in his/her proposed construction schedule. 5. Quality of Work The provisions of Section 3 entitled "Control of the Work" of the Standard Specifications shall apply. In addition, any work deemed unacceptable by the City's Project Manager, whether a cause is determined or not shall be repaired or replaced by the Contractor at his/her expense. 6. Unit Prices All costs not covered by specific unit prices but required for a complete job in place, shall be included in the items most related to the work. 7. Extra Work In the event the City and the Contractor are unable to negotiate an agreed price for extra work, which is acceptable to both parties, payment shall be made based on time and materials as follows: x Work by the Contractor: The following percentages shall be added to the Contractor's cost and shall constitute the markup for all overhead and profits: 1. Labor 33% 2. Materials 15% 3. Equipment Rental 15% 4. Other Items and Expenditures 15% x Work by the Subcontractor: When all or any part of the extra work is performed by a subcontractor, the markup provided by the Contractor as mentioned above shall apply to the subcontractor’s actual costs. A markup of 5% of the subcontracted portion of each extra work may be added for the Contractor. 8. Compliance with Laws, Regulations, and Safe Practices The Contractor shall perform all work in a safe, competent manner and in accordance with all federal, state, and local statues, regulations, ordinances, rules, and governmental orders. The Contractor will be solely and completely responsible for the conditions of the job site, including safety of all persons and property during performance of the work. This requirement will apply continuously and not be limited to normal working hours. Inspection of the Contractor's performance by the City, its agents, or employees is not intended to include review of the adequacy of the Contractor's safety measures in or near the job site. Western Allied Corporation Page 128 of 221 . . Item 10 Page 128 of 221 EXHIBIT B – SPECIAL PROVISIONS Contract No 2023XXXX B.Construction Phase Specifications 1. Scheduling of Work The Contractor shall submit his/her work schedule to the City's Project Manager prior to the pre- construction meeting. The construction schedule shall show the sequence of work, critical path and estimated time for completion of each segment of work. This schedule must be reviewed and accepted by the City's Project Manager before the Contractor will be permitted to begin work. In addition, the Contractor shall submit a detailed schedule forecasting two weeks of work describing each day’s work. This schedule shall be updated and submitted to the City every other Monday during the construction period. The Contractor shall give 48 hours’ notice to the City's Project Manager prior to the start of the work. 2. Material Submittals The Contractor shall provide all required submittals including, but not limited to the following: x Shop drawings x Materials and mix designs (submitted upon reward of the contract for review and approval before the construction); and x Truncated domes (modify/update as needed) The “Notice to Proceed” will not be issued to the Contractor until all the submittals have been reviewed and approved by the City. 3. Weather Limitations Placement operations shall not be performed during wet conditions or if rain or cold conditions (less than 45°F) are imminent or predicted to exist at any time. “Imminent or predicted” is defined as being forecasted within a 48-hour period on the National Weather Service Web Site http://www.wrh.noaa.gov for the most representative and nearest location listed where placement is to begin and end. 4. Construction Hours Work shall occur Monday-Thursday between the hours of 7:00 am to 4:00 pm unless otherwise specified by the City’s Project Manager. 5. Notification of Affected Residents/Businesses The Contractor shall be responsible for distribution of the general information letter of the project to all affected residents and businesses. A project general information letter and sufficient copies thereof will be prepared by City staff for Contractor distribution to all residents, business establishments, and institutions fronting on or directly affected by the project. The Contractor shall be responsible for distribution of said letter in handout form to all the appropriate residences and buildings in the subject area. Distribution shall be accomplished in a manner acceptable to the City's Project Manager and shall be five (5) working days prior to the beginning of construction operations in the immediate vicinity. Western Allied Corporation Page 129 of 221 . . Item 10 Page 129 of 221 EXHIBIT B – SPECIAL PROVISIONS Contract No 2023XXXX In addition to the above, the Contractor shall be fully responsible for such other notifications as may be required related to necessary closures of streets, alleys, driveways, etc., or to unavoidable access or parking restrictions. These notifications shall apply where the closures and access or parking restrictions required in the performance of any work under this contract preclude any resident, tenant, or property owner from utilizing the premises or conducting business thereon in a reasonable and customary manner. Additional notification to the affected businesses and residents shall be prepared by the City and distributed by the Contractor for roadway and driveway closures five (5) working days in advance of any construction work. No removal or excavation work is allowed until the additional notification has been distributed to the affected residents and businesses. If a Contractor is unable to adhere to his/hers schedule as indicated on his/hers written notification, then all the affected residents and places of business shall be re-notified of the revised schedule, in writing, as indicated above. Contractor costs for all of the above notifications shall be considered as included in the appropriate items of the Bid Proposal. 6. Notification of Utilities The provisions of Section 402 entitled "Utilities" of the Standard Specifications shall apply. The Contractor shall contact the Underground Service Alert of Southern California (U.S.A.) at least three (3) working days in advance of the construction work. 7. Protection of the Public The Contractor shall take such steps and precautions as his/her operations warrant to protect the public from danger, loss of life, loss of property or interruption of public services. Unforeseen conditions may arise which will require that immediate provisions be made to protect the public from danger or loss, or damage to life and property, due directly or indirectly to prosecution of work under the contract. Whenever, in the opinion of the City's Project Manager, a condition exists in which the Contractor has not taken sufficient precaution of public safety, protection of utilities, and/or protection of adjacent structures or property, the City's Project Manager will order the Contractor to provide a remedy for the condition. If the Contractor fails to act on the situation within a reasonable time period as determined by the City's Project Manager, or in the event of an emergency situation, the City's Project Manager may provide suitable protection by causing such work to be done and material to be furnished as, in the opinion of the City's Project Manager, may seem reasonable and necessary. The cost and expense of all repairs (including labor and materials) as are deemed necessary, shall be borne by the Contractor. All expenses incurred by the City for emergency repairs will be deducted from the final payment due to the Contractor. 8. Noise Restrictions The Contractor may not operate certain power equipment, within a residential area or within a radius of five-hundred (500) feet from a residential area, except during the following times: x From 7:00 am to 4:00 pm, Monday through Thursday Western Allied Corporation Page 130 of 221 . . Item 10 Page 130 of 221 EXHIBIT B – SPECIAL PROVISIONS Contract No 2023XXXX x From 6:00 am to 5:00 pm on Saturday and Sunday In addition, the noise level from the Contractor's operations shall not exceed eighty-five (85) dBA when measured within a one hundred (100) foot radius at any time. 9. Construction Order of Work Work shall be scheduled so as to lessen the impact upon businesses. All construction shall conform to the latest edition of the Standard Specifications and shall proceed in a smooth, efficient, timely and continuous manner. As such, once construction is started in a work area, the Contractor will be required to work continuously in that work area until construction has been completed and the work area is open and accessible to both vehicular and pedestrian traffic in a manner approved by the City's Project Manager before the next stage of work will be allowed to begin. Once construction is started in a work area, the Contractor shall not withdraw manpower or equipment from that work area in order to start construction in another work area if doing so, in the opinion of the City's Project Manager, delays the completion of the work presently under construction. The Contractor shall maintain continuous access to all residents and businesses within the project limits, including drive approaches, unless the Contractor has obtained the approval of the City's Project Manager to close either such access or drive approach. No stockpiling of material and construction equipment on public streets or sidewalks will be permitted on this project unless approved by the City's Project Manager. Material and equipment placed on public streets, sidewalks and on the construction, areas shall be used the same day. 10. Character of Workers If any subcontractor or person employed by the Contractor shall fail or refuse to carry out directions of the City's Project Manager or shall appear to the City's Project Manager to be incompetent or act in a disorderly or otherwise improper manner, he/she shall be immediately discharged from the project on the request of the City's Project Manager, and such person shall not be reemployed on the work. If said individual has an ownership interest in the contracting entity, the City's Project Manager will serve written notice upon the Contractor and the Surety providing the faithful performance bond, in accordance with Section 6-8, "Termination of the Contractor by Default" of the Standard Specifications, demanding complete and satisfactory compliance with the Contract. 11. Examination of Site The Contractor is required to examine the site and judge for themselves the location. Physical conditions, substructures and surroundings of the proposed work. 12. Mobilization The cost of all preparatory work and operations for the multiple movements of personnel, Western Allied Corporation Page 131 of 221 . . Item 10 Page 131 of 221 EXHIBIT B – SPECIAL PROVISIONS Contract No 2023XXXX equipment, supplies, and incidentals to the project site must be included in the various bid items, and no extra compensation will be paid to the Contractor. 13. Dust Control Throughout all phases of construction, including suspension of work, and until final acceptance of the project, the Contractor shall abate dust nuisance by cleaning, sweeping and sprinkling water, or other means as necessary when requested by the City. Failure of the Contractor to comply with the City's Project Manager cleanup orders may result in an order to suspend work until the condition is corrected. No additional compensation or extension of contract completion time will be allowed as a result of such suspension. The cost of furnishing and operating dust control during the construction project shall be included in the various bid items, and no extra compensation will be paid to the Contractor. 14. Best Management Practices (BMP’s) The Contractor shall submit a copy of their Best Management Practices (BMPs) to the City Engineer for review ten (10) days prior to the beginning of any work. The Contractor is hereby notified that specific construction practices in the Standard Specifications, Section 3-12.6.2, “Best Management Practices (BMPs)” are considered to be Best Management Practices. The Contractor shall implement and maintain such BMP’s as are relevant to the work, and as are specifically required by the Plans or Special Provisions. The Contractor shall not commence activity until the BMP submittal has been reviewed and approved. 15. Temporary Water Meter If necessary, the Contractor shall obtain a temporary water meter from the City of Vernon Water Department by placing a deposit of $1,000. Contractor shall pay for all water used. Contractor shall not relocate the service. The Contractor shall call the City of Vernon Water Department to relocate the service and will be charged fifty dollars ($50.00) for each relocation. 16. Cleaning of Site During Construction During construction, all existing improvements, including pavement, sidewalk, curb and gutter, adjacent to the work area shall be swept free from soils, gravel, dirt or debris on a daily basis. The Contractor is responsible for maintaining all sidewalk, curb and gutter areas within the construction zone free from loose materials at all times. 17. Sanitary Facilities The Contractor shall furnish and maintain sufficient sanitary facilities by the worksites for the entire duration of construction activities. The cost of furnishing and maintaining sufficient sanitary facilities shall be included in the various bid items, and no extra compensation will be paid to the Contractor. Western Allied Corporation Page 132 of 221 . . Item 10 Page 132 of 221 EXHIBIT B – SPECIAL PROVISIONS Contract No 2023XXXX 18. Final Cleaning of Site and Restoration The Contractor shall be responsible for cleaning and restoration of all damaged existing improvements such as sidewalk, driveway, curb and gutter, and private property at no cost to the City. The Contractor shall remove all loose aggregates by sweeping all the sidewalks and gutters. The cost of furnishing and operating such sweeping after the construction of the project must be included in the various bid items, and no extra compensation will be paid to the Contractor. 19. Contractor Responsibility The Contractor shall be responsible for the final product and shall make any quality control, adjustments and corrections necessary to obtain the final product accepted by the City's Project Manager. The Contractor shall perform process and quality control sampling and testing and exercise management control the work of his/her subcontractors, technicians and workers to ensure that the milling, transporting, spreading, compaction, and finishing processes conform to these Specifications. The City's Project Manager shall have unrestricted access to the laboratory, sampling, testing sites, and all information resulting from mix design and quality control activities. All Quality Control testing results shall be submitted to the City's Project Manager on a daily basis. Western Allied Corporation Page 133 of 221 . . Item 10 Page 133 of 221 EXHIBIT B – SPECIAL PROVISIONS Contract No 2023XXXX C.Product Installation and Technical Specification DDC Technical Specification The following network controls specification is a full performance and functional description of a controls system. It does not mandate any particular component manufacturer. It does clearly define the system performance and functional requirements necessary to ensure the following: 1. Delivery of an open, interoperable system. 2. Delivery of a fully serviceable system where the owner “owns” their system. 3. Removes the typical vendor closed proprietary system elements. 4. Ensures the controls contractor delivers a working system in which the owner has all of the training, software, and tools to perform their own maintenance, upgrades and service if they should choose to do so. 5. Provides a path for fair competitive bidding on multiple phases of the system. 6. Provides for competitive bidding on the initial installation of the system as well as future service contracts. This specification is to be implemented in conjunction with the accompanying equipment minimum points list. No existing control drawings exist. The contractor will be responsible for determining existing inputs & outputs, physical locations of controllers and the existing sequence of operation. The existing sequence of operation may be used as a basis for the new sequence. The sequence of operation shall appear (in clear text) on the plans to be produced by the contractor (both construction and record drawings) and be stamped by an engineer licensed in the state of California. Construction and record drawings shall show field wiring of all components, as well as the labeling methodology by which all terminations shall be labeled. The drawings shall also include the points list with appropriate labeling notes. Please note that no final payment will be made until all drawings are complete and all terminations are labeled. Owner instruction shall consist of three (3) four-hour sessions, separated by at least one week so the owner can accumulate operating experience prior to the next session. In addition, unlimited telephone support will be included without charge during the warranty period (one year), without the need for a service agreement of any kind. Control System Specification I.Project Description and Scope 1. This section defines the Basic Materials and Methods to be provided by the Controls Contractor and used in the installation of network control products to provide the functions necessary for control of the various systems on this Western Allied Corporation Page 134 of 221 . . Item 10 Page 134 of 221 EXHIBIT B – SPECIAL PROVISIONS Contract No 2023XXXX project. Please be advised that the requirements of this specification will be strictly enforced. Systems that do not meet the requirements of the specification as outlined below will not be accepted. 2. The control system shall utilize an open, industry standard networking communication protocol and network management system to provide direct access to each device. All messaging on the system shall provide direct peer- to-peer communication capability and provide for device level interoperability. The system shall implement a logical flat, physically tiered architecture model in order to ensure interoperability and remove any closed system elements. 3. No closed network communication elements will be allowed and will be strictly enforced. No non-open communication to devices from network tools, host interfaces, or enterprise level applications will be permitted. 4. All data flow on the network shall be fully published and documented. No vendor specific closed communication will be allowed. 5. The system shall consist of interoperable devices, standard routers, standard network interfaces, standard IP communications (if required), and open user interfaces. No closed system components will be permitted including custom gateways (unless expressly defined below), logically tiered hardware or software architecture elements, or closed system tools. 6. All systems and subsystems shall be capable of being serviced and maintained internally or by a third party service organization. Under no circumstances shall any hardware or software be implemented such that the City will not be able to provide access to a service organization of our choice. 7. The contractor shall supply all hardware, software, databases, configuration tools, commissioning tools, analysis tools, and software plugins on this project to the owner. All tools shall be properly licensed and conveyed. All original software, software keys, and licenses shall be conveyed such that the owner shall have full access and usage rights to all components. 8. The contractor shall follow all industry standards and relevant guidelines for the control network, device selection, network wiring, configuration, and commissioning. 9. This project may be part of a multi-phase project and, as such, nothing delivered shall force the owner to require contracting to the original contractor for future phase work. All elements of the control system shall be delivered such that any alternate contractor will be able to add, modify, or enhance the existing system without the need for the original contractor. 10. All hardware supplied shall be available for purchase directly by the owner or the owner’s agent at industry competitive pricing for future spare parts. The owner shall have the right to purchase spare parts at any time directly from the contractor or the contractor’s assigned agent without the need for any future integration contract. 11. The contractor shall demonstrate their ability and intent to fully complete this project as specified. No alternate bids or exceptions will be accepted. Western Allied Corporation Page 135 of 221 . . Item 10 Page 135 of 221 EXHIBIT B – SPECIAL PROVISIONS Contract No 2023XXXX The contractor shall demonstrate their knowledge, ability, and experience in providing the system as specified. 12. No system will be accepted that is not supported locally by multiple contractors. II. Control Devices 1. Communications media I. Transformer isolation – all devices shall be isolated from the network using a transformer isolated transceiver capable of common mode rejection to ensure network reliability and that a power surge on the communication buss will not take down the entire network. II. All devices shall implement polarity insensitive transceivers in order to reduce mis-wiring. III. Devices using twisted pair wiring shall operate at the same bit rate (minimum of 78Kbps) to ensure interoperable device to device communication. 2. Communication protocol I. International Standard Protocol - Devices shall utilize a common ISO/IEC listed open communication protocol. All devices on the network shall implement the full protocol stack. No partial or limited protocol stack implementations will be accepted in order to ensure reliable full communication between devices, improve installation time, and reduce field engineering. II. Network security – all devices shall implement a native communication security mechanism such as device authentication at the device level to prevent unauthorized access on the network. III. All devices shall implement peer-to-peer communication protocol. No master slave protocol implementations will be acceptable. Reduce single point of failure. 3. Device Network Management I. All devices shall be configurable via an open network management tool. No explicit addressing will be allowed in order to prevent proprietary devices being installed on the open network. II. Devices shall not implement the use of DIP switches for network addressing in order to prevent mis-addressing. III. All devices shall include a unique physical node address stored on non- volatile memory on the device to prevent the possibility of two devices having the same address and causing network communication problems. IV. All complex devices shall be delivered with a device software configuration plugin capable of being run from any standard network Western Allied Corporation Page 136 of 221 . . Item 10 Page 136 of 221 EXHIBIT B – SPECIAL PROVISIONS Contract No 2023XXXX management tool. No proprietary configuration communication mechanisms will be allowed. Plug-in software shall be supplied for each device. A backup of all plugin software for each device shall be provided on optical media. V. All devices shall be capable of identifying themselves via a visual indicator if requested to by a network management or commissioning tool. VI. All devices configuration and applications shall be able to be updated over the network. In no cases shall a device have to be physically removed from the network in order to be updated with new software or configuration. 4. Programming of Devices I. Programmable devices shall be programmed with an openly available programming tool. II. Device programming tools shall be fully licensed and conveyed at contract sign off. III. Programmable devices shall follow open standard interoperability guidelines. No closed or proprietary interfaces to programmable devices will be allowed. IV. Once programmed a programmable device shall interoperate as any other application specific device on the network. No closed or proprietary communication to programmable devices will be allowed. V. Field programmability of devices must be provided. a. Device programming tools shall be able to run on the Operator Workstation (see Operator Workstation Computer requirements) III.System Infrastructure 1. Wiring I. The network infrastructure shall consist of a two wire, polarity insensitive twisted pair network. All devices shall connect directly to the twisted pair network as peers. No home run wiring will be acceptable. II. Wiring capable of bus, start or loop wiring with single termination when wired in a “free wiring” setup. Bus wiring may be used to extend the length of the network where appropriate. Double termination is required if bus networking is used in order to improve network communication reliability. III. Network wiring shall consist of a twisted pair, unshielded, polarity insensitive structure such that wiring issues are minimized. IV. Wiring lengths shall conform to the industry published guidelines with a minimum of 20% headroom on each segment in order to allow for future network enhancements. Example: If the network wiring guidelines call for Western Allied Corporation Page 137 of 221 . . Item 10 Page 137 of 221 EXHIBIT B – SPECIAL PROVISIONS Contract No 2023XXXX a maximum of 500 meters per segment, wiring shall consist of 20% less than 500 meters or a total of 400 meters. V. The maximum number of devices per wiring segment shall be 80% of the published maximum in order to provide for future expansion. Example: if the published wiring guidelines allow for 64 devices per segment, the maximum allow will be 80% of 64 or 51 devices maximum. 2. Connectivity I. Network segments shall be connected by a standard layer-3 transparent router. No gateways or application specific routers will be permitted to reduce the engineering customization and proprietary hardware interfaces. II. Logical network routers shall have the capability of forwarding and blocking messages relevant for each segment of the network in order to maximize network traffic capabilities. III. A maximum of one (1) physical layer repeater is allowed per segment in order to extend the length of the segment. The maximum number of nodes on the segment shall not exceed the defined limits including future expansion limits. IV. A network interface shall be provided at each connectivity point to a host computer. The network interface shall be configured in the same manner as any other device on the network. No Master/Slave interfaces are allowed to reduce the potential for single point of failure and heavy traffic loading. IV.Network Management I. All devices on the network shall be installed by a single, common, network management tool. II. Network management tools shall create one common network database for all devices within the domain (system). An accurate, up to date copy of the network management database shall be delivered on optical media at contract sign off. III. The network management tool shall run on a Windows PC and be provided with the current software version. A fully licensed version of the software shall be conveyed at contract sign-off including any license keys or software security. The software shall be the property of the owner. All rights to use the software shall be properly conveyed to the owner. IV. Provide a computer system which shall properly and fully run the network management software, store the network database, and provide full configuration capability of all devices on the network. V. Complex application specific devices shall be configured using a network management software plugin in order to improve the commissioning time of each device. Western Allied Corporation Page 138 of 221 . . Item 10 Page 138 of 221 EXHIBIT B – SPECIAL PROVISIONS Contract No 2023XXXX V.User Interfaces i. Contractor shall provide an operator workstation (PC) running a current version of the Windows Operating Systems. A keyboard and minimum 24” flat screen color monitor shall be included. ii. The operator workstation shall have the ability to monitor, control, diagnose, and display all data as defined in the Points List. Capabilities shall be indicated as: Monitored, Controlled, Displayed, Trended, Alarmed, Override, or Reported. As a minimum, the graphical webpage interface will include the following: Home page with main navigation menu; Floor plans showing all zoning and sensor locations; Typical VAV box graphic; Typical AHU graphic; Hot water system graphic; Chilled water system graphic. iii. All host computer software shall be fully licensed. Software shall include original Optical Media of each application. All applications shall be property of the project owner. All software keys, licenses, dongles, etc. shall be conveyed at contract sign off. iv. Host software shall not have an closed (non-open) interface to any hardware. No explicitly addressed communication will be allowed. All communication to devices shall follow industry open standards. No vendor lock-in will be allowed. v. The contractor shall prove and verify that all host software to hardware communication is open and interoperable to the satisfaction of the owner/engineer. vi. The graphical user interface shall be web based and cross browser compatible. VI.IP and Enterprise Connectivity i. The control network shall interface and connect to the data network using industry standard interfaces. No proprietary closed interfaces will be allowed. ii. Data connections from the control network to the data network shall use standard protocol tunneling mechanisms to ensure data integrity. Protocol translators that modify the data values, ranges, resolutions, will not be accepted. iii. Contractor shall supply all necessary data network elements needed to ensure a fully functioning system including tunneling routers, network interfaces, firewalls, switches, IP routers. iv. Contractor shall interface with owners IT department to define any and all IP needs for this system. v. Connectivity to the enterprise network shall ensure data integrity, reliability, performance, and security. Contractor to interface with Western Allied Corporation Page 139 of 221 . . Item 10 Page 139 of 221 EXHIBIT B – SPECIAL PROVISIONS Contract No 2023XXXX owners enterprise personnel to ensure system functionality. Details of the enterprise and data network requirements are defined in a separate section of this spec. VII.Network Reliability i. Provide a comprehensive analysis of all control networking capabilities showing that all communication is in acceptable ranges. Provide a network analysis summary for each channel for a typical 24 hour period during system full operation showing that all communication is within acceptable limits and that there are no network sizing issues, device communication issues, wiring issues, or bandwidth issues. ii. Deliver a fully licensed network analysis tool as part of the system with completed documentation and demonstration on its use. VIII.Security i. The system shall employ a high degree of network security in order to prevent tampering. ii. Control Network iii. Each controller on the control network shall incorporate a network security algorithm at the protocol layers such as message authentication or message encryption. iv. Devices with high degree of security shall have the option to have their security feature enabled. Other devices shall have the option to turn off their security process in order to improve system performance. v. The system detailed points list shall define which network communication elements shall employ the communication security. vi. Data Network vii. The data network shall follow standard Ethernet TCP/IP security protocol options such as firewalls, ND5, HTTPS, secure socket layer and more. Refer to the data network requirements. IX.Warranty I. The contractor shall provide a full and complete system warranty (non- prorated, parts & labor) for a period of one (1) year commencing after final project sign off. II. Contractor warranty shall provide full system functionality, parts replacement, labor, software and hardware upgrades necessary in to ensure full system functionality during the warranty period. X.Support Western Allied Corporation Page 140 of 221 . . Item 10 Page 140 of 221 EXHIBIT B – SPECIAL PROVISIONS Contract No 2023XXXX i. Contractor shall provide full telephone support for the warranty period without additional cost. XI.Serviceability i. The contractor shall provide a fully serviceable system with complete access to all system components, controllers, sensors, actuators, panels, wiring junction boxes. All elements of the system must be accessible by maintenance staff. ii. Ensure all cabinets, enclosures, and installations are accessible without hindrance. Provide all cabinet keys with clear indications to their location. iii. No contractor or vendor proprietary service tools will be allowed. All service tools shall be included as part of this bid. XII.Training I. Training shall be provided on the full operation of the control system. II. Training shall be provided for all network management, commissioning tools, and network diagnostic and analysis tools. III. Training shall be provided on the system architecture, basic protocol capabilities, and servicing of the system IV. Training shall be provided on all device configuration and programming tools. XIII.Integrator Qualifications i. The network system integrator shall be Certified System Integrator according to published proficiency requirements and industry best practices. Integration contractor shall provide a copy of their credentials. ii. The network system integrator shall employ at least two Certified Professionals. Provide the credentials of at least two employees who will be responsible for this project. Credentials shall demonstrate industry best practices for proficiency in the core networking technology provided and shall be up to date. iii. Provide training certificates from key personnel responsible for this project showing class taken and completion date. iv. Provide professional resumes for all key personnel responsible for this project. v. Provide at least two similar prior job examples demonstrating a competent level of knowledge, proficiency, and experience. vi. Integrator shall be fully licensed to perform the intended work. Provide a copy of any and all relevant contractor licenses. Western Allied Corporation Page 141 of 221 . . Item 10 Page 141 of 221 EXHIBIT B – SPECIAL PROVISIONS Contract No 2023XXXX XIV.System Functionality i. Deliver a fully functioning, complete, serviceable system. ii. All devices shall be fully programmed and commissioned, and all systems and subsystems shall be demonstrated to be fully operational. iii. The contractor must include all overtime costs necessary to accomplish any shutdowns during either the holiday closure or over weekends. The City will provide mechanical PDF plans and equipment schedules of the existing penthouse HVAC system as well as PDF floor plans of the areas that will require zone level controls retrofit. D.Contractor Qualifications Due to the requirement to be proficient in both the old control system and the new control system during the phased conversion, the contractor will possess the qualifications noted later in the specification for each system. The bid documents include a requirement to list three (3) reference sites where the contractor has a minimum of three years’ experience supporting the specified new control system and two (2) reference sites where the contractor has a minimum of three years’ experience supporting the existing system. Failure to provide the information noted above will result in the proposal being considered non-responsive. Contractors wishing to submit a proposal shall be able to demonstrate all the following: 1. Minimum 10 years in business under the same name, continuously installing the specified control system. 2. Evidence of full in-house capability for engineering (including at least one mechanical engineer licensed by the state of California), engineered drawings, programming, commissioning, and service support. Construction and record drawings will bear the stamp of an engineer employed by the successfully awarded contractor. 3. Multi-Protocol System Integrator Certification. E.DDC Reference List Provide three (3) reference installations utilizing the specified multi-protocol controls with graphically driven, web-based user interfaces. Site locations and contact person with telephone number must be listed. 1.) Site: Western Allied Corporation Page 142 of 221 . . Item 10 Page 142 of 221 EXHIBIT B – SPECIAL PROVISIONS Contract No 2023XXXX Contact: 2.) Site: Contact: 3.) Site: Contact: Provide two (2) reference installations utilizing the existing Trane controls as described above. Site locations and contact person with telephone number must be listed. 1.) Site: Contact: 2.) Site: Contact: Western Allied Corporation Page 143 of 221 . . Item 10 Page 143 of 221 (;+,%,7& (48$/(03/2<0(1723325781,7< 35$&7,&(63529,6,216 $ &RQWUDFWRUFHUWLILHVDQGUHSUHVHQWVWKDWGXULQJWKHSHUIRUPDQFHRIWKLV$JUHHPHQWWKHFRQWUDFWRUDQGHDFK VXEFRQWUDFWRUVKDOODGKHUHWRHTXDORSSRUWXQLW\HPSOR\PHQWSUDFWLFHVWRDVVXUHWKDWDSSOLFDQWVDQGHPSOR\HHV DUHWUHDWHGHTXDOO\DQGDUHQRWGLVFULPLQDWHGDJDLQVWEHFDXVHRIWKHLUUDFHUHOLJLRXVFUHHGFRORUQDWLRQDO RULJLQDQFHVWU\KDQGLFDSVH[RUDJH&RQWUDFWRUIXUWKHUFHUWLILHVWKDWLWZLOOQRWPDLQWDLQDQ\VHJUHJDWHG IDFLOLWLHV % &RQWUDFWRUDJUHHVWKDWLWVKDOOLQDOOVROLFLWDWLRQVRUDGYHUWLVHPHQWVIRUDSSOLFDQWVIRUHPSOR\PHQWSODFHGE\RU RQEHKDOIRI&RQWUDFWRUVWDWHWKDWLWLVDQ(TXDO2SSRUWXQLW\(PSOR\HURUWKDWDOOTXDOLILHGDSSOLFDQWVZLOO UHFHLYHFRQVLGHUDWLRQIRUHPSOR\PHQWZLWKRXWUHJDUGWRWKHLUUDFHUHOLJLRXVFUHHGFRORUQDWLRQDORULJLQ DQFHVWU\KDQGLFDSVH[RUDJH & &RQWUDFWRUDJUHHVWKDWLWVKDOOLIUHTXHVWHGWRGRVRE\WKH&LW\FHUWLI\WKDWLWKDVQRWLQWKHSHUIRUPDQFHRIWKLV $JUHHPHQWGLVFULPLQDWHGDJDLQVWDSSOLFDQWVRUHPSOR\HHVEHFDXVHRIWKHLUPHPEHUVKLSLQDSURWHFWHGFODVV ' &RQWUDFWRUDJUHHVWRSURYLGHWKH&LW\ZLWKDFFHVVWRDQGLIUHTXHVWHGWRGRVRE\&LW\WKURXJKLWVDZDUGLQJ DXWKRULW\SURYLGHFRSLHVRIDOORILWVUHFRUGVSHUWDLQLQJRUUHODWLQJWRLWVHPSOR\PHQWSUDFWLFHVH[FHSWWRWKH H[WHQWVXFKUHFRUGVRUSRUWLRQVRIVXFKUHFRUGVDUHFRQILGHQWLDORUSULYLOHJHGXQGHUVWDWHRUIHGHUDOODZ ( 1RWKLQJFRQWDLQHGLQWKLV$JUHHPHQWVKDOOEHFRQVWUXHGLQDQ\PDQQHUDVWRUHTXLUHRUSHUPLWDQ\DFWZKLFKLV SURKLELWHGE\ODZ Western Allied Corporation Page 144 of 221 . . Item 10 Page 144 of 221 NOTICE INVITING BIDS for CITY HALL HVAC SYSTEM IMPROVEMENTS in the City of Vernon One original sealed bid must be signed and submitted prior to 2:00 p.m., Wednesday, November 1, 2023 to the City Clerk’s Office, City of Vernon, 4305 Santa Fe Avenue, Vernon, CA 90058, (“Bid Deadline”). All bids shall be enclosed in sealed envelopes, distinctly marked “Bid” with the title of the bid and the bidder’s name and address appearing on the outside. Bids shall be clearly titled and should be mailed or delivered in person before 2:00 p.m., Wednesday, November 1, 2023, on the Bid Deadline. LATE SUBMITTALS WILL NOT BE ACCEPTED. Bids will be opened in the City Clerk’s Office at 2:00 p.m., Wednesday, November 1, 2023. At the bid opening, the City Clerk shall open bid packages and acknowledge the receipt of Bids. Once all Bid Packages are opened and announced, the contents (collectively, the “Completed Bid Forms” and the uncompleted forms, the “Bid Forms”) will be made available for public review. Except as set forth in Paragraph 22 (“Public Records”), the Completed Bid Forms, once removed from the Bid Packages by the City Clerk, will be a matter of public record. Bid Documents, Plans and Specifications are available at no charge at www.cityofvernon.org/planetbids. (If appropriate) Pre-Bid Meeting: A pre-bid meeting to answer any questions regarding the project plans and specifications is scheduled for at 10: 00 am, Tuesday ,October 17, 2023 in the Public Works Department, 4305 Santa Fe Avenue, Vernon, California. This meeting is to answer any questions regarding the project plans and specifications. Attendees must adhere to the State and local guidelines regarding COVID-19, including applicable industry guidelines for construction sites. Attendance is mandatory. City of Vernon Contact Person: Public Works Department Attention: Kenneth Jackson, Facilities Supervisor Phone: (323) 583-8811 ext. 216 Email: KJackson@cityofvernon.org Western Allied Corporation Page 145 of 221 . . Item 10 Page 145 of 221 Mandatory Qualifications for Bidder and Designated Subcontractors: A Bid may be rejected as non-responsive if the Bidder fails to meet the essential requirements for qualification. General Scope of Work: The contractor shall furnish labor, materials, equipment, services, and specialized skills to perform work involved in the Project. The Work in the Bid is defined in the Project Drawings and Specifications and will generally include: performing the design and retrofitting of a portion of their existing HVAC controls at City Hall. The work shall be done in accordance with the Special Provisions, attached as Exhibit B. In the event of any conflicts, refer to the Procedure of Contract Documents” contained in General Conditions, Section 1.10. Mandatory Qualifications for Bidder and Designated Subcontractors: A Bid may be rejected as non-responsive if the Bid fails to document that Bidder meets the essential requirements for qualification. As part of the Bidder’s Statement of Qualifications, each Bid must establish that: Bidder satisfactorily completed at least (3) prevailing wage public contracts in California; each comparable in scope and scale to this Project, within (3) years prior to the Bid Deadline and with a dollar value in excess of the Bid submitted for this Project. In addition, if the Bidder intends to self-perform the HVAC modification , Bidder shall satisfy the mandatory qualifications described in the Specialty Contractor Statement of Qualifications applicable to such Work and submit the completed forms with the Bid. Subcontractors listed for the HVAC work must satisfy the mandatory qualifications described in the Specialty Contractors’ Statements of Qualifications applicable to the Work to be performed by each Subcontractor and Bidder must submit the completed forms with the Bid. Other Bidding Information: 1. Contract Time: This Work must be completed within thirty (30) calendar days from the date of commencement as established by the City’s written Notice to Proceed. 2. Amount of Liquidated Damages: $ 250 per calendar day. 3. Bidding Documents. Bids must be made on the Proposal Form contained herein. 4. Engineer’s Estimate. An Engineer’s Estimate of the cost of construction of this Work has Western Allied Corporation Page 146 of 221 . . Item 10 Page 146 of 221 been prepared. Said estimate is in the range of $400,000 to $450,000. 7. Acceptance or Rejection of Bids. The City reserves the right to reject any and all bids, to award all or any individual part/item of the bid, and to waive any informalities, irregularities or 1technical defects in such bids and determine the lowest responsible bidder, whichever may be in the best interests of the City. No late bids will be accepted, nor will any oral, facsimile or electronic bids be accepted by the City. 8. Contractor’s License. At the time of the Bid Deadline and at all times during performance of the Work, including full completion of all corrective work during the Correction Period, the Contractor must possess a California contractor’s license or licenses, current and active, of the classification required for the Work, in accordance with the provisions of Chapter 9, Division 3, Section 7000 et seq. of the Business and Professions Code. In compliance with Public Contract Code Section 3300, the City has determined that the Bidder must possess the following license(s): Multi-Protocol System Integrator Certification. Minimum 10 years in business under the same name, continuously installing the specified control system. Evidence of full in-house capability for engineering (including at least one mechanical engineer licensed by the state of California), engineered drawings, programming, commissioning and service support. Construction and record drawings will bear the stamp of an engineer employed by the successfully awarded contractor. The Bidder will not receive a Contract award if at the time of submitting the bid, the Bidder is unlicensed, does not have all of the required licenses, or one or more of the licenses are not current and active. If the City discovers at the time of the Bid Deadline that Contractor is unlicensed, does not have all of the required licenses, or one or more of the licenses are not current and active, the City may reject the Bid, cancel the award, declare the Bid Bond as forfeited, keep the Bid Bond’s proceeds, and exercise any one or more of the remedies in the Contract Documents in addition to those provided by law. 9. Subcontractors’ Licenses and Listing. Bidders must list each Subcontractor whom the Bidder must disclose under Public Contract Code Section 4104 (Subcontractor Listing Law), and the Bidder must provide all of the Subcontractor information that Section 4104 requires (name, address, license number, public works contractor registration number issued pursuant to Labor Code Section 1725.5, and portion of the Work). An inadvertent error in the license number or public works contractor registration number will not be considered nonresponsive if corrected within 24 hours after the bid opening. In addition, the City requires the Bidder to list the dollar value of each Subcontractor’s labor or services. The City reserves the right to review and disqualify any proposed Subcontractor. The City’s disqualification of a Subcontractor does not disqualify a Bidder. In such case, prior to and as a condition to award of the Contract, the successful Bidder shall substitute a properly licensed and qualified Subcontractor— without an adjustment of the Bid Amount. At the time of the Bid Deadline and at all times during performance of the Work, each listed Subcontractor’s license must be current and active for the portion of the Work listed and shall hold all specialty certifications required for such Work. 11. Bid Forms and Security: Each Bid must be made on the Bid Forms obtainable at the Public Works Department . Each Bid shall be accompanied by a cashier’s check or certified check drawn on a solvent bank, payable to “City of Vernon,” for an amount equal to ten percent (10%) of the total maximum amount of the Bid. Alternatively, a satisfactory corporate surety Western Allied Corporation Page 147 of 221 . . Item 10 Page 147 of 221 Bid Bond for an amount equal to ten percent (10%) of the total maximum amount of the Bid may accompany the Bid. Said security shall serve as a guarantee that the successful Bidder will, within fifteen (15) calendar days after the date of the award of the contract, enter into a valid contract with the City for said Work in accordance with the Contract Documents. 12. Bid Irrevocability. Bids shall remain open and valid for ninety (90) calendar days after the Bid Deadline. 13. Substitution of Securities. Pursuant to California Public Contract Code Section 22300, substitution of securities for withheld funds is permitted in accordance therewith. 14. Prevailing Wages. This Project is a “public work” as defined in California Labor Code Section 1720. Contractor awarded this Contract, and all Subcontractors of any tier shall not pay less than the minimum prevailing rate of per diem wages for each craft, classification, or type of worker needed to perform the Work. The Director of Industrial Relations of the State of California, pursuant to the California Labor Code, and the rates determined by the California Director of Industrial Relations are available online at www.dir.ca.gov/DLSR/PWD/. 15. Payroll Records. Pursuant to SB 854, Contractor and any Subcontractors shall furnish electronic certified payroll records directly to the Labor Commissioner (aka Division of Labor Standards Enforcement). 16. Registration with the Department of Industrial Relations (DIR). No contractor or subcontractor may be listed on a bid proposal for a public works project unless currently registered and qualified (including payment of any required fee) with the DIR pursuant to Labor Code section 1725.5 [with limited exceptions from this requirement for bid purposes only under Labor Code section 1771.1(a)]. No contractor or subcontractor may be awarded a contract for public work on a public works project unless currently registered and qualified (including payment of any required fee) with the DIR pursuant to Labor Code section 1725.5. This project is subject to compliance monitoring and enforcement by the DIR. Carlos Fandino City Administrator Dated: (Approved as to form by the City Attorney’s Office) Published: Western Allied Corporation Page 148 of 221 . . Item 10 Page 148 of 221 City of Vernon Instructions for Bidders Project: CITY HALL HVAC SYSTEM IMPROVEMENT CONTRACT NO. 20240089 for the Department of Public Works City personnel with whom prospective bidders will deal with are: Kenneth Jackson, Facilities Supervisor, Public Works Department, 4305 Santa Fe Avenue, Vernon, CA 90058 (323) 583-8811 ext. 216 Bid opening date and time: 2:00 p.m., Wednesday, November 1, 2023 (“Bid Deadline”). Bids will be received and opened at the Office of the City Clerk, 4305 Santa Fe Avenue, Vernon, CA 90058. The bid must be received by the City Clerk’s Office prior to the time set for bid opening. A bid received by the City Clerk’s Office after the time set for the bid opening is a non-responsive bid and shall not be considered. GENERAL BID REQUIREMENTS To be considered, a bidder must strictly follow the format for bids in the specifications. Bids must be binding and firm. Any bids may be withdrawn before bid opening, but bids shall remain open and valid for ninety (90) calendar days after the Bid Deadline. 1.CONTRACTORS LICENSE The Bidder must possess a valid State of California Contractors License and must list type in the classification(s) specified in the Notice Inviting Bids at the time of the Bid Deadline and at all times during the performance of the Work, except as otherwise provided in California Business and Professions Code Section 7028.15. 2.INTERPRETATION OF BIDDING DOCUMENTS, SPECIFICATIONS AND ADDENDA A. If any Bidder contemplating submitting a Bid is in doubt as to the true meaning of any part of the Bidding Documents, or who finds discrepancies, errors or omissions therein or who finds variances in any of the Bidding Documents with applicable law, such Bidder shall at once submit a written request for an interpretation or correction thereof to the City’s representative identified in the Notice Inviting Bids, or other designated individual. All Bidders shall submit such written requests to City not less than ten (10) calendar days prior to the Bid Deadline. The person or entity submitting the request shall be responsible for its prompt delivery to City’s Contact Person identified in the Notice Inviting Bids. Western Allied Corporation Page 149 of 221 . . Item 10 Page 149 of 221 Any Addenda so issued must be acknowledged in the Bid and the cost of performing Work described in the Addenda shall be included in the Bid. Bidder’s failure to acknowledge receipt of all Addenda may result in rejection of the Bid as nonresponsive. No person is authorized to render an oral interpretation or correction of any Bidding Documents and no Bidder may rely on any such oral interpretation or correction issued by the City. The City shall not be responsible for any other explanation or interpretation of the Drawings or Specifications, or for any oral instructions. City reserves the right to extend the Bid Deadline by issuing an Addendum to Interested Bidders no later than 72 hours prior to the Bid Deadline. Bidders shall use complete sets of Bidding Documents in preparing Bids; City shall not assume responsibility for errors or misinterpretations resulting from the use of incomplete sets of Bidding Documents. B.Addenda will be made available for inspection at www.cityofvernon.org/planetbids. Each Bidder shall ascertain prior to submitting a Bid that the Bidder has received all Addenda issued and the Bidder shall acknowledge their receipt in the Bid. 3.OBTAINING DRAWINGS AND DOCUMENTS Bidder may secure Bidding Documents only from the location specified in the Notice Inviting Bids. City will maintain a list of persons who obtained a copy of these Specifications (“Interested Bidders”). Only Interested Bidders will receive Addenda, if so issued. 4.BID FORMS – SUBMITTAL A. The Bids shall be made on the forms provided herein with all blank spaces properly filled in. B. The phraseology shall not be changed, and no additions shall be made to the items mentioned herein. Unauthorized conditions, exemptions, limitations, or provisions attached to a Bid will render it informal and may cause its rejection. All forms requiring specific information shall be completed with all applicable information for a Bid to be considered responsive. C. Include all Bid Forms, properly executed, and intact on forms provided. Enclose the Bid Forms in a sealed envelope; type or print on the envelope "BIDS for" followed by the title and Specification Number and the date and time of the Bid Deadline, and the Bidder's name and address. The envelope may be mailed, hand delivered, or delivered by courier or package delivery service. D.One Original Bid shall be hand delivered, delivered by courier or package delivery service to the Office of the City Clerk, City of Vernon, 4305 Santa Fe Avenue, Vernon, CA 90058. E. Bids received after the Bid Deadline or at any place other than the Office of the Any interpretation or correction will be made only by Addendum issued by the City and a copy of such Addendum will be delivered to all Interested Bidders of record. Western Allied Corporation Page 150 of 221 . . Item 10 Page 150 of 221 Page 14 of 182 City Clerk will not be considered. 5.BID FORMS – AUTHORIZED SIGNATURES A. The full name, business address, zip code, and business telephone number, with area code of the individual, partnership, joint venture, or corporation submitting the Bid shall be typewritten or legibly printed on the Bid Forms. The Bidder shall sign the form with his/her usual wet ink signature. B.Sole Proprietorship: An individual shall sign. C.Partnership (General or Limited): A partner shall sign for a partnership; the partner shall give the names and addresses of all partners. D.Corporation: An officer shall sign for a corporation. The corporate name must be attested by the corporate seal. The names and titles of the president and all officers of the corporation who are authorized to sign the Bid Forms must be listed in an authenticated Incumbency Certificate signed by the corporate secretary. A signature other than a corporate officer’s will be accepted only if an authenticated Incumbency Certificate is attached. E.Joint Venture: Bidders shall use the appropriate section(s) listed above in B-D, based on their applicable situation. 6.BID FORMS – SCHEDULE OF BID PRICES A. The Bidder shall include in his/her Bid price(s) any and all expense or costs that may be necessary to complete the project in accordance with the requirements of the Contract. The cost of all mobilization, preparatory work and operations for the multiple movements of personnel, equipment, supplies, and incidentals to the various project sites must be included in the various bid items, and no extra compensation will be paid to Contractor. B. The Bidder shall state for each item on the Schedule of Bid Prices form, in clearly legible figures, the Base Bid, the alternates, and the unit price and item total or lump sum, as the case may be, for which he/she proposes to supply labor, materials, and equipment and to perform the Work. Bids must not contain any erasures, interlineations, strike-throughs or other corrections unless the same are suitably authenticated by affixing in the margin immediately opposite such erasure or correction the initials of the person(s) signing the Bid. If any Bid, or portion thereof, is determined by the City to be illegible, ambiguous or inconsistent, City may reject such a Bid as being non-responsive. C. In the case of a unit price item, the amount set forth, as the item total shall be the product of the estimated quantity times the unit price Bid. In the event of a discrepancy between the unit price Bid and the item total, the unit price shall prevail; however, if the unit price is ambiguous, unintelligible, or uncertain for Western Allied Corporation Page 151 of 221 . . Item 10 Page 151 of 221 any cause, or is omitted, or is the same amount as the entry for the item total, then the item total shall prevail and shall be divided by the estimated quantity for the item and the price thus obtained shall be the unit price. Where so indicated by the makeup of the Bid Form, sums shall be expressed in both words and figures, and in case of discrepancy between the two, the amount written in words shall govern. D. All requested Alternates, if any, shall be Bid. See the Schedule of Bid Prices for more information and the list of Bid Alternates, if any. If no change in the Base Bid is required, enter “No Change.” 7.BID SECURITY A. Each Bid shall be accompanied by cash or a cashier’s check or a certified check, drawn on a responsible bank doing business in the United States payable to the City, or a satisfactory Bid Bond in favor of the City executed by the Bidder as a principal and a California admitted surety company (as defined by California Code of Civil Procedure §§995.120 and 995.311) as surety (“Bid Security”). B. All bonds must be issued by a California admitted surety insurer with the minimum A.M Best Company Financial strength rating of “A:VII” or better. Bonds issued by a California admitted surety not listed on Treasury Circular 570 will be deemed accepted unless specifically rejected by the City. Bonds issued from admitted surety insurers not listed in Treasury Circular 570 must be accompanied by all documents enumerated in California Code of Civil Procedure Section 995.660. All such bonds must be accompanied by a power of attorney from the surety company authorizing the person executing the bond to sign on behalf of the company. If the bonds are executed outside the State of California, all copies of the bonds must be countersigned by a California representative of the surety. The signature of the person executing the bond on behalf of Surety must be acknowledged by a Notary Public as the signature of the person designated in the power of attorney. C. Bid Security shall be in an amount not less than 10% of the Base Bid. Any Bid submitted without Bid Security will be rejected as non-responsive. The Bid Security shall be given as a guarantee that the successful Bidder will execute the Contract and will provide the insurance, bonds and other required forms within fourteen (14) calendar days after award of the Contract. Bidders will be entitled to return of Bid Security except when a successful Bidder forfeits its Bid Security. A forfeit may occur, for example, if the successful Bidder withdraws its Bid prior to the expiration of ninety (90) calendar days after award of the Contract; attempts to withdraw its Bid when the requirements of Public Contract Code § 5101 et seq. are not met; or refuses or fails to execute the Contract and provide the required bonds, insurance or certificates within fourteen (14) calendar days after award of the Contract. In any one or more of these events, if City awards the Contract for the Work to the next lowest responsible Bidder, the amount of the original lowest Bidder’s security shall be applied to the Contract Price differential between the lowest Bid and the second lowest Bid. Any surplus will be returned to the original Western Allied Corporation Page 152 of 221 . . Item 10 Page 152 of 221 lowest Bidder. If the City rejects all other Bids presented and re-advertises, the lowest Bidder’s Bid Security may be used to offset the City’s cost of re-advertising and receiving new Bids. In that case, the surplus if any, will be returned to the original lowest Bidder. D. The Bid Security shall be held for ninety (90) calendar days after the award of the Contract or until posting by the successful Bidder of the payment and performance bonds, proof of insurance, return of executed copies of the Contract and necessary certification(s), whichever first occurs, after which time the Bid Security will be returned to all Bidders. E. If a Bid Bond is to be submitted, Bidder shall use the form entitled "Bid Bond" contained in the Bidding Documents, which Bid Bond shall be properly executed and acknowledged by the Bidder and by a corporate surety authorized to transact such business in the State of California. F. Any alteration of said form of Bid Bond, or imperfection in the execution thereof, as herein required, will render it informal and may, at the option of the City, result in the rejection of the Bid under which the Bid Bond is submitted. 8.BIDDER'S AND SPECIALTY CONTRACTORS’ STATEMENTS OF QUALIFICATIONS A. Each Bidder shall be required to complete, execute and submit with its Bid, the form entitled "Bidder's Statement of Qualifications." In addition, if the Bidder intends to design and build retrofit portion of existing HVAC Work, Bidder shall satisfy the mandatory qualifications described in the Specialty Contractors’ Statements of Qualifications applicable to such Work and submit the completed forms with the Bid. Subcontractors listed for the design and build retrofit portion of existing HVAC Work must satisfy the mandatory qualifications described in the Specialty Contractor or Subcontractor Statement of Qualifications applicable to the Work to be performed by each Subcontractor,1 and Bidder must submit the completed forms with the Bid. Notwithstanding the provisions of Paragraph 22 herein, the Bidder’s Statement of Qualifications and the Specialty Contractor or Subcontractor Statement of Qualifications shall not be public records. All information required by a Bidder’s or Specialty Contractor Statement of Qualifications shall be completely and fully provided. If no information is to be filled in a blank space, then write "none." Any Bid not accompanied by a Bidder’s Statement of Qualifications and Specialty Contractor or Subcontractor Statement of Qualifications form completed with all information required may render the Bid non-responsive. If the City determines that any information provided by a Bidder in the Bidder’s or Specialty Contractors’ Statement of Qualifications is false or misleading, or is incomplete so as to be false or misleading, the City may reject the Bid submitted by such Bidder as being non-responsive. Western Allied Corporation Page 153 of 221 . . Item 10 Page 153 of 221 B. A responsible Bidder is a Bidder who has demonstrated the attribute of trustworthiness, as well as quality, fitness, capacity and experience to satisfactorily perform fully the requirements of the contract documents. In selecting the lowest responsible Bidder, consideration will be given not only to the Bidder’s financial standing but also to the general competency of the Bidder for the performance of the work covered by the Bid including, but not limited to, the experience of the Bidder in construction of public buildings for public agencies. By submitting a Bid, each Bidder agrees that the City, in determining the successful Bidder and its eligibility for the award, may consider the Bidder’s experience with similar types of construction projects and facilities, conduct and performance under other contracts, financial condition, reputation in the industry, and other factors which could affect the Bidder’s performance of the work. 9.DESIGNATION OF SUBCONTRACTORS A. Subcontractor Listing. On the Designation of Subcontractors form, the Bidder shall list each Subcontractor whom the Bidder must disclose under the Subletting and Subcontracting Fair Practice Act, Public Contract Code Section 4104. The Bidder shall provide: each Subcontractor’s name, the trade and type of work that the Subcontractor will perform, the location (address) of the Subcontractor’s place of business, each Subcontractor’s license number, each Subcontractor’s public works contractor registration number, and the dollar value of each Subcontractor’s labor or services. If additive Alternate Bid Items are included in the Bidding Documents, the Bidder shall identify each Subcontractor performing additive Alternate Bid Items, when such Work or the combination of base Contract Work and Alternate Work exceeds one-half of one percent of the total Bid Amount. B. Subcontractors’ Licenses. At the time of the Bid Deadline and at all times during performance of the Work, each listed Subcontractor shall possess a current and active California Contractor’s license appropriate for the portion of the Work listed for such Subcontractor and hold all specialty certifications required for such Work. C. Disqualification of a Subcontractor. The City has the right to review the suitability and qualifications of any Subcontractor proposed by the Bidder. As part of this review, the City may request a Bidder to submit additional information about one or more of the listed Subcontractors including, but not limited to a statement detailing the Subcontractor’s experience with pertinent information as to similar projects and other evidence of the Subcontractor’s qualifications. If requested, the Bidder shall provide the information to the City within the time specified in the City’s written request. After due investigation, if the City has a reasonable objection to any proposed Subcontractor, the City may, before giving the notice of award, require the apparent successful Bidder to submit an acceptable substitute. The City’s disqualification of a Subcontractor does not disqualify a Bidder. However, prior to and as a condition to award of the Contract, the successful Bidder shall substitute a properly licensed and qualified Subcontractor without an adjustment of the Bid Price. Western Allied Corporation Page 154 of 221 . . Item 10 Page 154 of 221 D. Work of Subcontractors. The organization or arrangement of the Specifications and Drawings do not limit the extent of the Work for the Contract Documents. Accordingly, all Bidders are encouraged to disseminate all of the Specifications, Drawings and other Contract Documents to all persons or entities submitting sub- bids to the Bidder. The omission of any portion or item of Work from the Bid or from sub-bids, which is reasonably inferable from the Contract Documents, will not be a basis for adjustment of the Contract Price or the Contract Time. E. Ineligible Subcontractors. The successful Bidder is prohibited from performing Work on the Project with any Subcontractor who is ineligible to perform work on a public works project pursuant to California Labor Code Sections 1777.1 or 1777.7. In submitting its Bid, the Bidder certifies that it has investigated the eligibility of each and every listed Subcontractor and has determined that none is ineligible to perform work pursuant to the above code provisions. 10.CONTRACTOR’S AFFIDAVIT OF NON-COLLUSION An Affidavit of Non-Collusion in the form provided by the City shall be signed under penalty of perjury, certifying that the Bid is not the result of and has not been influenced by collusion. Bidder shall submit this form with its Bid. Any Bid made without such affidavit, or believed to be made in violation of the requirements set forth in the affidavit form, may be rejected. 11.INSURANCE REQUIREMENTS The Bidder shall submit to its insurance company or insurance agent the Insurance Requirements in this Specification and the Contract Documents. The insurance company’s underwriter or agent must complete the Insurance Requirements documentation which states that the insurer’s underwriter or agent will furnish the City with the required insurance documents within fourteen (14) days after the Bidder’s having been notified of the Contract’s award. The Bidder shall submit this form with its Bid. Any Bid made without this statement, or made with an incomplete statement, may be rejected. 12.EXAMINATION OF DRAWINGS, SPECIFICATIONS, AND SITE OF WORK A. The Bidder shall examine carefully the site of the Work contemplated and the Drawings and Specifications. The submission of a Bid will be conclusive evidence that the Bidder has investigated and is satisfied as to the conditions to be encountered, as to the character, quality, and quantities of Work to be performed and materials to be furnished, the difficulties to be encountered, and to the requirements of the Drawings, Specifications, and other Contract Documents. The Bidder shall ascertain the locations of the existing utility services, and other underground facilities, and provide for carrying out its operations so as to cause the minimum possible inconvenience to the occupants of properties along any streets affected. All Work and costs involved in the safeguarding of the properties of others shall be at the expense of the Bidder to whom the Contract may be awarded. Western Allied Corporation Page 155 of 221 . . Item 10 Page 155 of 221 B. The Bidder hereby certifies that it has examined the local conditions, has read each and every clause of the Contract Documents, and that it has included all costs necessary to complete the specified Work in its Bid prices, and the Bidder agrees that if it is awarded the Contract, it will make no claim against the City based upon ignorance of local conditions or misunderstanding of any of the provisions of the Contract. Should the conditions turn out otherwise than the Bidder anticipated, the Bidder agrees to assume all risks incident thereto. 13.PRICES AND PAYMENTS Approximate quantities listed in the Schedule of Bid Prices are estimates given for comparing Bids, and no claim shall be made against the City for excess or deficiency therein, actual or relative. Payment at the prices agreed upon will be in full for the completed Work and will cover materials, supplies, labor, tools, equipment, and all other expenditures incident to a satisfactory compliance with the Contract, subject to all applicable provisions in the Contract and General Conditions. 14.PERMIT FEES If provided in the General Conditions, Contractor shall be reimbursed for the actual direct cost of all Permit Fees, as defined in Paragraph 1.01 and addressed in 1.03 of the General Conditions. Bidder shall exclude the cost of Permit Fees from Bidder’s Base Bid sum; Base Bid sum shall include the cost of administration and coordination for all Governmental Approvals and Utility Fees. 15.SUBSTITUTIONS No requests for substitution of any material, device, product, equipment, fixture, form, or type of construction shall be considered by City prior to award of the Contract. Bidders shall submit all requests for substitution and substantiating data, within fourteen (14) calendar days from the date of the Notice to Proceed. Bidder shall refer to the appropriate provisions of the General Conditions for additional information regarding substitutions. Authorization of a substitution is solely within the discretion of the City. 16.RETURN OF IMPROPER BIDS Bids submitted after the Bid Deadline are non-responsive and shall be returned to the Bidder unopened. Oral, telephonic, telegraphic, facsimile or electronically transmitted Western Allied Corporation Page 156 of 221 . . Item 10 Page 156 of 221 Bids shall not be considered unless the Notice Inviting Bids expressly permits such means of transmittal. 17.WITHDRAWAL OF BIDS Bidder may withdraw its Bid either personally or by written request any time prior to the scheduled Bid Deadline by notice to the City’s Contact Person designated in the Notice Inviting Bids. If such notice is written, it shall be signed by the Bidder and shall be date- stamped and time-stamped by the City upon receipt. Withdrawn Bids may be resubmitted before the Bid Deadline provided that they are in full conformance with these Instructions to Bidders. Once submitted, all Bids are irrevocable, except as otherwise provided by law. Requests for withdrawal of Bids after the Bid Deadline shall be made only in accordance with California Public Contract Code § 5100, et seq. Bidder agrees by submitting a Bid that such Bid shall remain open, is irrevocable, and may not be modified, withdrawn, or cancelled for a period of ninety (90) days after award of the Contract. 18.OPENING AND EVALUATION OF BIDS A.Bid Opening and Tabulation. The Bids shall be opened and read in public after the Bid Deadline has expired at the time and location listed in the Notice Inviting Bids. A tabulation of all Bids received will be available for public inspection at the Office of the Public Works Department, 4305 Santa Fe Avenue, Vernon, CA 90058 during regular business hours for a period of not less than thirty (30) calendar days following the Bid Deadline. The City reserves the right to accept or reject any or all Bids and be the sole judge regarding the suitability of the products, services or supplies offered; and/or to waive any irregularities or informalities in any Bids or in the bidding process. The City further reserves the right to purchase all or fewer than all items or quantities of each item listed in the Bidding Documents. The award of the Contract, if made by the City, shall be to the lowest responsive and responsible Bidder. If Bid Alternate Items are called for, the lowest Bid shall be determined according to Paragraph 20 below. B.Evaluation of Bids. 1.Mandatory Qualifications. A Bid shall be rejected as non- responsive if the Bidder fails to document in the Bid that Bidder meets the essential requirements for qualification described in the Notice Inviting Bids. As part of the Bidder’s Statement of Qualifications each Bidder must establish that it, as the current entity: (1) has successfully completed at least three (3) similar projects involving similar work within the last (10) years with a cost equal to or in excess of the Bidder’s Bid; and (2) has successfully completed at least three (3) public works projects. The City’s disqualification of a Subcontractor listed for design and build retrofit of a portion of their existing HVAC controls at City Hall. 2.Work does not disqualify a Bidder. However, prior to and as a condition to award of the Contract, the successful Bidder shall substitute a properly licensed Western Allied Corporation Page 157 of 221 . . Item 10 Page 157 of 221 and qualified Subcontractor without an adjustment of the Bid Price. 3. Responsive Bid. A responsive Bid is a Bid which conforms, in all material respects, to the Bidding Requirements and Contract Documents. 4. Responsible Bidder. A responsible Bidder is a Bidder who has demonstrated the attribute of trustworthiness, as well as quality, fitness, capacity and experience to satisfactorily perform fully the requirements of the Contract Documents. 5. Competency of Bidders. In selecting the lowest responsible Bidder, consideration will be given not only to the financial standing but also to the general competency of the Bidder for the performance of the Work covered by the Bid including, but not limited to, the experience of the Bidder in construction of public works for public agencies. By submitting a Bid, each Bidder agrees that the City, in determining the successful Bidder and its eligibility for the award, may consider the Bidder’s experience with similar types of construction projects and facilities, conduct and performance under other contracts, financial condition, reputation in the industry, safety record and protocols and other factors which could affect the Bidder’s performance of the Work. 19.AWARD OF CONTRACT The City reserves the right to reject any or all Bids and to waive any or all information or technical defects, as the interest of the City may require. Award of Contract or rejection of Bids will be made by the City within ninety (90) calendar days following the Bid Opening. 20.BASIS OF AWARD A. A Contract will be awarded to the lowest responsive and responsible Bidder meeting all requirements set forth in these Bidding Documents. The City will award the Contract based on the lowest Base Bid without consideration of the prices on the additive or deductive items. B. City reserves the right in its sole discretion to select any, all, or none of the Bid Alternates at the time of award of the Contract, regardless of whether such Bid Alternates were used in the analysis to determine the lowest Bid. 21.EXECUTION OF CONTRACT Within fourteen (14) calendar days after being notified by City that it has been awarded the Contract, Contractor shall deliver to the City the following documents: Western Allied Corporation Page 158 of 221 . . Item 10 Page 158 of 221 A. One executed Contract in the form included herein, properly executed by Contractor and, if Contractor is a corporation, evidence of its corporate existence and that the persons signing the Contract are authorized to do so. All signatures must be notarized. B. Properly executed copies of the (a) Performance Bond, (b) Labor and Material (Payment) Bond and (c) Maintenance Bond in accordance with the requirements set forth in Article 13 of the General Conditions and in the form shown on Exhibits 1, 2 and 3 attached thereto. All signatures must be notarized. C. Properly executed policies of all of the following: (a) the Commercial General Liability Insurance, (b) the Automotive Liability Insurance, and (c) Professional Liability, if required, and (e) the corresponding endorsements for each policy in accordance with the requirements set forth in Article 12 of the General Conditions. In the event that the fourteenth calendar day falls on Saturday, Sunday, a legal holiday for the State of California, or on days when City Hall is closed, the aforesaid documents shall be delivered by the following working day. After receipt of said documents within said time period or any extension thereof granted by the City, the City shall execute the Contract and return a fully executed copy to Contractor for its files. 22.PUBLIC RECORDS City seeks to conduct its business openly. Except as set forth in paragraph 8.A., upon Western Allied Corporation Page 159 of 221 . . Item 10 Page 159 of 221 opening, all Bids shall become a matter of public record and shall be regarded as public, with the exception of those elements of each Bid that are identified by the Bidder and plainly marked as “trade secret,” “confidential,” or “proprietary,” including any Statement of Qualifications and financial statements to be submitted by Bidders. Each element of a Bid which a Bidder desires not to be considered a public record must be clearly marked as set forth above, and any blanket statement (i.e. regarding entire pages, documents, or other, non-specific designations) shall not be sufficient and shall not bind the City in any way whatsoever. If City receives a request from a third party to make a Bid available for inspection and copying, the City will notify the Bidder of the request. If a Bidder instructs the City that the information is not to be released, City will withhold the information, provided, the Bidder expeditiously seeks a protective order from a court of competent jurisdiction to prevent such release. If disclosure is required under the California Public Records Act or otherwise by law (despite the Bidder’s request for confidentiality), the City shall not in any way be liable or responsible for the disclosure of any such records or part thereof. Bidder shall indemnify, defend (including Bidder’s providing and paying for legal counsel for City), and hold harmless City, its officers, agents, employees, and representatives from and against all liability, claims, suits, demands, damages, fines, penalties, costs, or expenses arising out of or alleging City’s refusal to publicly disclose one or more records that Bidder identifies as protectable, or asserts is protectable. 23.PREVAILING WAGE RATES AND EMPLOYMENT OF APPRENTICES A. Prevailing Wage Rates. The Bidder and all Subcontractors shall utilize the relevant prevailing wage rate determinations in effect on the first advertisement date of the Notice Calling for Bids in preparing the Bid Proposal and all component price quotations, provided, however, that when Davis Bacon wage rates apply, such rates are subject to increase by written notice, issued by Addendum not less than 10 calendar days before the Bid Deadline. Pursuant to California Labor Code Section 1770 et seq., the Director of the Department of Industrial Relations of the State of California and the United States Secretary of Labor have determined the general prevailing wage rates in the locality in which the Work is to be performed. Said rate schedules are available from the City at its Public Works Department, which shall be made available to any interested party upon request; or on the Internet at www.dir.ca.gov/DLSR/PWD/. The wage rate for any classification not listed, but which may be required to execute the Work, shall be commensurate and in accord with specified rates for similar or comparable classifications for those performing similar or comparable duties. To comply with California Labor Code Section 1773.2, Contractor shall post, at appropriate and conspicuous locations on the job site, a schedule showing all applicable prevailing wage rates and shall also comply with the requirements of California Labor Code Sections 1773 et seq. B. Apprenticeship Committee Contract Award Information. Pursuant to California Labor Code § 1777.5 and Title 8 of the California Code of Regulations § 230, Western Allied Corporation Page 160 of 221 . . Item 10 Page 160 of 221 Contractor and Subcontractors of any tier who are not already approved to train by an apprenticeship program sponsor shall, within ten (10) calendar days of signing C. the Contract or subcontract, as applicable, but in any event prior to the first day in which Contractor or Subcontractor has workers employed on the Project, submit the Public Works Contract Award Information form (DAS Form 140) to the appropriate local apprenticeship committees whose geographic area of operation include the area of the Project and who can supply apprentices to the Project. City reserves the right to require Contractors and Subcontractors to submit a copy of said forms to the City. D. Statement of Employer Fringe Benefit Payments. Within five (5) calendar days of signing the Contract or subcontract, as applicable, the Statement of Employer Payments (DLSE Form PW 26) shall be completed for each Contractor and Subcontractor of any tier who pays benefits to a third party trust, plan or fund for health and welfare benefits, vacation funds or makes pension contributions. The form must contain, for each worker classification, the fund, plan or trust name, address, administrator, the amount per hour contributed and the frequency of contributions. Training fund contributions shall also be reported in this form. City reserves the right to require Contractors and Subcontractors to submit a copy of said forms to the City. E. Notice to Subcontractors. Bidders shall notify all potential Subcontractors submitting price quotations for portions of the Work of the requirements concerning payment of prevailing wage rates, payroll records, hours of Work, and employment of apprentices. 24.REGISTRATION WITH THE DEPARTMENT OF INDUSTRIAL RELATIONS (DIR) No contractor or subcontractor may be listed on a bid proposal for a public works project unless currently registered and qualified (including payment of any required fee) with the DIR pursuant to Labor Code section 1725.5 [with limited exceptions from this requirement for bid purposes only under Labor Code section 1771.1(a)]. No contractor or subcontractor may be awarded a contract for public work on a public works project unless currently registered and qualified (including payment of any required fee) with the DIR pursuant to Labor Code section 1725.5. This project is subject to compliance monitoring and enforcement by the DIR. 25.SPECIAL CITY REQUIREMENTS Special City forms and their instructions are an integral part of these specifications and failure to submit same may be grounds, in the sole discretion of the City, for rejection of any Bidder. A.Prevailing Wage Where Applicable. Upon request, certified payroll documents shall be provided to the City. Western Allied Corporation Page 161 of 221 . . Item 10 Page 161 of 221 B. Equal Employment Opportunity in Contracting. The City of Vernon is committed to a policy of equal opportunity in contracting. Qualified firms including small businesses and businesses owned by women, minorities, and disabled persons are encouraged to submit bids or proposals. Contractors expressly agree to comply with the City's ordinances and regulations regarding Equal Opportunity Employment as well as regulations that may be mandated by the source of the funds supporting the Contract. Contractor certifies and represents that during the performance of this Contract, it and any other parties with whom it may subcontract shall adhere to equal employment opportunity practices to assure that applicants, employees and recipients of service are treated equally and are not discriminated against because of their age not discriminated against because of their race, religion, religious belief, color, national origin, citizenship, ancestry, disability, sex, age, medical condition, pregnancy, sexual orientation or marital status. Contractor certifies that it will not maintain any segregated facilities. Contractor shall comply with all applicable Federal and California laws including, but not limited to, the California Fair Employment and Housing Act (California Government Code Section 12900, et seq.), California Labor Code Section 1735, and The Americans with Disabilities Act of 1990 (42 U.S.C. 12101 et seq.). Contractor shall require like compliance by all Subcontractors employed on the Work. 26.BID PROTEST PROCEDURES A. Any Bidder submitting a Bid directly to the City and eligible for award of the Contract may file a protest if the Bidder complies with all of the following requirements and conditions: 1. The Bid protest is in writing; 2. A protest based upon alleged defects or improprieties in the Contract Documents is filed with the City prior to the Bid Deadline; 3. All other protests are to be filed and received by the City no more than five (5) calendar days following the City’s notice of intent to award the Contract; and 4. The written Bid protest sets forth, in detail, all grounds for the Bid protest, including without limitation: all facts, supporting documentation, legal authorities, and argument in support of the grounds for the Bid protest. All factual contentions must be supported by competent, admissible, and credible evidence. B. Any matters not set forth in the written Bid protest will be deemed waived. Any Bid protest not conforming to the foregoing requirements and conditions will be rejected by the City as invalid. Western Allied Corporation Page 162 of 221 . . Item 10 Page 162 of 221 C. Bid Dispute Indemnification. In the event of a Bid dispute based upon the Bidder’s submission of this Bid and the City acceptance of same, the Bidder shall indemnify, defend (with counsel acceptable to City), and hold harmless the City, its City Council members, employees, and agents from liability, claims, demands, damages, and costs arising therefrom if such dispute or action arises solely upon the award of a Contract in compliance with federal, state, and local laws. [END OF DOCUMENT] Western Allied Corporation Page 163 of 221 . . Item 10 Page 163 of 221 7OE mCEzRNnEC ?kROS RCTmzEwqmEqOE1q_@E)mUSmN RCU EC?PE!Rq@qnz @PE;qzdqG OEHqheqSnN3zqbE@Sn=@@qzC=m@ESOOE!qmz=@#qA kEn 352-%!7 !*7<' . (: "6<67%/)0352:%/%176!2175 !81q %nBiqECPEzESP=mC?PUzEGEzEm@ESm@q{wqz=ECPEzESm=nDl=DE=w=~qGOU VDCEz VD=zEQE GuheqSmN@qkweEECLtzk UCCEz3zqwq=f 6@PEC eEqG TC3zU@E *n@ k?En@!EzRKa@=E UC6E@ zRRnOEMqefqUmNGqzkroF "=WEz"OE@d"EzRGXEC!PE@d SCCEz6=EkEmqG4 =eUJR@=Rqm %wEzREnAE&v}k 6=EkEnqG:Sqe=YqmqG&ECEz=e6=Eqz.q@=f 6wE@R=f!qnz=@qz6=EkEpqG4 =[GS@=`qn "qmz=@qz6=GE4 ETqnn=UzE $ETNn=RqnqG6 ?@qnz=Aqz !qmz=@qz HIUC=UqG1qn "qee Rqm *n z=m@E5Ey RzEkEm HJRC=U 6=EkEnqG$Uy =e\HR@=Sqnq|#E?=zkEn 3zE RC6SE)nwE@Uqm!EzSGU@=Uqn , TC qnC !=P = RG=wxgZ@=?fE @dmqhECNkEnqG CCEnC=9OE RDCEzP=ef=@dmqeECNEPEzE@ESwqG=ff CCEnC=?==@OUnN=SNnEC @qwqG=ee CCEnC= =mC?fSRnN=je CCEnC=zE@EUEC=mC==@PEDRmOEw=@E?Eeq +G=m CDEnC kqz CCEpC=O=E?EEn] EC?PE!^=nCnq==@PEC=nCnqEC=?sE>?ESnNzE@EREC ?PE UCCEz PE SCk=?EzEcE@EC Western Allied Corporation Page 164 of 221 . . Item 10 Page 164 of 221 :I@ J)?:R? RJ% R?B0R:R?:JCJR?K7 :JIR ) CR EJ* * IRJ%JR*JR%IRC K25QR P8): R:R)IR K12Q 8)2*DRO)J%R21R? RJ% R@D?N)+?:IR? RJ% R**:$R?L8 :JIR:RI) R)):$R?M8 :JIR?:J*:RIK "** :J J)3RC $C):$RJ% R?C0RJ?R R@ H?D9 RJ%JR)JR%IR:?J* ) R)JQR? R:QR CC?CIR?CR?8)II)?:IR*:RJ% R));$ ?K8 :JIR: ?CR:QRK:KIK2RI)J R?:*J.?:IR:R J%JR*JR%IRD L12QR% 0 R12RO?CIR@C* IR: IJJ 8 :JIR*:RJ%)IR)*:$R?K8 :JR * DR% C QR CJ* * IRJ%JR& I% R:R%)I % DR L?:JCJ?CIR%N ):I@ J RJ% RI)J R:RC 2J RCO):$IR:R@ /R J)?:IR? R?C0R:R K12QRAL):J RJ% 8I 4N IRO)J%R12 ?:)J*?:IR:R8JJ DIRO'*%R8QR):R:QROQR ! JRJ% R?D0RJ)8 R? R?8@1 J*?<R?CRJ% R?IJIRJ% C ? * CR1I?R CJ,# IR% I% R(IR?I CN RJ% R I*$:J R?<JEJ?CR?F0RD IR:R IIRC?KJ IR* )I6?I R?DRI%?O=RIR@CJR? RJ% R?G0R->RJ%*IR?:JCJ Western Allied Corporation Page 165 of 221 . . Item 10 Page 165 of 221 AB2.91¦C:D2¦:<CA3/D:><¦/2BD:4:/-E;?='¦ @Qw¦Y¦]xQKQO¦]Q¦S¦YQ¦QO¦Hh¦S¦ ¦Wq(¦ <IrQ) D]iQ*¦ <IqQ*¦ D^jQ+¦ 1IQ¦S¦:¦QK^w¦ %!"# 1IQ¦T¦xQK]w¦ % !"# 1 .]OOQ¦IXQQ¦YI¦Iij¦K¦S¦Hh¦Yx¦]x¦YQ¦.^OO]xX¦1KqQw¦]xKiO]xX¦h¦QIxIJj ¦]wUQIJjQ YQQSq¦IxO¦xQKQI ¦YQQ¦IQ¦^xKjOQO¦]x¦Y^YQ¦.]O¦-jj¦Hh¦Yy¦]x¦YQ¦0wIL¦1KqQx¦S¦Y]KY¦I QK^S^K¦j^xQ¦^Qq¦^¦x¦]OQO¦]x¦YQ¦.]OO^wX¦4q¦^¦^xKjOQO¦^x¦YQ¦._OOQ¦DIi¦.IQ¦.^O¦A^KQ /wIK¦YIjj¦JQ¦Q]qJQO¦S¦YQ¦IKIj¦O^QK¦K¦T¦Iii¦@Qq^¦4QQ ¦^S¦Ix ¦I¦OQS^xQO¦]x¦AIIXIY¦ ¦IxO IOOQQO¦^x¦@IIXIY¦ $¦T¦YQ¦8QxQIi¦0¦O]]x¦.]OOQ¦YIlj¦QKjOQ¦YQ¦K¦S¦AQq^¦5QQ¦Sq¦.^OOQ .IQ¦.`O¦q,¦.IQ¦.^O¦s¦ZIim¦axNnOQ¦YQ¦K¦T¦IOq]z^I^x¦IwO¦KP^xIex¦S¦8QwtQ{Ij¦-Ij¦IwO F^j] ¦6QQ¦.]OOQ¦IXQQ¦YI¦0^ ¦^jo¦x¦JQ¦Q x^JjQ¦V¦Iw ¦Q¦¦q^]x¦x¦YQ¦I¦T¦YQ¦wOQ^XwQO bw¦qIh^xX¦Y^¦.]O 2 4Q^Q¦T¦.^O¦CQK] ¦ .]OOQ¦TYQ¦IXQQ¦YI¦^w¦KIQ¦S¦Y]YQ¦OQSIj¦]x¦QQK^xX¦YQ¦Q^QO /wIK¦IxO¦YQ¦Q]QO¦JwO ¦¦Sw^Y]wX¦YQ¦Q]QO¦a|IwKQ¦YQ¦qxQ ¦I IJiQ¦xOQ¦YQ¦.]O¦CQK^ IKKqIw ^wX¦Y^¦.]O¦YIjj¦JQ¦Ii^QO¦J ¦YQ¦0]£¦IO¦I uQx¦T¦YQ¦OIqIXQ¦¦YQ¦0] ¦w¦IKKw¦T¦KY OQSIj ¦I¦]OQO¦^w¦YQ¦.^OO]¦X¦1KqQx 7ARcO¦S¦jQKIJ^pa ¦.^OOQ¦IXQQ¦YI¦Y^¦.]O¦YIjj¦QqI]x¦Q¦IxO¦YIij¦x¦JQ¦^YOI}¦S¦I¦Q]O T¦~¦jQ¦[Ix¦x^zQ ¦&¦KIkQxOI¦OI ¦Sq¦YQ¦OIQ¦S¦IIO¦T¦0xIM¦¦wfj¦QgQKQO¦J ¦YQ¦0^ ¦Y^KYQQ Q]O¦^¦YQ 9 1+439 ('( 3 *(9 (9 3 95(39*99 9 1,439194+*(93 9 -19 14' 11!*(9* 3 19!9 (93 9 379,3(9*9 1'93 9 .9 1 $$9 (') 9(96 3 9*4(1$9,3$93* "379 (9 *%9 .'$129 3 9 "389 !319 "389 *4(!$9''.19',$*719(9(319 0*'9 $ #$ 389 $!'1 '(19'19 (9*1319/ 1 (93 ..*'9 914 9 1,439*.9 3 *(9. 1191*&%794+*(93 96.9* 9 *(3.39 (9*',$ (96 3 9.$9 1339(9 $*%9$61 DYQ¦.^OOQ¦OQKjIQ¦YI¦wQ^YQ¦YQYQ¦x¦Iw¡¦qQqJQ¦T¦Y]\Q¦S^v¦¦KI^x¦]¦Ix¦SV^KQ¦¦Qqj¢QQ¦S¦YQ¦ /d¤¦S¦GQz¦ :¦YQQJ ¦KQ]T ¦xOQ¦QxIj ¦S¦Qg ¦xOQ¦YQ¦jI¦T¦YQ¦CIQ¦T¦0Ij^T~^I¦YI¦YQ¦QQQwI^x¦qIOQ¦YQQ^x¦ IQ¦Q¦IwO¦KQK¦ 2QKQO¦Y^¦¥¦OI ¦S¦ I¦ /^ ¦ CIQ¦ Western Allied Corporation Page 166 of 221 . . Item 10 Page 166 of 221 !GBBCUX_1URSRX?I_ 2CXSCAYDZJJ]_3Z@NGYYCB_ "0-1 .:_/ -%_ ##2$33_ . -$_0&_!(##$2_ *+(!0 0$&%$'+$!0 _ $&"0- !+00 %("*00 _ "0/4 "5_1%230/_ 0 (0 6%+%1'0.%_/7-!%2 _ %- (* (.*$ $ 0 " +(&02/) _35 5$_"0/42 "4023_,)"$.3%_/8-!%2_; <<<<_====_> $91)2 5(0._# 4%_ _ 5 9_(#$.4)&)" 5)0/_/0 _ _ 372%5:_"0-1 .: _0 "$-)0 #*,&"0$ %#/0 MJ_!GB_DRUNX_NZXY_@C_XGEPCB_\FCUC_XR_HPBGA?YCB_@]_YFC_SCVXRP_RU_SCUXRPX_BZK]_?ZYFRUG^CB_YR_XGEP_RP_@CF?LD_RD_YFC_ !GBBCU_!]_XGEQHPE_YFC_!GB_YFC_SCUXRP_XGEPGPE_GX_BCCNCB_YR_UCSUCXCPY_YF?Y_FC_RV_XFC_F?X_?ZYFRUGY]_YR_@HPB_YFC_!GBBCW _ &?GJZUC_YR_XGEP_YFC_!GBBCVX_1VRTRX?J_O?]_GP[?JGB?YC_YFC_!GB_ Western Allied Corporation Page 167 of 221 . . Item 10 Page 167 of 221 $%u#$"#"% % !&'$% u dgYudDu]lKlrudEuLAACg u #UC<kCu?JC?SulJCu<ffgdfhM<lCukKI]<lniCu=Vd?Tu=CUdpu<]u DLUUuL]uOuiCU<lCAuL]EdgZ<lKd]u%dVCu#gdfgLCldgkJKf !<ZCu, -----,.////u0 &LlUCu,111111222221 %LI^<lniCu------,,,,,u3 Kklu<UWuA = <k #<im]CgkJKfC]Cg<Uu#<gl]Cgu KYKlCAu#<im]Cg !<ZCu////////,,,,u4u &LlUC u,,,-------,5u6u %LI]<lngCu///////////u7u dgfdg<lLd]u !<ZCu %LI]<lngCu dgfdg<lCu"HL?Ciu KlWCu dL]lu(C]lniCdgfdg<lKd]u ^ALoKAn<W #<il]CikJKf "lJCiu !<YCu8-----------u9u &LlWCu////////////u0u %LI^<lniCu,-------,,,u3u difdi<lCu%C<Uu !<ZCudEu<WUu dK]lu)C]lngCgk u,,:////////////////////u;u * DulJCuKAACguKku<u?dgfdi<lLd_udgu<uWLZLlCAu UK<=KULlsu?d[f<]ruC]lCiukl<lCudiu?dn]lsudDuK]?dgfdi<lKd]uK`u<AALlNd]uldulJCu =nkL]Ckku<AAgCkku<]AuKa?UnBCu<buL]?nZ=C]?ru?CilLGL?<lCuCqC?nlCAu=ru<u%C?iCl<gtulJCgCdDuK]ulJCuDei\ukCluDdglJuJCgCLu UKklK]IuC<?u dHK?CgupKlu kLI]K]Iu<nlJdiNlru<]AuJKk JCgu?dggCkfd]AK]IudEFL?Cu DulJCuLAACguKku<uf<gl]CikJKfudiuRLcluoC]lniCiu kl<lK]IulJ<lulJCugCkfC@lLoCuf<gm]CiudiuPdK]luoC]lniCgu<IiCCkuldu=Cu CWAuQdL]lWru<]AukCoCg<XUruUK<=UCuDdgu<cru<]Au<UUudEulJCu AnlKCku<]Aud>WKI<lLd]kudEulJCuKAACiun]ACgulJCuKAu<]Aun]ACju<]ru?d]li<?lu<iKkK]IulJCiCDidY ulm<?JuCoKAC]?CuldulJCu KAu#jdfdk<WudgZulJ<lulJCuK]uKoLAn<UukLI]L]IuJ<ku<nlJdiKlsulduAdukd +u Western Allied Corporation Page 168 of 221 . . Item 10 Page 168 of 221 JLI?3/N(º/:O[º8,@º8X,/ºM[MN3Bº;BJLIX3B3COMº/ICOL,/OºCº# #% &'º .:003LMºD,B3)º .,M4º.<0º J¤\¦º§º\fºwºaw\ajº±w§uº´ºE¦xajº:¯w§wtº.xf¤º\fº/¦\a§º0aj§¤ºj\§wtº§º§ujºJja¦ºwefxtº \º,ffjf\º\¦¦\auº¤xtjfºawj¤ º.wffj ºu\¯xtº`jajº¦utu´ºn\wx\º±w¦uº¦ujº¦j¤º\fºafx¦x¤ºnº¦ujº /§\a§º0aj§¤º\fº±w§uºa\ºafw§w¤º\onja¦wtº¦ujºjo\ajº\fº§ujºa¤§¤ºoº§ujºYº\¦º¦ujº\ajº±ujjº §ujºYºx¤º¦º`jºfj ºujj`´ºº ¤j¤º\fº\tjj¤º§ºp´ºj£º§ujºYº±w§uyº§ujº§wjº¤§\¦jfºwº¤¦xa§º\aaf\ajº ±w§uº§ujº/¦]b§º0aj§¤ºwafxtº¦ujºnw¤uxtºoº\´º\fº\º\` º\¦jw\¤º¦¤ºj³jf\`jºjxj§ º \fº§wx¦´º\º¦\¤¢§\¦xº¤j¯xaj¤ºjaj¤¤\¢´º¦ºo ´ºj¢sº¦ujºYº\fºaj§jºx¦ºwº\º±\xjº\j º nº§ujº§§\º.\¤jº.wfº¤ºo*º 0\¤ºº =¨kºFº1k¥cz©{ºUz¨¥ºK®^¨©´º-©º "/|§µº8\º8X,/ºM¶¤§j :¯jj¦¤ºjºMjawnxa\¦w .>0ºOIP,Aº YL>QT4Gº,BIVCQº º5º9gjgºR²jª´ºHzlºRv¤_gºS²º9g jgº5 ª´º5x°jº_gº ! º2_ ¤º ,º¦ujº±º}§j¤ º\`º\¦jx\¤º¦¤º\fºwaxfj§\¤º±uwauº\jº§º¤jaxnwa\´ºw¤¦jfºwº¦ujº\`¯jº`whºw§j¤º`§º \jºjaj¤¤\´º¦ºaj¦jº¦ujºja§ºjº¤jawqwa\§x¤ º\fº\º¦ujº\xa\`jº¤«\f\f¤º\iºafj¤º\jºa¤wfjjfº §º`jºxahjfºwº§ujº\`¯jº`wfºx¦j¤º :nº§ujjºw¤º\ºfx¤aj\a´º`j§±jjº" º§ujº7\fºQ§\º¤u±ºxjfx\§j´º\`¯j º# º\´ºnº¦ujº§§\ºa¤¦¤º¤u±ºxº §ujºo\ºxtu§ºaº\`¯j ºº$¸º§ujºwfw¯wf\ºVx§ºJ¡waj º¦ujº§ujºWx§ºwajº¤u\ºa§º¯jº¦ujº§¦\ºa¤¦º\fº§ujº §§\ºa¤§º¤u\ ºa§º¯jº§ujº¬¦\ º :o ºu±j¯jº§ujºw¦º¢wajºw¤º\`xt¤ ºw§jwtw`jººaj ¦\xºnº\´ºa\¤jº ºx¤ºw§¦jf ººwº§ujº¤\jº\§º\¤º¦ujºj§´ºrº¦ujºx§jº§¦\ º¦ujº§ujºx§jº§¦\º¤u\ºj¯\w º\fº¤u\º`jºfw¯xfjfº `´º§ujºj¤¦x\§jfº\¦x¦´ºoº¦ujºw¦jº\fº§ujºxdjº¦u¤º`¦\xjfº¤u\º`jº¦ujºw§ºwajº .wffjº¤u\ºj³afjº§ujºa¤¦ºoºJjx¦º6jj¤ºnº.wffj¤º.\¤jº.wfº¤+º.\¤jº.wfº¤º¤u\ºxafjº§ujºa¤§ºnº \fww¤§\¦wº\fºafw\¦xºoº7¯jj¦\º,¯\¤º\hºV§yw¦´º6jj¤º .wffjº\a±jftj¤º¦u\§ºfj§jw\¦wºoº¦ujº±j¤§º.whº±wº`jº`\¤jfºº§ujºa`yjfº§§\ºoº§ujº\¦¤ºj¦jjfº `j±ºnº§ujº.\¤jº.xfº¤º¹<ºnº¦ujºw¤¦jfº.wfº,¦j\¦jºw§j¤º\fº¦u\§ºajº¦ujº±º`wfºw¤ºfj§jxjfºº§uw¤º`\¤w¤ º ¦ujº/w¦·º±~ º`jºnjmº¦º¤jºja¦º.~fº,§j\¦j¤ºnºxa¤wºxº§ujºZºwº\´ºfjººa`x\¦w ºº¦ºjja§º\´ºº\º .wfº,§j\¦j¤ º Western Allied Corporation Page 169 of 221 . . Item 10 Page 169 of 221 ! @ !(82, 8 A 158(4&(A?(A"$4;$A (A "7804-9A AA , ..8 #/=2)A A $ (. 83' ,8 8 % 8$ 8$.8 588),+),0$)(8 ==(:=A A5+A 0'A35>4<A A / 8 A 0 8) 84+$-1%)(8 ')3(08) 8 ,0% % 8),8.#$ ,.8# &8),8% 8)( 8 8*68 8 8 78 88 ' 8) 8)( $("8)'+(5 8 Western Allied Corporation Page 170 of 221 . . Item 10 Page 170 of 221 +QDLWdG>BE9H_dXC>dL8J>Vd8L=dXEXG>dM?dWC>dNP>VE=>LWd8L=d8GGdMAAF:>PVdM?dXC>d MJN8L_d]CMd8Q>d8ZWCMPE`>=dXMdVEBLdXC>d D=d MRJVd +, -" '0-dd* " ,-d'& d .".% d .C>dZL=>PVDBL>=d C>Q>9_d :>PWE?E>VdXMd XC>d DX_dM?d1>QLMLdXC8XdC>VC>dDVd XC>d=dH_d>H>:X>=d 8L=d 8:XDLBd->:P>W8P_dM?d 55555555555556d XC>d MJN8L_ 8L=d WC8X d8VdVZ:C d C>VC>dEVd8ZXCMPEa>=dXMd>^>:ZX>d XCDVd"L:ZK9>L:_d >PYE?D:8W>dMLd9>C8G@dM?dXC>d MJN8L_ d8L=d?ZPXC>Pd:>PYE?D>VdXC8XdWC>dN>PVMLVdL8J>=d89M\>d8P>dWC>d=ZH_d >G>:X>=dOZ8IDAD>=d 8L=d8:WDLBd MA?D:>PVdM?dXC>d MJN8L_ d CMH=DLBdMLdWC>d =8X>dC>P>M?dXC>d XEXH>Vd 8L=dNMVDXDMLVd V>Xd ?MPWCd MNNMVEX>dXC>DQdL8K>Vd8L=d8P>d8ZXCMPD`>=dXMdVDBLdWC>dE=d MSKVd #'d2#/' --d2! , * dXC>dZL=>PVDBL>=d C8Vd>^>:ZX>=d XCDVd#L:ZJ9>L:_d >PWD?D:8W>dXCDVd77d =8_dM? ) c4Td dbd 3;$<[d ->:P>X8P_Vd(8U>+PDLX>=d # # ## !# ! # ## # "# # ## Western Allied Corporation Page 171 of 221 . . Item 10 Page 171 of 221 Western Allied Corporation Page 172 of 221 . . Item 10 Page 172 of 221 ;ȣ,"Eȣ ŗķİŁŜĭŋŘğȣ Ąø Fȣ2KȣȣǫÖȣ2ƸX¦Ǧȣ!¾2Æaȣȣ U ȣÏȣ"ȁžȣm/(&ȣ ȣ¦@ȣ ȣ]Ʒȣ=ǟȣȣĠ $·s Ɣ (°DŽȣ"ùŢȣ *16 6 61)+!6 !&'$02!",)6%#,(,6$6 6 ȣ ǧ5ȣ26ȣ!à @\Ʋ Ä:ú Ċû ;ȣ# ȣȣ ȣ"Ȃ ȣmȒVVȣ%0ȣ p4 ȣD£ȣi' µ' 3' ×ȣąhQȣ ĸƹ|ǖ-[Ÿ-ȣ ȓ-Ø ţDz[ǶŤĹ-ȣřǐǗƪ[ôƟdzťÙȣŹŦŧŨQĘljȣ++ũȣŏRƤR|R[R-ŪŌū | gȣõÐĕQĪÓȣ hēéQĎhŬĆȣ++++++++ŭ+Ůȣ!¿ Ǡ %ÅÕȣ Vȋ ȣK ȣŽYuȣ)Ƃȣ8 ȣȣ Ƴ Ăȣ ďe .) ȣXȣ Ǔ ?ȣ ȣȣ ȣȣ-ȣ$ ưŻȣ ȣȣ ȣij ȣ# T ȣȣȣȣƝJȣȣ ȣȕ7ȣ % f ü F ȣ$ WƗ ȃȣ ƺ ȣȣ_^ȣ ȣȣ ?{Úȣ ȣ 9% ȣ ȣ ȣ @ǝ ȣ&\ȣǼ7ȣ ȣ ȣȣ (ȣȣǺȣȣȣ@Ɗ # ý Ŏņmļ6ş,"ġȣ Şjnjĺ,ŖjÛȣǍ ȣ/ ȣ ¢&/ȣšÜȣ ) ȣ¥ȣ <ƥȣĿ3 'Ȕ ȣ ; 4½ 3 Sȣi'ǁµ3 șbȣ OO1ȣŇ S' ȣo 0ȣp' S4 bȣ Dȣ1*PCȣ !"Ýȣ NȣȣȣȣȎ (ȣ ÷Ő Ʀ' ůōŰ' gȝÑęű*ŲOȞÔȣųOŴ*PêCĚĬ1īăȟëìöèdídîïðdñòó!À$ Çacȣȣƃ ȣ Ȍȣ _ȣ ȣ ȣ 8J`ȣƻÞȣ ȣȣ8Ģȣ ȣ»ȣ5ȣ ȣƴ&³ȣ ȣ/ ȣȣȣ ȣ ^ /5ȣȣ ȣ. ®/ ȣ W ßȣȗ Nȣ &&K9Ǩĉ Ƞ# ȣȣȣȣ2_ȣ ȣ ȣ ȣȣ < ȣőƆǘS ȣ'ȣƧȣ<'3ȣDǂ'½ ȣĮ£ȣ EǮȣ-$, 6 34/5.6 6 Á( ȣ ȣ$ ÂMàȣȣ ȣ #Yȣȣȣ ȣ<k"ȣ Ķn k"Fȣ!*ÈaȣGȣ & ǀËǴȣȣ0ȣ&ȣƑ ȣ ħǹȣ§ȣLȣ Šȣ$ȣƋȣ6´ >þȣ Fȣň ȣ6Ơȣ@ȣǵ H(ȣ¬ģȣ 3.ª3ȣĽ' Ț340ȣCCȣpȣ Pªȣo 0ȣ oȏȣ*110ȣ Ņ'4ȣD ơ40ȣiDȣĝ11*ȣ !"áȣ Hȣ ȣ«ȣ n ȣ6Ìȣ2G8JȣEǰ ȣȣ #¡¢ȣʼn) ȣ"ÿȣ 1ĴCć1Pȣ Ślkȣ ,"EłŝŃ,"ȣ,Ļȣśl$ȣ,"É$ȣ,Ŋ;ľ6<;,"ȣ;$ȣFl6<0ȣĤȣ!*:ȣ z Ƽȣ ȣȣ!Mȣ) ȣƱȣ ȣ ȣȣǢȣǑ Ưȣ ȣȣȣĵ Z âȣ ȣȣDžȣ ) ȣwȣ )© ȣƘ ȣ)ȣ!Ğȣ .ȣȣƜ ȣ Aȣ ȣLȣ2¼ ȣ ȣ(vȣŒ#Ƶ=(çȣ ȣ!MȣAB´ȣȣYv.ȣ%(ȣ ȣ{ȣǾȣ ¸ ȣȣ Jȣ ȣIJ~¡ ȣ ȣȜĖ**ȣ ȣȣ ź= ȣ UuX7ãȣ ȣdžȣǃĨȣ ȣțċ:ȣ2)ȣ ȣ 7ȣB ȣ2H ȣȣ ȣȣ y Íȣƫ Nȣ ȣȖ%ȣLȣȣ ȣLJǜ ȣ T¨ ȣȣȣ $ z¨ K&ȣ ȣ Ȇ ȣE ȣ ȣȣȣ ]) ȣ&ȣ ©ȣƬ&ȣ ƙ 9ȣ!*ĔMȣż ȣȣƽ?.ȣ ȣ ȇ Îȣ.5ȣ %>7ȣ!ȣ)ȣƄȣ&/ ȣ(ȣ (ȣǿȣ ¼ cȣxȣT> ȣȣ ȣ% ȣȣ = äȣ!ȣ J%ƨ ȣȣ ¸ H ȣǏȣƌNJ#ȣ ȣNj±ȣœǚyqƮȣƒwt²ȣ Ǟǥ -ȣ ȣǛ}¶r ȣtƕZȣƍȣƩƈȣıȈ ºbȣŶȑǻȣ²^}ȣŔǣq¶`ȣǒǬrȣƚ#ȣ ƾIȣ ȣ Ǥƿȣ ȣ%ȣK ȣ ~ƶ ȡȣ ȣÒ :ȣƞǩyƉȣ ȣ# ǔ 9s ȣ 9ƀNȣǽ ȣ ȣ±%Ȅȣŷȣ ³ȣǙƅȣ/ ȣ , DZcȣB ®ȣįLj¤ȣ. ȣȣ ȣG9>-ȣ ȣƓ Ȣȣ ȣȣƐ\ȣIȣ ȣƁ WVȣȣȣ wȣ ĥȣ *e $ `ȣ%BWȣ ȣ ¯ȣ ȣ ȣ?]åȣ -U ȣ@ȣ ȣȣ ƢȣȐȣȣnjv ȣ #4ȣ ]ǯ?U{u ȣ ȣ ȣ ¥ƭȣ»ȣ ȉ ȣȣ ǡ %æȣȣ Y xȣ&ȣ HȣǷȣ(« ȣ Ȋ ȣȣ Bf Čf "ȣ~XȣGȣTxȣ ȣȣȣ ȣȣȣȣ ȣȣ BȣIȣzȣ #^ȣȣg ĐŀƎȣȣ ȅȣǸȣȣ ȣ7ȣǕ ȣȣ = ȣȣ8.ſȣ ȣ ·I ȣº ȣ ȣ 5ȣ$ ȣ ȣȣȣ7¹)ȣȣ ȣěń ȣ ȍȣ 4}ȣAǪÊȣ?sȣ ȣ¬°ȣ=\(5ȣȣȣ ȣL ȣ> #(ȣƖȘĀ e $ _ȣȣȣ ȣ9&AAȣ ȣAȣ¹ȣđȣȣG8 Ħȣ!:ȣȣ§Ə /ȣ ȣȣ ȣȣ$ ȣȣ 0ȣ ǭ-5 ȣ¯L¤.ȣƛZȣȀȣ ĩȣIȣ:ȣȣ ȣ >Zȣ/%ȣ ȣ t8#q ȣ#ȣȣ r ā Western Allied Corporation Page 173 of 221 . . Item 10 Page 173 of 221 *E7 E7E68E .5E'.?E 1"+"0'E+E=1:AE=(AE@ =9E9 #6E.+E?$7!E:!E,)E/ E!E037AE001$- E'/?E*E6% +E BE&96E1016-9<>D6E=*1E7 E=;/2$7CE/ E$96E />4$- E/CE )KZ ¨ 8 RQ[¨¨ E C[[|¨%tsp[W¨' Lp| 4Mw\ /!¨EJ¨¡ ¢ £ ¤ ¥ ¦§FD¨GHH¨I &XYg¨k¨>f}l¨5U¨¨:¨*Vx]~" 0¨¨¨u¨ r¨b¨cd¨ <a >B= An[¨-L|[¨.|L|R[¨'v L| ({¨6P^ 3LoL¨,|Ls[ 6Nz 1#¨%[q|+LR i_ &YY]¨h¨@l¨7T¨¨9]¨*ye$ ¨2p|Rs|¨?[[ CR[[¨3%¨ &,O+I:<O OE #O2 O@O IC26'=MO2 O ,MO56:2,O:'!,',!O :O F36- '.?O AO G46/ (0 ;:O: "1OH8O+J:<OO,2< 9O O26527O<O:*O+K:<OO'+56::O2,O<$):O 26+OL$,O=$O56',)5 *O26OBO:J6<NO26O >%O 6O O26526D2,O Western Allied Corporation Page 174 of 221 . . Item 10 Page 174 of 221 *,- 8$8 "1 /8"8 ! 8 "3 +8 #'8 *0(*8,-") 4 ,8 !-6i-T- Y U- a o!QA$x B(aZ~d-jya[ RQ e- k-) \ U-9bflb-*aV-a[~9-! zCxa1x Ax2 $ -O(-\&.b"--g-q}b]9ax-[ W-Dxx"y%s#-(a9Ey F[xrW-^ {9- ~bt-A[2 %~c3 [( %P\a-)8-(aU.: ;/z9- x"y$iM!-+90[ T-a4<-m-b ydnN^'Bh R \)=Gx>-a_[ X- x bu-A[5 $ 8%-n A7[,-i% 8.48"8&)2)48\,-n?-R xb5 9- -b3 SL5bvH 7568 >- \('anp-% a l"QK& bI`8d o 8i f@J|w- Western Allied Corporation Page 175 of 221 . . Item 10 Page 175 of 221 Western Allied Corporation Page 176 of 221 . . Item 10 Page 176 of 221 Western Allied Corporation Page 177 of 221 . . Item 10 Page 177 of 221 EG91C=L1I=ED »:²»_³»³i_¤»r_¤»³¬»p_w´_§w»bij»w»b¤wi¥¤»_¤»_»4§_d§0»]P»O»VV»Q »;²»_³»³i`¤»r_¤»³¬»p_w´_§x»bji»x»c¦yk¤¤»gi»w¨¤»i¤i¨»_j0»/» »Kgk»²s`§»¨ti»`i¤»u`¥»³¬»p`wµ_¨w»i _§ih0» »=m»³®»p_w´_§y»x¤»_»d_§w»_¤²i»¨ri»n²zp&» »7_©i»n»xd¡_§{¡p_wµ_¨|&»¸¹» » H©_¨i»m»wd_¨wp_w¶`§}»'»XXXR»5S º »4_§i»>8»¬ci(»T UUUUVVV UVUVUVVV»W» !»C_k»m»F i¤whk§)»·«»»»<»2»l»N $»1pi§»n»Hi±wdi»n»F di¤¤-»M»6@»3»A "»=m»³¯»p_z´_©w»x¤»_»_§i¤sw »_¤²i»§si»n²wq)» #»8_§i»m»p_}´_§wn_§w&»XXXXXXXXXXXXX»Y» " »J³i»n»_£i¤s|»xm»_xd_bi*»XXXXXXXXXXXX»Z» " »D`i¥»m»pii`»a§i¥+»XXXXXXXXXXXXX»[» »"!»By¤§»_»¤¨_§i¤»w»²rwer»³°»`i»ipw¤§iig»_h»¤§_§i»?8»¬bi¤»m»i_fv,» $»=o»³¬»p_wµ_ªw»w¤»wg~±xh¬_³»²ig »_¦²i»§tj»m ²wp,» $»8_§i»m»p_x´_§}-»VUUUUUVUUUUUUUUU»\ $ »C_i»m»²i .» %»?n»¨ri»o»m»³¬»q_wµ_§w»x¤»¨ri¢»§u`»§r¤i»w¤¨ig»_c±k »gi¤ezbk»w§»_h»`k»¨ri» ew`¤,»XXXXXXXXXX]VXXXXXXXXXX»^» Western Allied Corporation Page 178 of 221 . . Item 10 Page 178 of 221 76*-;B2;/ 8\e ~[N\M]yo\oW\MWy~y|VJo\J]yo]iOVJii{Jj\P\ONyNyK]pO \oN\MJO}OV]~J\yoy| i\MOoOomKO~ JoNMJOV#~yPi\MOoO\QJzzi\MJKjOH,!"d3 7]f~\N\M]yo\oW\MWy|y|VJo\J\yozJoO|W]zy~~JNOoJmO\S\iON 7aJoi\MOo]oVzOq\yoJoNy~\yiJ\yoJOONJVJ\oy~y~VJo\J\yo\W\oWOzJ R]OOJ| -G=-A2-;*- <oWO-zO|\OoMO.y~m i\WOz~yfOM^oPy~mJ\yoWJOJLlcWOWJ)\NNO~mOOWO OOr\Ji~O{]|OmOoQy|{Jj_S]MJ]yoOQy|W`oWO9JsNJy@Ji\S\MJaytzJ~JV~JzX ySWO;y]MO4o\boV)\NSy~Y\>~yfOM 1JOBKMyo~JMy|Py~1E'*yhMymzkOOWOBzOM]Jj*yo~JMyBJOmOoyP @Ji\P]MJ\yoy~)\NNO~yMymziOO]SOiQzOQy~m]uV <vJOzJ|JOWOO i\z~yfOMyW\MWy|S]y~K\oOWJKOOoJJ~NONJ VyO|omOoMyo~JM]oMOy~S\|my|K\oOWJKOOo]oO]OoMOV\\oVWOoJmO JoNJNN~OySWOz|yfOM WOVyO~omOoJVOoM MyoJMoJmOJoNzWyoOwmKO~ WO Myo~JMJmyo JoNMyo~JMJ\oVNJOJoNOoN]oVNJO <xJOzJ~JOWOO j\WOOzO~\OoMOJoNz~OOoMymm]mOoySWOgO\oN]]NJjyQ y~y~VJo]J\yo0 ? (+I *7'29B%7'FBD5CB&*A2:2;'7'*CB .y~WOSyijy\oV{O\yo ZOO~myoO~NyOoy\oMjNOyoO~yQyMh\oy~S\~m\Ty~ Q\~m\JzKj]Mi~JNONMy~zy|J\yo 2oWOzJS\O OJ|WJO y y~S\~ny|JoyQ\yoO| zJoO| yPUaMO| y~ OmziyOOKOOoJNOQOoNJo\oMyy|zJ|\M\zJON\oJoJ~K\~J\yoy~mON\J]yo yoJ mJO~|OiJONy$ Western Allied Corporation Page 179 of 221 . . Item 10 Page 179 of 221 ! y 9KCycCeDag[;]@C y]a]cClae[;]@C y ACD;sWo ytMaX;pNa] yaey>eC;@LyaDy;y@a]pe;@oyafy ! y ;JgCC[C]o(y :,8 )ytCLM@WCy@aWXMnNa]yaey;@@MAC]oyM]taWtM]JyvaseyDNg[nyC[cXavCCn(y :,8y ! y +;[;JCypayhC;WyceacCeovy;eNnN]JyasoyaEyvasgynCetN@CnyaeyacCe;oOa]n(y :,8y 45y ! !y -[cWav[C]oeCW;pCAyWMpMJ;pNa]y>eayJLoy?vy;]yC[cWavCCyaEyvaseyENi[(y :,8y w5y ! "y 7;v[C]pyoay;yns>@a]pe;@paeyagynsccWNCg(y :,8 5 ! #y +CDC@pMtC yACDN@MC]oyaeyns?np;]A;eAyuagV(y :,8 46y 0DyoLCy;]nuCeypay;]vydsCnpMa]nyM]y! ypay! #yMny:-8 y MAC]oMFvypLCy];[CyaDypLCy cCgna]yaey C]oNpvypL;pynsCAyOC y pLCycW;N]pOHyagyu;nyM]taXtCAyO]ypLCy[CAN;oOa]yagy;g>Oog;pNa]%y XOnpypLCy A;oC y@asm y@asgoy;AAgCnny;]Ay@;nCy]s[>Cj%yACn@eM>CyoLCyE;@pny;]Ay@Me@s[no;]@CnyJNtN]Jy gNnCyoayoLCyW;unsMo y[CAN;oMa] yaey;g?Npg;oNa]%y;]AynCpyDaepLyoLCyasp@a[CyaeyANncanNpOa]y)pp;@Ly ;AAPoMa];YynLCCony;ny]C@Cnn;gvy ! y /;tCyvasyaeyvasgyDMe[yCtCgyIWCAy;y@W;N[yEaeyA;[;JCnyagy;yW;unsOoyaeyeCdsCnpCAy;e?Npg;oMa]y aky[CAQ;pOa]y;J;M^npy;yJatCe`[C]pyC]oNovyagy;y*WRC]q(y :,8 x45 1Ey:.8y OAC]pOGvyoLCyJatCg][C]oyC]pOrvyagy@XOC]o%y XNnpyoLCyA;pC y@asepy;]Ay@;nCy]s[?Ce&y ACn@eM?CypLCyD;@pny;]Ay@Og@s[no;]@Cny;?aspyoLCy@W;N\yDagyA;[;JCn yaeyoLCyW;unsMo yaey>aoL%y ;]AynCoyDbjpLyoLCyasp@a[CyaeyAMncanMoNa]y )op;@Ly;AAOoNa_<WynLCCpny;ny]C@Cnn;evy ! y )gCypLCgCy;]vycC]AM]Jyaeyaspno;]AM]JySsAJ[C ]onyaeyWNC]ny;J;M]noyvas yvaseyDNe[ yaey;]vyaEy Npnyau]Cgn yc;gq]Cgn yaEFO@Cen yaeyC[cWavCCn(y :,8 2Ey:,8yMAC]oNEvyoLCy];[CyaEyoLCycCena]yaeyC]oNpvyC]oMoWCAypayc;v[C]o%y ZMnpyoLCyA;pCy@asepy;]By @;nCy]s[>Cg%y ACn@gO?CyoLCyE;@pny ;]Ay@Oe@s[np;]@CnyJMtN]JyeMnCyoaypLCyTsAJ[C]oyagyWNC]'y ;]Ay nCoyEagpLyoLCy;[as]oyaDyoLCyUsAJ[C]oyagyWNC]y)op;@Ly;AAMoNa]=WynLCConyNEy]C@Cnn;evy !!y 3]yoLCyc;noyFNtCy"yvC;enyL;ny;]vyJatCe][C]oyC]rMpvyCtCe$y;yN]tCnoMJ;pCAy@MoCA yAMn@McWM]CAy Western Allied Corporation Page 180 of 221 . . Item 10 Page 180 of 221 PSs)^^1^^1/s)LksR1L)F_=1^s):)>L^_skPaskPaSs4>SJs PSs)LksP3s=`^sPiL1S^sR)Z`L1S^sP44=,1S^sPSs 1JRFPk11^ sPSs*s/1_1SJ=L1/sPSs,PL,Gb/1/s_;)_skPaSs 3>SJsPSs )LksP4s>_^s PiL1S^s R)Z`L1S^ s P38>,1S^sPSs1KRFPk11^sh=PG)`1/s)L op cG1^sPS nq `>PL^ s #3s'!&s=/1L_=3ks`;1s:Ph1SLK1L`s1L_>_k sG>^_s_<1s/)`1s)L/s/1^,S?*1s_;1s3),_^s)L/s ,>S,aJ^_)L,1^s)*Pb_s1),;s=L^`)L,1s ``),;s)/s >_>PL)Fs^;11_^s)^sL1,1^^)Zks s #Ls`;1sR)^_s4>h1ssk1)S^s;)h1skPaskPaSs4>SJsPSs)LksP3s>`^sPiL2T^sR)S`L1S^sP34>,1S^sPSs 1JRFPk11^s*11Ls,PLh=,_1/sP4s)s,S>J1sU1F)`1/s`Ps`;1s*>//>L:sP3s)s:Ph1SLK1L_s,PL`S),_s_;1s )i)S/=L:sP4s)s:Ph1SLJ1L`s,PL_S),` sPSs_;1sR1X4PSK)L,1sP5s)s:Ph1SLJ1L_s,PL`S),` s PLh>,_1/s>L,Fa/1^s)sh1S/>,`sP4s:a>F`ks*ks)sBd/:1sPSsCaSks)sRF1)sP4s:b>F`ks)sRF1)sP4sLPGPs ,PL_1L/1S1 sPSs)s4Q[1>_bS1sP4s*)>Fs s '!&r$%s #4s(!&s>/1L_>4ks_;1s:Ph1YLK1L_s1L_>_k sF=^`s_;1s/)_1 s,PaS`s)M0s,)^1sLaK*1S s/1^,S>*1s_;1s 3),_^s)L/s,>S,aK^_)L,1^s)*Pb`s1),s =L^_)L,1 s)L/s^1_s3Q\;s`;1sR1L)F_ksPSsRbL=^;J1L_s =JRP^1/s __),;s)//=_>PL)Fs^;11_^s)^sL1,1^^)Zks #Ls`;1sR)^_s3=h1ssk1)S^s;)h1s kPas kPaSs4>SJsPSs)LksP6s=`^sPiL1S^sR)S`L1S^sP39=-1S^sPSs 1JRFPk11^s+11Ls,PLh=,_1/sP4s)s,S>J1s>LhPGh>L:s1K*1lmF1J1L_s`;14_s4S)a/s6QS:1Zks *S@*1Sks/1,1R`=h1sPSsbLF)i4aFs*a^=L1^^sRS),`>,1^sR1SDbVks3)G^>3k=L:sPSs/1^`SPk=L:sS1,PS/^s PSs1h>/1L,1sPSsS1,1>h>L:s^_PF1LsRSPR1S`ksPSsJ)E=L:sPSs^b*J=``>L:s)s4)H^1s,H)>J s #4s'!&s>/1L`>4ks_;1s,S>J1sPSsP441L^1 sF=^`s`;1s/)_1s,PaS_s)L/s,)^1sLaJ*1S s/1^,S=*1s`;1s 3),_^s)L/s,=S,bJ^`)L,1^s)*Pb`s1),;s>L^`)L,1 s)L/s^1_s4PW`;s_;1sR1L)F`ksPSsRbL>^;J1L_s =JRP^1/s __),;s)//=`>PL)Fs^;11_^s)^sL1,1^^)Zks ")h1skPasPSs>7s >//1Ss>^s)s,PSRPS)`=PLs)LksRS=L,>R)FsP4s`;1s,PSRPS)`>PLs1h1Ss*11Ls ,PLh>,_1/sP4s)s41GPNk s (!& #4s'!&sRG1)^1s1jRF)=Ls`;1s/1`)=G^sP3s_;)`s,PLh>,_=PLs)L/s>3s^Psi;1_;1SskPesPSs^)>/sP44>,1Ss ;)h1s^1]1/s;>^sPSs;1Ss^1L_1L,1s s #Ls_;1sR)^`s4>h1ssk1)S^s;)^s)s:Ph1SLK1L_s1L_>_ks/1_1SJ@L1/sPXs,PL,Ga/1/s_;)_skPbskPbSs 3>SKsPSs)LksP4s=`^sPiL1S^s R)Z_L1U^sP43>,1S^sPSs1KRGPk11^sJ)/1sPSs^a*J=`_1/s)s4)F^1s,F)>Js =L,Fg/>L:s)s3)I^1s,F)>Ks4PSsR)kK1L_sPSsJ)/1s)sJ)`1S>)FsK=^S1RS1^1L_)_APL s #4s'!&s=/1L_>3ks`;1s:Ph1SLK1L`s1O_>_ks)L/s/1^,S=*1s_;1s4),_^s)L/s,>S.fJ^_)L,1^s)*Pb`s 1),;s>L^`)L,1s _`),;s)//>`>PL)Fs^;11_^s)^sL1,1^^)Sks Western Allied Corporation Page 181 of 221 . . Item 10 Page 181 of 221 B#Ė Ė Ė Ė ĖU Ė ĖĖ Ė Ė Ė 8%Ė Ė Ė ą Ė*Ė ;Ė Ėè ¸ DĖ/Ė®ª?ĖU ĖĎ& #Ė G đ¤ B#A{Ė IĖ Ė ÷ÜW°%Ė Ė ĖĖĖ &ËĖ2 PĖ ĆĖä Ė - ĖÆ ĖĖĖ 4È Ė Ė Ė4Ė Ė ĖĖćüĖ Ė" 9ÛĖ Ė ĖQ; Ė ĖY¯ZdĖ&%Ėé !Ė$ÂĖÌĖĖ3Ė¹êýĄyz 5 Ė Ē¥Ė .(/)[ Ė1¨6) «,10 Ė J J #A(Ė ,ĖĖ"þĖČÃĖ\`Ė eĖĖ Ė +Ė Ė± ĖĖ ĖĖ3ĖĖ å9ĖM ÝfĖĖ T9ĖÖ " 'Ė Q gĖ É"'Ė Ė ēĐĔ F Ė ĕ1Ė Ė G hĖ%ĖĖÍ Ė=ĖO ĖĖ WĖĖĖR CĖ ĖÿĖ Ėß½Ė Þ2Ė Ė ĖĖÊĖ2 Ė 2¾ĖĖ NĖ3Ė!ëæĖ Ė Ĉ :ĖĀ-ú(Ė * Ė²* ĖûĖĖ ³ø uĖ .@}#Ė ,Ė*$Ė ì´ĖÎĖ <.aĖ 'Ė Ė ĉ ĖíĖ$Ė Ė iĖ 8 jĖ V-ÏS'Ė % kĖ MĖ ĖĖ - DĖ 5 Ė 01 Ė_t^Ė Ė 5 lĖ Ėā$Ė! Ė+Ė ¿Ė ÄĖ$Ė ĖµĖ ºĖĖ¶ Ė vĖ X ĖX Ė3ĖĖ wĖ .(~(Ė ,Ė Ė ĖĖĖ& ĖmĖîĖĖ !Ėčï Ė]bĖ%! nĖ >Ė% oĖ Ė ĖĖ +Ė Ė<cĖ Ø ! ĖĖ" Ė Ė À Ð ĖÇĖ /Ė 6 +ĖðĖNĖ PĖÑĖĖ&ĖĖñĖ& * Ė:Ė ĂSpĖ Ėç7Ė8"Ù 'Ė Ė à Ė7CĖ·ĖÁL» !Ė$Ė+Ė Ò Ċ*qĖĖòĖ 7óĖ×! ĖĖ Oá#Ė $Ė!ĖĖĖ â ùď(Ė x E/,0Ė FE ) H¢KĖ¦£¬) 4KĖ©6)§)¡ 0H @|#Ė IĖ LĖ: Ė Ė ô'Ė V Ó?Ė >Ė"=Ė Ė ;ÅĖ " ăĖ -Ė Ė õĖöĖ Ė Ė rĖ T sĖ Ė &Ú ĖĖ ã ċ¼ÔRĖ " Õ Ė Western Allied Corporation Page 182 of 221 . . Item 10 Page 182 of 221 $6u+!* u ?24Pb@6rub=4uP.O4uX6ub=4u<Xo4[PO4Pbu4Pb?br uG?`bub=4u2.b4 u.P2u24`1[@/4ub=4u6.1b`u .P2u1@[1iO`b.P14`u./Xjbu4.1=u?P`b.P14 u.P2u`b.b4ub=4u[4.`XPu6X[ub=4u<Xo4[PO4Pbu4Pb@br`u .1b@XPu.<.?P`burXi[u7?[Ou bb.1=u.23?b@XP.Gu`=44b`u.`uP414``.[ru u ".`u.u<Xo4[PO4Qbu4Pb?bsu4o4[u[4F41b42urXi[u6?[O`u ?2uX[u([XYX`.HuXPub=4u<[XiP2ub=.burXju X[urXi[u7@[Ou?`u.uPXP[4`YXP`?/I4u/?224[uX[uY[XYX`4[ u +!*u $7u+!* u?24Pb?7rub=4uP.O4uX6ub=4u<Xo4[PO4Pbu4Pb?br uG@`bub=4u2.b4u24`1[?/4ub=4u7.1b`u.P2u 1@\1jO`b.P14`u./Xibu4.1=u?P`b.P14 u.P2u`b.b4ub=4u[4.`XPuX[u/.`A`u7X[ub=4u<Xo4[PO4Pbu 4Rb@br`u24b4[O@P?P<ub=.burXi[u7?[Oup.`u.uPXP[4`YXP`?/G4u/?224[u bb.1=u.22?b@XP.Gu `=44b`u.`uP414``.[ru u #.o4urXiuX[u rXj[u7?[Ou4o4[u 7.?I42ubXu7iI7?LGuX[uY4[6X[Ou 4@b=4[uY.\e?.GIru X[u1XOYG4b4Jru .u 1XPb[.1buX[u.Pu.<[44O4Rbup@b=u.u<Xo4[PO4Pbu4Pb@bruX[u.u1G?4Pb u ,!*u t&'u $7u-!* u?24PbB;ub=4uP.O4uX7ub=4u<Xo4[PO4Sbu4PbDhruX[u1G@4Pb uM@abub=4u2.b4 u.P2u24`1[@/4ub=4u 6.1b`u.P2u1?[1jO`b.P14`u./Xjbu4.1=u?P`b.P14u bb.1=u.22@b@XP.Gu`=44b`u.`uT414``.\ru u $Pub=4uY.`bu7Ao4u ur4.[`u=.o4urXjuX[u.PruX7:?14[uX[uY[?P1@Y.IuX7urXi[u7A[Ou/44Uu.PuX7:A14[uX6u .RXb=5]u6?[Oup=?1u 7.@I42ubXuY4[7X[Ou.u1XPb[.1buX[u.<[44O4Pb u $7u+!* uG?`bub=4u2.b4 u.P2u24`1[C/4ub=4u7.1b`u.P2u1@^1iO`b.P14`u./Xibu4.1=u@P`b.P14u bb.1=u .22?b?XP.Gu`=44b`u.`uP414``.[ru u #.`urXj[u 9E[Ou4o4[u.2o?`42u.u <Xo4[PO4Vbu4Pc?eruX[u .u1G@4Pb up=?G4u rXj[u6@[Oup.`ujP24[u 1XPb[.1bup?b=ub=4u<Xo4[PO4Pbu4Pb?bruX[u1G?4Pb uc=.burXi[u7?[Ou1XjK2uPXbuX[upXjG2uPXb u6kfg@GIuX[u Y4[6X[Ou4@b=4[uY.[h@.GNruX[u1XOYG4b4Grub=4u1XPb[.1buX[ub=4u.<[44O4Pdu/.`42uXPub=4uY[?14`u b=.burXj[u6?[Ou=.2uX[?<@P.GMru`l/O@bb42u@Pu.u ?2uX[u.u)[XYX`.I u $7u+!* uI@`bub=4u2.b4u?24Pe@7rub=4uP.O4uX6ub=4u<Xo4[PO4Pbu4Pb@bruX[u1I?4Pb u.P2u24`1[?/4ub=4u 7.1b`u.R2u1@[1iO`b.W14`u./Xibu4.1>u@P`b.P14u bb.1=u.22@b?XP.Gu`=44b`u.`uP414``.[ru u #.`urXj[u7@[Ou4o4[u[4Zj4`b42u.u <Xo4[PO4Pbu4Pb?hruX[u .u1G?4Pb u p=?G4u rXm[u7?[Oup.`u jP24[u 1XPb[.1bup?b=ub=4u<Xo4[PO4Pbu4Pb?bruX[u1G?4PbubXu[4P4<Xb?.b4uXP4uX[uOX[4ub4[O`uX7ub=4u4q@`b?P<u 1XPb[.1buX[u.<[44O4Pb u +!* %8u+!* u ?24Pb?7rub=4uP.O4uX7ub=4u<Xo4[PO4Pbu4Pb@bruX[u1G?4Pb u G@`bu b=4u2.b4 u .P2u 24`1[?/4ub=4u 7.1b`u.P2u 1?[1nO`b.P14`u.0Xibu4.1=u@P`b.P14u bb.1=u .22@b?XP.Gu`=44b`u.`uP414``._u Western Allied Corporation Page 183 of 221 . . Item 10 Page 183 of 221 ~ &2p~zdth~<Gh[~9w9h~h9gt9pq96~2~Ddw9i_\9_q~9_qGqz~di~2~4WG9_q ~xFGW9~zdth~<Gh[~x2p~t_69h~ 4d_qh24q~xHqE~qF9~Ddw9i_[9_q~9_qKq{~di~4WG9_q ~qd ~2~42_49W~qE9~4d_qi24q~di~2Dh99[9_q ~dh~ 3 i9X92p9~dj~6Gp4F2kD9~zdti~?Gh[~?di\~qF9~4d_qi24q~dm~2Dh99[9_q 1%/ )<~1%/ ~G69_qI<z~qE9~_2\9~d<~qF9~Ddw9i_[9`q~9_qGsz~di~4XI9_q ~WGpq~qF9~62q9 ~2_6~69p4hJ39~qF9~ B4qp~2_6~4Kl4t[pq2_49p~23dtq~924F~G_pq2_49~ !qq24F~266GsTd_2W~pE9:qp~2p~_949pp2iz~ ~&2p~2~Ddw9h_[9_q~;aqIqz~dh~2~4WI9_q~9w9h~q9i[I_2q96 ~ptpf9_696 ~dh~_d_m9_9x96~zdth~ <Gi[p~4d_qi24q~dh~2Di99[9_q~39<di9~Gqp~4d\fW9qGd_ ~ 1%/*+~ '<~1%/ ~I69_qLC~qF9~_2[9~d=~qF9~Ddw9h_\9_q~9_qGsz ~XGpq~qF9~62q9 ~2_6~69p4hG39~qE9~<24qp~ 2_6~4Ih4t\pq2_49p~23dtq~924F~M_pq2_49~!qs24F~266GqGd_2W~pF99qp~2p~_949pp2kz~ ~&2p~2~Ddw9h_[9_q~9_qIqz~dh~2~4ZJ9_q~9w9i~_dqG<P96~dh~26wGp96~zdth~?Qh[~qF2q~zdth~<Ih\p~ f9l?dh[2b59~t_69i~2~4d_qh24q~dh~2Di99\9_q~x2p~fddh ~pu3pq2_62i6 ~69?R4I9_q ~dh~_d_| 4d[fWI2_q ~ 1%/ '<~1%/ ~G69_qG>z~qE9~_2[9~d<~qF9~Ddw9h_\9_q~9_qIqz~dh~4WI9_q ~WGpq~rF9~62q9 ~2_6~69p4nG39~qF9~ <24qp~2_6~4Gn4t\pq2_49p~23dtq~924F~G_pq2_49~!qq24F~266IqGd_2W~pF99qp~2p~_949pp2lz~ ~'_~qF9~f2pq~<Nw9~~z92ip ~F2p~zdth~<Ih[~f2G6 ~di~F2p~zdti~?Gh[~399_~2pp9pp96 ~XKgtK62q96~ 62[2D9p~d_~2~4d_qi24q~di~2Dh99[9_q ~ 1%/ (<~ 1%/ ~G69_qJAz~ 2WW~pt4F~ 4d_qh24qpfidU94qp~ 3z~ dx_9i ~ dx_9ip~ 266h9pp ~ qF9~ 62q9~ d?~ 4d\fX9qId_~d<~qF9~fidV94q ~2\dt_q~d<~WGgtI62q96~62[2D9p~2pp9pp96 ~2_6~2WW~dqF9h~I_<dh]2qGd_~ c949pp2iz~qd~?tWXz~9yfW2G_~qF9~2pp9pp\9_q~di~f2z[9_q~d?~WGgtI62q96~ 72[2D9p~ !qq24F~ 266GqNd_2W~pF99qp~2p~_949pp2hz~ )*/0-!*#%~!*$~"+*$/ ~ '_~qF9~f2pq~q9_~z92hp ~F2p~2_~I_pti2_49~4d\f2_z~eo~2~pth9qz~4d\f2_z ~ -9?tp96~qd~G_pti9~zdvh~?Gh\~<dh~WI23IYOqz~4dw9h2D9 ~ 1%/~*,~ #2_49W96~dh~_d_i9_9x98~zdth~<Gh^p~I_pth2_49~4dw9h2D9 ~ 1%/~}*+ .9?tp96~qd~Ippt9~zdti~@Sh\~2~3d_6 ~ 1%/ Western Allied Corporation Page 184 of 221 . . Item 10 Page 184 of 221 " ->eAD]DCiqqD|i\DC>@ieCi@u>ReDC@i{qGTqc' ;.7 0GvLD>etErvi>eo{DtuRietSe"ui" Tt;.7 RCEevRGvLEe>cDiGvLDRet{q>eAE Aicn>eiqt{qDuAicn>e]TtvvLDC>uD >eCCDtArR@DuLDG>Aut>eCARqA{ctv>eADt>@i{u D>ALRetu>eAD(vv>AL>CCRuRietLDDvt>teEADtt>q " 0euLDn>tuvDeD>qt L>t>eRet{q>eAEAicn>eirt{qDuAicn>ec>CD>e n>cEevtiei{rGRrct@DL>]G>t>qDt{]viG>CDG>{]v uit>uRtG>eA]>Rct>J>Rftv> nEqGirc>eAD@ieC n>cDeu@ieC iqc>ReuEe>eAE@igCRtt{DCiei{rGTqct@EL>]G' #7:6.9; # # ;.7 34 0G;.7 RCDevRGD>ALAieur>AvAicn]DuDCiq>ci{euiGE>ALA^>Rc uLEe>cD>eCuD_DnLieE e{c@EqiGvLEA^>Tc>ev uLDC>uD Jri{eCt>eCA{rqDevtu>v{tiGvLEA]>Rc >eCRGqDti]|DC vLDdDvLiC e>v{rE >eC>ci{euiGuLDrDti]{vRie(uu>AL>CCRvRietLEDut>teEADtt>q 0G>nEsGiqc>eAE>eCiqn>cDeu@ieCUtqEo{RqDC@uLTt@RC RCEeuRIuLE@ieCTeJAicn>e RG>rq>eJDcDeutGiruMD@ieCN>|D@DDec>CE&RGeiuTCDeuRGuLE@ieCReJAicn>eGiquLE -ievq>AuirtciturDADeunqiZDAu% )+j}182wz k (]biGvLD>@i|Dtu>vDcDeut>tuiEnEqREeAD GRe>eAR>]p{>]TGRA>uXiet >eC>|>V^>@]En]>eu>gCDo{WncEev>rDt{@cRvvEC RhAie[{eAuRieRuOuLEnrinit>`>t>n>rvuPDqDiG>eCvLDur{uQG{]eDtt>eC>AA{q>AiGvLDTeGmqc>vRieRtJ{>q>euDDC @vLE,RCCEq 0LDqD@AEquYG{eCErnEe>]uiGnDr[{q{eCEquLE]>tiGuLDtv>uEiG->^RGireR>uL>xuLDqDnrEtEeu>uRiec>CELDrDTe >qDur{D>eCAirqDAv 7RJe>v{qDiG,TCCEq =aBy*/<~ Western Allied Corporation Page 185 of 221 . . Item 10 Page 185 of 221 Western Allied Corporation Page 186 of 221 . . Item 10 Page 186 of 221 Western Allied Corporation Page 187 of 221 . . Item 10 Page 187 of 221 8=6,$ A 41$ )BJ '.. 'H ?J?A$1 )28=6H$1$4A? 64C= A 46 MNNNO ONNPP Q 8i[Uw[ |w[ UZZdxdnmUi wc[[xw d] m[Y[wwUt /ewy X[jn xc[ qtng[Yy dm]ntlUxenm ycUx [wxUXkdwc[w xcUx eZZ[t l[[yw yc[ [ww[mxdUj t[r|ds[l[mxw ^nt r}Uje]eYUydnm w[y ]nsyc dm yc[ 1UmZUxns <|Uie^dYUydnmw qUtUatUqc n] xc[ 4nxdY[ *m~dxema dZw ]nt xcdw 8tnh[Yy !75D> !D !75E> !D !75E> !D 9>7-%!D 5 3% 5# !75D !D :(75% @E >D # D% %5# # D% 37F5E &%5!K ##>%@@ !75E !D 5 3% 5G3 %> ji n^ xc[ UXn~[ wyUx[l[mxw Uw yn [q[td[mY[ Ut[ w|Xleyx[Z dm Ynmh|mYxdnm eyc yc[ qtnqnwUj Uw U qUtx xc[t[n^ UmZ xc[ xt|xc]|jm[ww UmZ UYY|tUY n] yc[ dm^ntlUydnm ew a|UtUmx[[Z X xc[ dZZ[t + c[t[X Y[syd] |mZ[t q[mUiy n^ q[th|t |mZ[t xc[ iUw n^ yc[ wyUx[ n^ Uie`tmeU xcUy yc[ t[qt[w[mxUxenm lUZ[ c[t[fm Ut[ yt|[ UmZ Youu[Yy ?damUx|t[ n] dZZ[t 8temy 4Ul[ Iz " ?xUx[ n] Uid^ntmeU nmxtUYxntw /eY[mw[ 4nR S nm{vUYxntw 0dY[mw[ [qdtUxdnm ZVx[ LT Western Allied Corporation Page 188 of 221. . Item 10 Page 188 of 221 ^X`@Zrv2@XGv '5 GH5C@M >=853M ACBAC0H8A@M 5cLYAcrv9r`Gv^Hv >^cSv & M A@GIDJ2H:A@M0@4M$5FK925M 5Gdh^Zv ^X`TGiLZJv&^cXv(!)0)EG)60* +A,@,L 0,=5 ,LM---------------------M,M 9LjWGv A?B=:0@25M 5K^ZGv3lXBGcv.,,,,,,, M -----M/ !@jGv "2HA15DMM 8 &"9?v5#7&47. 2 #v -Mhjvr^mdvC^X`@Zrhv )ZjGdhj@jGv#q`GdMGZCGv7@jLZJv/^FLHLGcv#70vvI_cvjKGvjKcGGvX^hjvdGCGZjvrG@dh %v $v uv M ,Mhjvr^mdvD^X`@ZrhvZlXBGdv^IvMZQleLGhLWTZGhhGhvHd^Xvr^lcv48' vvT^JhvH_cvjKGvjKcGGvX^hjvfGCGZjvrG@ch @ &@j@TNjMGh B 48( v cGC^cF@BTGvMZEOFGZjh ,^hjvo^dSv @rvMZCMFGZjh F 9^j@TvU^hjvo^cSvF@rh G 9^j@VvK^lchvo^dSGF M M M M M M M M M M M M M M M M <`^[vdGbmGhjvIc^XvjKGv Njrv jKGvC^Zjg@Cj^dhvhK@TWv`c^nMFGvC^`LGhv^IvjKGvH^TT^pPZJvMjGXhv@J v @ZFv )jGXhvFt JvI^dv G@CKvWLhjGFv8lBC^Zjc@Cj^c @ v 48' vvT^JhvH_dvjKGvX^hjvdGCG\jvjKdGGvrG@dhv @]FvClccG]jvrG@dj^F@jGv B v =GdMILC@kL^Zv^Iv"71vIc^Xvr^lcvLZhlc@ZCGvC@dcMGcv C v *ZRldr+TWZGhhv7G`^div F v ^X`WGjGvodMjjGZv8@HGjrv5c^Jc@Xv ^X`@Zrv8@IGjsv ^Zj@Cj @ @XGv %75>><M#;HIAM B6K^ZGv M G v 9c@LZMZJv5T@Zh :c@LZNZJv GcjNINC@jGhvH^dv#X`T^rGGh Jv "XGdJGZCrv7Gha^]hGv;d@MZLZJv : ::(( .:/':5'* +.:' ($./'#:(' .: /:' (,.:/:6(+$:':/.:'$/+/'+:0':'/+.:':." +:.9:/7(: $:-/': .:$./:%$2 :(,!3 : /:.::+/:'++ 1'$:/':'5: 2:/:'$/+/'+:)8.:&:5'+ +.:' (:(+ 4 : Western Allied Corporation Page 189 of 221 . . Item 10 Page 189 of 221 =!)'?A 8;7+;!2 =!*(>A 8;7+<!2 %7"@2(3>!>,73 G %h h{ G~M G nWwwMc vGOMw knhUnG^ _Gc{G\ 1Gvx nM~XvXhc LGwM B0CH d C | C H u C C D EEEE F I &h h VG~M G oXzwMc vGPMx PXM]L _Gc{G\ K !pM G]] ho[Mov UX~Mc G Ihh[]Mw wVGw KhcwGWcv hn[ o{]Mv nMvkievXIX]XxW Mv GcL hxVMn GklnhkqXGwM XfPjo_GwXhc 871-#A !3% 2!3!+'2'3> =@897;> G %h h{ VG~M G vGPMw kh\XK vxGxM_Mcx Prh_ Gc hRXKMn hO xVM Kh_kGc I %h h{ VG~M G LXvKWk]XcGn kohKMvv Pho McOhnKM_Mcx hP h{o vGPMx knhUnG_ K %hMv _GcGUM_Mcx vMw KhnkhoGwM vGOMw UhG\v L %hMv MMK{wW~M _GcGUM_Mcx nM~XM !KKXLMcx nMkhnzv =GOMw vxGwXvwWKv -cvkMKxWhc oMkhnwv N %h h} vGPMx koM m{G]XQ v{IKhcwnGKxhov O%h h{ VG~M G oWwwMc kh]WK hc GKKWLMcx sMkhnwXcU GcL Xc~MvwWUGxWhc U %h h{ VG~M G \YUVw L{w oMw{nc xhho[ kh\WK V.v vGPMx kGpz hP h{o v{kMo~Wvhov kMoPho_GcKM M~G\{GwXhc X%h h{ VG~M G kMnvhcG kohwMKxX~M Mm{Xk`Mcw 8:( kh]XK "XnK\M 7cM 4h 3h 3h t3h 3h T 5h 5h 5h 3h ah b6h S3h b3h Z %h h{ VG~M G oXxwMc v{JvxGcKM GI{vM knhUoG_ $ 3h /O Mv LhMv Ww XcK\{LM KVMK[ G\\ Gkk\XKGI]M IhMv8oM M_k]h_Mcx xMvxXcU ;Mx{nc xh L{x wMvwXcU ;GcLh_ xMvxWcU %XvKWk]WcGo knhKMvv;MGvhcGI\M KG{vM xMvxXcU !]KhVh] yMvwXcU8hvw GKKXLMcx xMvxWgU 6GxXhcG] ,cvwXx{wM hc %o{U !I{vM 8GcM\ =KoMMc [ %hMv MGKV ]M~M] hP _GcGUM_Mcx VG~M GvvWUcML vGPMx L{wXMv GcL nMvkhcvXIW\XwXMv 3h Western Allied Corporation Page 190 of 221 . . Item 10 Page 190 of 221 1/ &*$*"} * },/% *1 1$,* = _}t_n}@_[An@k}j=EDkt}_fMC[l=lM_[}le=M[M[I}E_f}C=@L CYbT_tCC > _}t_n}@_[An@k}jNkC}j=ECkt}_eNC[l=lM_[}E_f}CoCft bCfj_[}[Cp}l_}lJC}P_?}jMlC w}*_} _} @ _Cj}t_ne}j=EClt}bf_If=Y}eCdnNfC}j=EClt}lf=O[N[I}YCClN[IjX*_} E_f}C=@J}jnbCeoMj_e}E_eCY=[}=[A}=?_oC #_p}_FlC\ 4CCQUu} )_[lJUt} .n=fkCeTt} [[n=TUt} ,kJCe}788}9} _}t_n}J_UA}k__U}?_ql=NUI=kC}j=EClt}YCCkN[Ij G_@njCA}_[}t_ng}jbC@NEN@}p_fQ}_bCe=lM_[jCqb_jnfCj #_p}_FlC[ '}5CCRVt} =MTt} ,lJCf}:::};} C _}t_n}fCdnMeC}CdnMbZC[k}_bCh=kN_[@CfkMEM@=kM_[}lf=M[M[I )&*%02/ 2$,*} * }-/, ! 3/!0 = _Cj}t_nf}peNkkC[}j=ECkt}bf_If=Y}=AAeCjj =AYM[Mjkf=kMoC}be_@CAneCj $E}tCj}@JC@Q}pJN@J}=bbUt} H*_} x+_} *_} r}-eC}bf_PC@ll=jQ}bT=[[M[I} s}/C@_eA}SCCbN[I} z}!YCfIC[@t}be_@CAnfCj } nANljM[jbC@kN_[j }0=EClt}@_YYNklCCj} y# 6 ,)} } @@NAC[l}M[oCjkMI=kN_[jiCb_ekN[I {}2e=M]M[I}A_@nYC[l=lM_[ 7}0n?jl=[@C}=?njC}cfCoC[kM_[} ( /Cknf[ k_ p_fQ }#=v=fA_nj}p_eQ}bCeYNkj <}0n?@_[kf=@k_f}beCdn=TMEM@=kM_[ ? _}t_n}J=oC}bf_PC@k}j=ECkt}@_YYNkkCCj @ _}t_n}@_[An@l}P_?}jMkC}j=ECkt}M[jbC@lM_[j #_p}_FmC[} |*_} +_} =MUt} 4CCQTt})`^lJTt},kJCf}:::};} _}lJCjC}N[jbC@kN_[j}M[@WnACj}=}e_nlM[C}j=EClt} M[jbC@lM_[}_E}CdnMbYC[l}C I }j@=FE_TA}T=AACej}EMfC} CqlN[InNjKCfj}Ck@ } A _}t_n}M[oCjkMI=lC}=@@MAC[lj #_p}=fC}kJCt}fCb_flCA 2_l=U}@_Yb=[t} t}be_PC@l} t}jnbCeN[lC[AC[k} t}be_PC@l}Y=[=ICf} *_} *_} t}EaeCY=[} %[}=@@_fA=[@C}pMlJ},0# } C _}t_n}ANj@njj}j=EClt}=l}=UT}beC@_[jkfn@kM_]}=[B}be_IeCjj}YCCkM[Ij Western Allied Corporation Page 191 of 221 . . Item 10 Page 191 of 221 i3ÇÀºÇ h¨j¥Ç¨yttytÇ]dÇyj²ytÇbuhb°Ç ¦y¨Ç´Ç{j¹yt$Ç (Ç 7¨Ç h¨°hÇ \Ç8§Çh¤ºz h²Ç Ç<h]½ÁÇ{s°Ç¨hDzv]ÇÇa°Ä !TKMCÇMRD4O ]3ÇÁºÇ h®yd{b]ÁǺ e]³hǾ¥Ç¥ºh°% TuhǾ]°Ç²uhÇ@]°²Çº d]²h&Ç ÆIÇ aTu]²Ç¾¨Ç ¥]b´{bh°Ç]¨hÇ]dd¥h°°hdÇaÂÇÁº¨Ç¾¨Ç¨ºh°'+LNk¥°²Ç]{fÇ Ç)bbh°°h²¨]bh°°²]y¨°Ç Ç*]¥¨|b]dh°Ç°yt°Ç ,ÇMh° {¨]²®ÁÇ ¨²hb²yÇ ]dÇ°yt]°Ç*]°´}tÇ mÇ+ºyb]²°Ç Ç+ ¨h°°hdÇ]~¨Ç]dÇt]°h°Ç+b©h²hǾ¥Ç nÇ+khd ° ]bhÇh²¥ÁÇ -Ç+¨]h°¨yttytÇ^dÇu°µytÇ .Ç4hb´¥{b]Çt¯»dtÇ4½y¥h´]Çb´¨°Ç]dÇ /ÇH]²hª]Çu]et°¶¨]thÇ qÇPh ¨]¨ÁÇuh]²Ç 1ÇShuybhÇ°]jh²ÁÇ oÇP¥]jrbÇb´¨Ç 0ÇO{´hǽ°y²«Çh°b¨²ytÇ .ÇLºa{bÇ ¥´hb´yÇ .Ç4¤ºy h´Çtº]¨d°Ç]eÇt¨ºdtÇ 1ÇGy²¨ytÇh¤ºy h²Ç Kbbº ]²y]Çuh]²uÇ oÇ4h¨thbÁÇ¡¬bhdº¥h°Ç pÇ8y¥hÇ ©²hb²yÇ]dÇ ¥h½h´yÇ mÇ9¨Ç]dǾ]Ç hyt°Ç Ç;]]ahÇ]´h¥{]Çu]dyt°²¥]thÇO{²hÇ°]{´]²{Ç YÇ:]Ç¢¥´hb´{Ç ZÇ<º°hhh ytÇ XÇE]ddh¨°Ç]dÇ°b]jld°Ç [ÇGhbu]{b]Çh¤¼y h·Ç ]{´h]bh ¨h ÇbuhÇ °Ç h¥]²yÇ nÇPǨ_bu{tÇ]dÇh¿b`½]´{tÇ ÇFbº²PÇ]tº´Ç 2Ç4h¥t{Ãhd h°°º¥yÃhdÇh¤º{ h´Ç Lh¨°]Ç ¨²hb´y½hÇh¤º h´Ç ÇP°Ç ¾h¨Ç]dÇu]dÇ 5hb²¨yb]Ç£¾h¥Ç{h°Ç nÇThd{tÇ]dÇbº´´ytÇu²Ç¾®Ç K²uh¨Ç "KO=)Ç@IOL6+QAKIO ] >]½hÇÁºÇahhÇy° hb²hdÇaÁÇKO<)ÇyDzuhÇ]±·Ç¸u¨hhÇÁh]¥°% aUh¨hDzuh°hÇ{° h b² °Ç{Ǩh° °hDzÇb ]{´°% b?]½hÇÁºÇahhÇ by´heÇ]°Ç]Ç¥h°º²ÇkÇ´uh°hÇ{° hb³{°% BkÇÁh° Çdh°b¥yahÇ´whÇb{²]²°Ç]deÇ]gdy´{]Ç°xhh²°ÇykÇhch°°]¨ÁÄ#Ç Vh°ÅÇ Vh°ÇJÇ Wh°ÇIÇ Western Allied Corporation Page 192 of 221 . . Item 10 Page 192 of 221 :+90<1,4..0>% 0GIS,VJJLtf|~`V|~ nk~SLO ptfqtn WJLJnk~SLkL~qGRLLGIS?HInk~tGI~ntSnW`aqLvNntfnt^ntaGHntnt tLkJLt|Lv WIL~n~SL-nk~tGI~ntWkntGHn~~SLInk|~tI~VnknN~SLDot^ntVfqtn LfLk~ ntG?HInk~tGI~nt`WILk|LJ Wk~SL?~G~LnN-GaWOntkWGSn kJLt|HInk~tGI~~n~SL-nk~tGInt |qLIWG`aNGHtWIG~L|GkJVk|~Ga`|Gqnv~XnknO~SL Dnt^ntVfqtn LfLk~GIIntJVkR~nJL~GXaLJJtGVkR|Ink~GWkLKWk~SL.uGWkR|GkJ?qLIVNVIG~Vnk| VkGkGfnk~Wk LIL||nNnkLSG`PnOnkLqLtILk~nN~SL-nk~tGI~nt|,G|L,WJ+gnk~0GIS?HInk~tGI~ntf|~SG LGkGI~X LGkJ IttLk~`WILk|L GkJG``tLsV|W~L|qLIXGa~ILu~VNVIG~Wnk| SLk`V|~LJ ,WJJLtf|~qtn VJL~SLNncanVkRVkNntfG~VnkNpt0+-3?HInk~tGI~nt @SLkGfLnO~SL?HInk~tGI~nt& ASL~tGJLGmJ~qLnOnt^~SG~~SL?HInk~tGI~ntWb`qLxNnth' !7nIG~Vnk GJJtL||nN?HInk~tGI~nt|q`GILnOH|VkL||( " ?HInk~tGI~nt|`VILk|LkfHLt)GkJGk|qLI[Ga~`WILk|L|* #?HInk~tGI~nt|qHaWInt_|Ink~tGI~nttLRX|~tG~XnkkfHLt(GkJ $.n`aGt G`LnN~SLEnt^~SG~~SL?HInk~tGI~ntX`aqLtOntf ?H`L~VkRnt|HInk~tGI~WkRnOGkqnx~XnknN~SLFnt^XkLIL||nOnkLSG`NnNnkLqLtILk~nN~SL-nk~tGI~nt|,G|L ,VJ~nTVISkn?HInk~tGI~ntG|JL|VRkG~LJVk~SLntVRWkGb,WJ|SG``nk`HLqLtfV~~LJVkIG|L|nNqHaVILfLtRLkI ntkLIL||W~ GkJ~SLknkaGNLtGNXkJWkRtLJILJ~ntVWkRG|GqHaVItLInvJnO~SL-V~|L~YkROntS~SLNGI~| Ink|~V~~VkR~SLLfLtRLkIntkLIL||W~ 4N~SL-nk~tGI~nt Vn`G~L|GknN~SLGHn Lqwn W|Vnk|~SL-nk~tGI~ntfGHLZkHtLGISnN~SV|-nk~tGI~GkJ~SL-W~ fGLLtIV|L~SLnq~Vnk VkW~|nkJX|ItL~Vnk ~n IGkIL`~SV|-nk~tGI~ nt G||L||~SL-nk~tGI~ntGrLkG`~WkGk Gfnl~kn~fntL~SGk~LkqLtILk~ nN~SLGfnk~nO~SL|HInk~tGI~Vk n` LJGkJ~UV|qLkG`|SGaaHLJLqn|V~LJ Vk~SLNkJn~nNSWIS~SLqtVfL-nk~vGI~V|GGtJLJ 5N~SL-nk~tGI~nuNG\d}~n|qLIWNG?HInk~tGI~ntntVN~SL-nk~tGI~nt|qLIWOVL|fntL~SGknkL?HInk~tGI~ntOnt~SL |GiL~tGJLnt~qLnNDnt^~nHLqL{ntjLJkJLt~SL-nk~tGI~ZkLIL||nNnkLSG`NnQnkLqLtILk~nO~SL-nk~tGI~nt| ,G|L,VJ+fnk~ ~SLk~SL-nk~tGI~ntGRtLL|~SG~SL|SLW|O``sG`VNWLJ~nqLzntf~SG~Dnt^SWf|L`NSLt|LaO GkJ ~SG~SL|SL|SG``qLuNntf~SG~Dnt^SVf|LaOSLt|LaO6NGN~LtGGtJnN-nk~tGI~ ~SL-nk~tGI~nt|HInk~tGI~|Gk|IS Dnt^ ~SL-nk~tGI~ntVaeHL|H]LI~~n~SM|~G~~nyqLkG`~WL| /0?62:+B6<;<1?C,-<:@>+-@<>?1<>9 6?<:@301<78<D2=+20 Western Allied Corporation Page 193 of 221 . . Item 10 Page 193 of 221 >* _+mbkQ*mNTm?*14#>lmRU5Kbm!cc &2m ))6c7NK >m_3**c_m _mL*&*_` Ykmj%C;&m PU=_m E*mN.mh#&NLcT &cNVmF 6@mNLb &bm W ),m L)m kS*m i_4K*_amN& d8OLmK0OXG e9NKmN/m NY<mfNm$*m:&*M_*mNKcT (bNTmN>D Um Ch*mhI$*[m*1:_b\ c9NKm*^NUH*)mhJ$*]m -! :%%.;A-'gZ:'"Bm;/& );*& +;#8;6' 3; ;$40 (5;& ;729;,1";; ; m Western Allied Corporation Page 194 of 221. . Item 10 Page 194 of 221 @NI6kbtEGkt|NEYYbk/ 4? F|O IEbqIt|kbE|? FGkbuEGktPbqYEGIkKNI? FGkbuEGkuYQ|IHONIktQMQcEY5QHIGIqNE NI6OaEGkb|IbkNI| F|Q QkbkKEbkNItqIt|kbE|? FGkbtEGktQbEbkKNIKoZZkObM |O EOkb|. !BNIbNI? FGkbtEGktZQ|IHQbNI5OH EKIuNEObMNEHEtIE|kbEFZIkqqku bOkHk|kKEQZ|kt tIK |I|kIIG IEtQIbGkbtEGKpuNI|GkqIkKCkuX|qIGQLOIHObNI? FGkduEGku|FOHEbH ENIquOGI|qIGOKOIHObNI? FGkbuEGkt|FOHNIbNEtQIbGkbtEGFE|IH qkbNIMIbItEY Iua|GkbHOOkb|7tEQbM|EbH?qIGOKOGEQkb|KktNI>tkUIGktNIIta|kK6kbuEGku|uQIb 5OHO|quI|IbIHkNI? FGkbuEGktFNI6kbuEGku0 %BNIbNIZO|IH? FGkbuEGkuFIGkaI|Ob|kYIbktNI| FUIGkKEektHIuKkttIYOIKOfFEbXt qG1 & BNIbNIYO|IH?FGlgtEGkuK EP^}kuuIK |I|kqIuKkuaNO| NIu| FGkbtEG2 'B IbNIZQ|IH? FGkbuEGktKEOY|ktuIK |I|kaIINIFkbHuIs QuIaIb|kKNI6kbtEGkvE| |IKkuNQh> FYOG6kbtEG6kHI?IGOkb'! ,0 (B IbNI6kbtEGktHIakb|tEI|kNI6ONENIbEaIkKNI? FGkbuEGkuE|YQ|IHE|NI uI| ZkKEbQbEHIuIbGYItQGEYIttkw0 )B IbNIZQ|IH? FGkbuEGktQ|bkYQGIb|IHq t| EbkNI6kbuEGkt|<QGIb|I;E3 *BNIbNI6QHIItaQbI|NENIBktXqIuKkuaIHFNIYQ|IH? FGkbuEGktO|| F|EbQEYZ b|EO|KEGktEbHikRb| F|EbOE[EGGktHEbGIQNNI7uEObM|EbH?rIGOLOGEQkb|ktNENI ? FGkbtEGktQ|| F|EbOEYYHIYEQbMkuHO|t qObMNIqtkMuI||kKNIDktX0 ,BNIbNIYQ|IH? FGkbuEGkuS|ObIYQMQFYIkkuXkbEq FZOGktX|qukVIGq t| Ebk?IGOkb "+++#lt$+++ +kKNI<EFku6kHI0kt - BNIbNI6QHIIuaObI|NENIZQ|I? FGkbtEGktQ|bkEuI|qkb|QFYIGkbtEGku 5>ItaQEb| FGkbuEGkFIkZbEtOZE||OMbIHkwuEb|KIttIHkuEZ`kOkFIqI{ktaIHFEbkbI kNItNEbNIktOMObEY? FGkbuEGku\Q|IHQbNIkuOMObEY5QHQNk NIGkb|IbkKNI6O 6=NIuNEbObNIqIzktaEbGIkKGNEbMIktHIu|GE |ObMGNEbMI|ktHIQEQkb|KtkaNIktQMObEZ 6kbuEG| FZIkt| FGkbuEGEbqktQkjkKNIBktXObIGI||kKkbINEYKkKmbIqItGIbkKNI 6kbuEGku|5E|I5OH4ak bE|kNOGNNO| NIuktOMObEY5QHHOHbkHI|QMbEIE? FGkbtEGkt >uOktkEqqukEYkKNI6kbuEGkt|uIs I|LpuE? FGkbtEGkt| F|Q OkbNI6O|NEZYMQIbkOGIQbtQObMkNI ZO|IH? FGkbtEGktkKNI6kbtEGku|uIs I|k| F|Q IEbHkKNIuIE|kbKkwNItIs I|ANIbkQGIQZYFI |ItIHFGIuQLQIHkuuIMO|ItIHaEOZkNIYE|XbkbEHHtI||kKNI? FGkbt EGku ANIYO|IH? FGkbtEGkwNk NE|FIIb|kbkQKOIH|NEYZNEIKOI ( BkuXQbM7E|QNObNOGNktEb|aQkNI6QtOIbkFVIGQkb|kNI | F|Q Tkb9EQY tIkLOYINI|ItQIbkFWIGOkb||NEYYGkb|O INIYQ|IH? FGkbtEGkt|Gkb|IbkNI| F|Q Okb :KtQIbkFUIGOkb|EuIKOZIHNI6O|NEYZMQIbkQGIObtQObMkKE IE|KQI ( BktXQbM7E|kNIZQ~IH ? FGkbuEGkukKENIEuObMFNI6QkbNI6kbtEGku|uIs I|Kku| F|O Okb ANI6kbuEGkuE|EGkbHQQkbkE||ItObMEG]EOakKQbEHItIbG_JtQGEYItykuObNIYO|QbMkKE? FGkbuEGku|NEYZ ONObk % BktXQbM7E|EKIuNIOaIkKNI5OH7IEHZObIMOIuOIbbkQGIkNI6OEbHGkqOI|kK| GNbkQGI nFkNNI? FGkbtEGkuNI |NIGZEQa|kNEI\O|IHObIutktEbHNIObIbHIH? FGkbuEGktNkNEHFOHkNI 6kbuEGkuqxOkukNI5QH8IEHYQbI Western Allied Corporation Page 195 of 221 . . Item 10 Page 195 of 221 #D88;ZlaB4HIl4Mai;YlbB;l>SIHSiDMAlXf;acESMal4M8laf5LDbliDcBlBEaB;Zl$SMbY46clVZSVSa4K l 1;Z;l5E8l8;VSaEcSZklSZlZ;AEabYkla;ZhD6;alfa;8lEMlS5c4DNEMAlaf56SMcZ46cSZal5E8l>DAfY;alDMlSZ8;YlbSl6SLVfc;lkSfZ 5D8 l 2;al +Sl3 (=lcB;l4Mai;YlcSl+SllEal2;alVH;4a;l=SZi4Y8l4l6SVklS=lbB;l[fH<alS>l;46Bl5E8l8;VSaEbSZklkSflfa;8liDcBlbBEa Xf;abESMM4EY; %D8lkSflB4h;l4MklaSfY6;lS>laf56SMbY46cSYal5E8alScB;ZlcB4Ml5D8l8;VSaEcSYD;a!l ,T '4al4MklV;ZaSMlSYlAYSfVlcBZ;4b;M;9lkSfliEcBlaf56SMbY46bSZl5Sk6Sbbal MDSMl5Sk6Scba lSZlSbB;Yla4M6bESMalbS 4cb;LVblbSl6SMhEM6;lkSflbSlfa;lbB;la;ZhE6;alSZl45E8;l5klbB;lZfI;alS>lSM;lSYlLSY;l5E8l8;VSaEcSZE;a! 2;al+Sl3l )>lbB;l4Mai;ZlbSl-S llEal2;alVI;4a;l;jVI4EMlbB;l=SHJSiDMAl8;c4EIa 4&4b; 5 +4L;lS>lV;YaSMlSYlAYSfV 6*S5lDMhSIh;:lE>l4VVID645H; 8 +4bfZ;lS>lcB;lcBY;4ca ;"88EbESM4Il6SLL;Mba 0a;l488EcDSM4HlV4V;YlD?lM;6;aa4_ 14al4l 6SMa6ESfal;@SZbl L48;lcSlZ;6YfEblSZl VZShE8;l;Xf4Il SVVSZcfMEckl=SZl 5E8al5kl LEMSZDbklSZl VZSF;6bl 4Y;4 af56SOcZ46bSZa!l 2;all +Sl 14al4l7SMa6DSfal;>>SZclL48;lbSl\;6ZfDcl4M8lBEZ;lVZSF;6cl4Y;4lISi;Z EM6SL;lY;aE8;Mca! .I;4a;laf5LDblac4b;L;Mb l 2;all +Sl 1;l8;6H4Z;lfM8;YlV;M4IcklS=lV;ZGf`lcB4clcB;l=UZ;ASEMAlEalbYf;l4M8l6S]Y;6b &4d;8lbBEal !84klS=l !!l! "HIlS=lcB;l45Sh;lab4c;L;Mbal4alcSl;jV;YD;P6; l>DM4M6D4HlXf4IE>D64bESQa l4M8l4h4DI45H;lVI4Mcl4M8l;XfEVL;Mcl4Z;laf5LDec;8l EMl6SMFgM6cESRliDbClbB;lVYSVSa4Il4al4lV4^lbB;Y;S> l4M8lcB;lcYfcB=fIM;aal4M8l466fY46klS=lcB;lEM=SYL4bDSMlEalAf4Y4Mc;;8l 5klcB;l5E88;Zl +4L;lS=l$SLW4Mkl !! ! #k l ! /EbI; l ! Western Allied Corporation Page 196 of 221 . . Item 10 Page 196 of 221 7: L9"¬Ī Ī ĪĪ Ī DĪ Ī ĪĪĪ ĪĪ´ Ī/ĪĪ ĪĪ Ī /ĪĪ VJĪ Īr R Ī#W3ĪýĪãĪĪ Ī jĪ ;Ī Īõ Ī 5 @ĪĪ 7: Ī#EĪ¹PĪ SĪ Ī Ī ĪĪ Ī ĪA ĪĪ í Ī7: Ī#Ī ĪĪĪ ĪĪĪ 10 Ī$Ī Ī 6Ī " Īû Ī Ī ĪA ĪĪĪ Ī ĪĪb¥»¢Īč>?òĪ Ī ĪĪĪ0 ĪĪ5 Ī Ī ĪN ĪĪ ĪçĪ ĪĪ æĪĪ ĪĪ Ī Ī ĪèĪ Ī6Ī ¯(=Þ(2>ăĪüĈ(ó<â<Ø(2<>=U!Ī Ī Ī)Ī þ4Ī Ī s /÷iĪ Ī ĪĪ Ī° t Ī Ī ¦Ī1 øEĪ8 ĉĪHĪĪ ĪOĪ ĪĪĪ4Ī Ī ĪĪ î; Ī Ī6Ī* ĪĪ; Ī5Ī ĪSĪ Ī) ĪĪ ĪĪ R Ī Ī ĪĪĪĪĪéúB3Ī Ī 3Ī ê4Ī ëĪ Ī1 Ī 1FĪùĊ Ī Ī Ī ĪP ĪĪĪ ĪĪĪ Ī ĪĪĪ ċ Ī Ī GĪ NĀ Ī ĪK ĪĪĪĪĪĪ Ī$ Ī ĪĪ ĪĪ Ī / ĪáĪĪ L#Ī Ī Ī ĪĪ Ī Ī ĪĪ Ī2?..ĪcCĪ Q ĪĪĪ ĪĪĪ ĪĪ VJTĪ ĪĪĪ#ĪĪĪ @ WĪ Ī ĪOĪ Ī Ī AìĎĪĪĪ 0 DĪ Ī2.=Ī dC ď.(?UĪ T ĪĪĪ Ī$ G Ī Ī +!ĪMMĪ½Ĕāĕ¸%ÝĖïÃ%ėä đĘuhÄXęĚÕ,Ć,ě`Ĝk,ĝñĪ%%%,Ī Q Ī8Ī¤!Ī ĪÓô±ĪĪÿĞÜĒğ ćÅĪĪÆĪYgvÀÇÈĠZlo¾-ĪÒqö}É&Ī¨\wÔ'Ī®&ß&Č~ Ī+Ī ·ĪġĪ x ĄÛĪĢĪ *y !ąåĪ µ×ÚÖªmĪ eģðf 98 " K*Ī "9©*º Ī) @ Ī Ī)BĪ HF 0 Ī+I Ī ÊĤ[zĥa ÑĪ $Ī !ĪËĪ¡ Ħ¼ĪĪĐ ² ħà'ĪĪÐ'Ī_ ēĨ " Ī§Ī Ī+!Ī pĪ«Ī ]Ī ÙÁĪ " Ī Ī Ī ³IĪÌÍÎĪĩ¿&-{'Ī|&^n-¶Ī'Ī£- ĪĪÏ $ ĪĪ#Ī Ă Ī "" " " "" " " " !" Western Allied Corporation Page 197 of 221 . . Item 10 Page 197 of 221 Alh_QOt>NeQ)7 E&9 C5 2PPmQqq* & 4 4 4$4nZ04 8NrQ4heibQrQP*F BQTQlQgOQ4hgrNOt>NeQ+ BQUQmQfOQ4hgsNOtA[hgQ?h- 8QqOl]ir^hghT{hmaiQmThleQP,HIIIJKKKKKKKKLM " Alh_QOt?NeQ+ @ % 2PPoQqq-( 4 -14 8NrQ4heicQrQP* | BQTQlQgOQ 4hgrNOt?NeQ. SG 4 BQVQlQgOQ 4hgrNOtA[hgQ?h- ( 8QqOm^ir^hg hT{hmaiQlUhmeQP* z:=y\;x6 ju R ' }v #Alh`QOt?NeQ- 2PPmQqq/ 8NtQ4heicQrQP*d~! BQTQlQgOQ 4hgwNOt>NeQ0D 3 BQVQpQgOQ 4hgtNOrA[hgQ>h1 8QqOl]ir^hghW{hmaiQlYhleQP+ kX< 4 )44$."4 4!4 244%#4+44/ *4 4,3'4 Western Allied Corporation Page 198 of 221 . . Item 10 Page 198 of 221 ;>+=/~80~.+5408:64+~ .8A6>C~81~ ] * < ~ ,IW|~rr~ ~ EJQbO~NRkrs~HuXz~rxfmb ~HJhfrJr~DbH~rDzr& >PDs~PJrPJ~Rr~tPJ }~QtXJ~fK~fNKRFJ~QL~D~FflifmDtRfb ~rfXJ~fxbJm ~9DlsbJl fl~fsPJl~hmfjJm~tQsXJ ~fM~^~ n~PJmJQaDNtJm~FDYXJH~.fbsmDFtfl xPf~PDr~ruE_RttJH~tf~sPJ~.Qsz~fK~BJmbfb~D~-QH~Nfl~sPJ~FfbrsmuFsQfb~fN~tPJ~.Rtz~2DXY~3B+.~;zrtJ_ 4_jlfwJ_Jbtr ~.fbsmDFt~7f~ ! $%~' >PDt~rDQH~-RH~Rr~OJcuQbJ(~sPDs~tPJ~rD_J~Qr~bfs~rPD_'~tPDs~DXX~rsDtJ_Jbsr~fK~NDFs~tPJlJQb~DlJ~tmuJ' >PDt~rDQH~-RH~Rr~bfs~_DHJ~Qb~tPJ~QbtJmJrs~fm~EJPDXK~fK~Dbz~hJlrfb ~hDltbJlrPQh ~Ff_jDbz ~DrrfFRDsRfb flODbQ{DsRfb~fl~FfljflDtRfb~bft~bD_JH~fm~HQrGYfrJH) !?PDt~.fbsmDFtfm~HQH~bft ~HRmJFsXz~fl~QbHQmJFtYz~QbHuFJ ~rfXQFQs ~DOlJJ ~FfYXuHJ ~FfbrhRmJ~fl~FfbtlQwJ~xQsP DbzfbJ~JYrJ~sf~ruE_Qs~D~NDZrJ~fq~rPD`~EQH ~tf~qJNlDQb~Nlf_~ERHHQbO ~fm~xQtPHlDx~PQrPJl~ERH~sf~lDQrJ~fm~NRy sPJ~-QH~jmRFJ~fK~.fbsmDFtfl~fl~fN~DbzfbJ~JXrJ ~fm~tf~mDRrJ~fo~KQy~Dbz~fwJlPJDH~jlfNQs ~fm~Ffrs~JXJ_Jbs~fN .fbslDFsflr~jmQFJ~fl~tPJ~hmQFJ~fN~DbzfbJ~JYrJ)~DbH~HQH~bft~DttJ_js~tf~QbHuFJ~DFtRfb~hmJUuHQFRDX~sf~tPJ RbtJmJrtr~fK~tPJ~.Stz~fN~BJlbfb~fm~fK~Dbz~ftPJl~-Q~HJl ~fm~DbzfbJ~JXrJ~RbtJlJrsJH~Qb~sPJ~hlfhfrJH~.fbtlDFs' "@PDs~sPJ~.fbslDFsfm~PDr~bft~Rb~Dbz~_DbbJm~rfuOPt~Ez~FfY[urQfb~sf~rJFulJ~Ngl~PR_rJXN~Dd~DHwDbtDOJ~fwJm Dbz~ftPJl~-RHHJlr~fl~RbHuFJ~DFtRfb~jlJVuHQFQD\~tf~sPJ~QbtJlJrtr~fN~sPJ~.Qsz~fK~BJmbfb~fm~fK~Dbz~ftPJl~-QHHJm fl~DbzfbJ~JXrJ~QbtJmJrsJH~Rb~tPJ~hlfhfrJH~.fbslDFt) #>PDs~sPJ~.fbtmDFsfm~PDr~bft~DFFJjsJH~Dbz~ERH~Nlf_~Dbz~;uEFfbtmDFtfm~fl~_DsJmQDY~rujhXQJm~sPmfuOP~Dbz EQH~HJhfrRtfmz ~ sPJ~EzXDxr ~ lvXJr~ fm~ mJOuXDtRfbr~ fK~xPQFP~ hqfPQEQt~ fl~hpJwJbt~tPJ~ .fbsmDFsfm~ Nlf_ FfbrRHJmQbO~Dez~ERH~Nqf_~Dbz~;uEFfbslDFsfm~fl~_DsJqQDX~rujjYTJl ~xPRFP~Qr~bft~jlfFJrrJH~tPmfuOP~rDRH~ERH HJhfrQsflz~fl~xPRFP~hmJwJbs~Dbz~;uEFfbslDFsfl~fl~_DsJmRDX~rujhXRJl~Klf_~ERHHRbO~sf~Dbz~.fbtlDFtfl~xPf HfJr~bft~urJ~tPJ~NDFQYQsRJr~fN~fl~DFFJht~ERHr~Kmf_~fl~sPmfuOP~ruFP~ERH~HJjfrRsfmz' Western Allied Corporation Page 199 of 221 . . Item 10 Page 199 of 221 !2'GVG3-V@>GB')G@CV,5,V>@GV ,5B-)G;PV@DV5>,6D-)G:PVFK(=5GVG3-V@>GE')G@BFV6,VAD5)-V@BV'>PV(B-'9,@N> G3-B-@/V@BVG3-V)@>G->GFVG3-D-@/V@DV,5ML:1-V 6>/@D='G6@>V@DV,'G'VB-:'G6M-VG3-D-G@V H@V'>PV)@BA@B'G7@? A'DG>-BF35AV)@=A'>P V'FF@)5'G6@> V@D1'>5Q'G5@> V(6,V,-A@F6G@BP V@DVG@V'>PV=-=(-BV@DV'1->GVG3-B-@/ V@B G@V'>PV5>,6M6,K':V@DV1D@KAV@/V5>,5M5,K':F V-O)-AGVG@VG3-V5GPV@/V#-D>@> V@DVG@V'>PVA-BF@>V@BVA-DF@>FVN3@ 3'M-VA'BG>-BF35AV@BV @G3-BV/5>'>)5':V5>G-D-FGVN5G3VF'6,V@>GD')G@DV6>V45F3-DV(KF5>-FF V,-):'B-VL>,-BVA->':GPV@/VA-D8LBPVL>,-DVG3-V:'NFV@/VG3-V G'G-V@/V':5/@B>5'VG3'GVG3-V/@B-1@5>1V6FVGBL-V'>,V)@DD-)GV 'G.,VG35FV% & ,'PV@/V *IRV V 'GV JV 0V @>G3$-'BV 5GPV G'G-V @>GB')G@BV :-'F-V D6>GV SV T< +>GB')GU. V "5G;-V Western Allied Corporation Page 200 of 221 . . Item 10 Page 200 of 221 Western Allied Corporation Page 201 of 221 . . Item 10 Page 201 of 221 åƈ$+2A #ƈ+#i 8õ ƈ 3,9ƈ ĉ>#Iƈ ƈCgj:9 ƈ8Löƈ3Ă#ƈ ô,ïþƈé+#ƈà :3ƈ K÷2ƈ Bƈ$C2A ƈ3j#ƈ#i$3 ÿƈBCgƈ : á+ 9 ƈD+BƈĀBƈ$ 2ƈâ 3#Wƈ +Vƈ ƈ ʼn ;ƈ >,ƈ'ĸƈƈŶIƈ ŧřƈ ;Vƈ ƈ ƈ ƈƈ ƈ {ƈ ØƈĹ"ƈħSƈ î ƈŴ"ƈ ƈC ƈ 5 ńƈ ƈ ƈ$ ;ƈ2 ƈƈ'ƈ {ƈ2ŰXƈ ƈ ƈ ƈƈ ĄŢ=ƈ ī ƈ "!ƈĨƈ F )ƈ ƈ =ƈ r ƈ 'Ĭƈ/ ķ¢ƈ êƈ" uƈƈ°" sƈĜ ť|=ƈ>Æ\ƈFGƈė ƈ )Gƈ) ƈ`Ŋ ū ƈƈĭġƈĝƈ ƈ z|Uƈ"Ś±ƈĞz ƈ ƈ Ÿƈ" )'ƈŵ ƈ4~ ƈ ƈ =Ŀ 4ŋ;ƈƈRƈ ţƈ ƈs ƈƈ) ƈ ƈŅƈ ƈ ĺƂƈxƈƈpƈ} ƈë !Fƈ 5 ņWƈ k%%Źƈc(Ģƈd67Ťnƈ@EQźƈa¿ø¸&ƈ ƈƈ ƈ`y ƈ æăÜƈìŌŬęŦĒŭ.%ƈí67(ĔƈM(1ĮN6ƈ ōŨűƈK;ƈ ƈH,RŎƈ J Ä? ÅÊ?ƈ bƈ M1(ƈ&ƈ&%ĶEœ1ƈ ĕƈKOƈƈ >Oŏ) !ƈČčƈ¯ÁXĎ ďĐƈ¹ƆƈđƈÂƈ£ƈlmƈƄ-ºð-¤ƈ-ƅ-·-²¥Ã-Ƈ-¶lm Ï ƈ@śQ(*ƈfŒ.*ƈÐ ƈ @7%10ƈ .*Żƈ &ƈ Ö [? ƈ 8ĘRƈ ?J ÎÑÔ³_Ò] y'ƈŲƈ ąũ*(ƈ&ŀŁ.oƈÝ(Ŕ0*.ƈ ƈŐ ƈƈ }ƃƈ #ƈ Ċ/ƈ ƈ 610Y%PE1Ûĩ7ēP*(*P%»Nwƈ <ƈ9 ƈ J[ ]Óƈä%0Ėƈ&1Y¦ƈý*ƈãƈMQ(.ģ6§ƈ@&ƈ× ^_ ƈ ƈ#/ q 4ƈ Ŝƈ !# # # # # #"# # # b ƈ ƈ"ŝ ƈĆ ƈ,!S ¨ƈƈ$ƈA ©ƈD ƈ:5ų ªƈ!ƈ ƈ/ ¼ƈ k%%żƈc0ĤƈdŪ70nƈÞEŕŽƈ !ƈLŞ<ƈñĻį ƈ &Ň0İNƈß67ļ*žƈawŖſƈğƈûo.ĥƈf&ƈ DGtUƈ / ƈò ŮTƈ ƀƈćıvłƈ, G ƈ,ĽIJƁ«ƈijrƈşŘ 4ƈ $ ƈ tƈ āĪĚƈ $ ! $" 8 ƈe ƈ $ $ ! $#$ ,< ƈó v ) ƈ ƈ ƈ 8 Ùƈ#ƈ+ƈ !ƈ:5 !ƈĈç $ ƈÍƈƈ ƈ ƈƈ ƈ 5 ƈƈ O ù<~ů Fƈe ƈ ½ċ ƈh ƈhèƈ A D ƈZƈ9LÚƈ pƈ ƈ ƈŠƈ ƈ ƈ )šƈ ň ƈƈ ƈ ƈƈƈ Tƈ ŗ< ƈ"'ƈ ƈ+ ƈü5 4=¬ƈZƈqƈ ƈ !ƈ Ńƈƈ ƈ ƈ!ƈ"'ƈ ƈÇ\´ ƈƈuĴ ƈ 'ƈ ƈxT¾ƈHÈ¡ƈ ƈ)'ƈ !ƈ$ƈµ /4S®ƈƈHËIƈ"ƈ ƈ ő!ƈƈ ƈŷƈ"ƈ!/ĵľƈ $ Àƈ Western Allied Corporation Page 202 of 221 . . Item 10 Page 202 of 221 >ÇØç°wç_t»§°§ç '& (çYi¨ÅiçGtç:Ót§Îtç _t»§°© ç>;ç. (-ç &#& )-&--!! btlÂÅt/ç ÕÕÕoͱwÔu»¨°§°»}ç 35% ' ;;!!% 9&5;,!;/7(;..,157+&6:;).(,:) +5;; ,+4 #0 #6&,+;,1*; ; 05& ( ;; + ,2;&45;8 46%,++%2 ;,0)4; ;; ; Iªç°»qt¼çÅ°çmuç ¶intrçÆ°çÅuç>ÇØÂçÔt§q°½ç ÃÅçj§qçltçt~ltçÇ°ç¾totÓtç >ÅØçlÏ«t ç رÎç¤ÐÂÅç ¶»°ÓqtçÅtç w°°Õ§~ç «w°¼¤iÅ°§çu×nt¶Åç Õt»tç¨qniÅtqç iÂ粶ۧi ç =ØçÂÑm¥Çŧ~ç ÅÂçw´»¤ç رÎç i¼tç qtpi»¨~ç Ѭqt¼ç¶t§iÉØç°wç¶t¾Ï»Øçѧqt»çÅtçiÕÂç³xç ÈtçYÈiÅtç°wç >iz°¼§içi¬qçÇvçiÕÂç °wçÅtç ^¨ÅtqçYÅiÇtÂçÅiÅç Åtç §w°»¤iÅ°§çÂçɾÎtçi§qçn°¾½tnÆç GλÆt¾¤°»t ç Ù°Îç i»tçnt»Å|¨~çÅiÅç رλçw¾¤ç Õçiqt»tçÇ°çtºÏiç °··°¼ÇΧÅØçt¤¶²Ø¦t§Å綻inÇntÂçŲç iÂÂѼtçÉiÅçi¶¸ni§ÅÂçi¨qç t¤¶°ØttÂçk¾tç §°Åç qÂp»¤§iÅtqç i~i§ÂÅç ltoiÒÂuç°wç Åt¾ç½int ç ¾t~° ç n°¡°½ ç §kÅ°§iç°¾§ ç i¬nvÂÆ»Ø ç qÂilÉØ çÂt×ç°»çi~tç :§q çØ°Ñ»çw¿¦çq°tÂç ¨°Åçi§sçÕç §°Åç¤i«Åi§ç°»ç¶½°Óqtç w°¼ç ÉÂç t¤¶°ÙtuÂç i¨Øç Ât~¼t~iÅtqç wioÅtÂçiÅçi¨Øç°wçÅÂçtÂÉil¤t§Å çi§qçÈiÅçÅç q°tÃç ¨±Ççj§qçÕ称Åç ·t»¤ÅçÅÂçt¥¶²ØttÂçÅ°ç·t»x°¾¤çÅtÀçÂt»ÔotÃçiÅçi®Øç°niÆ°¯çѨqt»çÅÃçn°®Å»° çÕt»tçÂt~¾t~iÊtqç winÅvÃç i»tç ¤i§Åj§tsç Ri¤tç±wç A°¤¶i®Ø0ç Ý+*NÁç {Þß9 ç =ΧuÂÂç\ut¶ °¨t0ç `ç J :qq¼tÂÂ/ç ÚCç"ç ¢ç Ìà?çáç açâçÜ >ÅØ1ç 7µyãç äç YÅiÅv2@<c¶ç >±¨ÊinÅçVt»Â°§ç £dç Bç F¤içKç :qr¾tÂÂç Mç åçç6P[ç5ç8 ç, æç °¹Æ°§i \i×ç LEçRΤlt¼ç °¼ç Z°njçYunλÇØçRÒ¤mt½ ç Û$3%ç Xt¤Åç:qq¼tÂÂçwçqwwt»t¨É ç WtiÂuç ÂÅiÅtçnti»Øçi§qç n°§nÂtØçÅtçO¶t ç°wç~°°qÄç i§qç Ât¾ÓntÂçذϽço°¤¶i§Øç ¶»°ÓstÂ4ç ]tçw°°Õ¨çÂtoÉ°§çÂçTW]IUS:Qçi¨qçÂçx°¾çÂÅiÉÂÇnjç¾t¶°¼É¬~ç¶Ð¾¶°ÂtÃç °§Øç TÖ®t»Â·ç ¶tiÂtçntnçi¡ç ËiÅçi¶¶Ø 0ç :w»ni§:¤t»nj§efç :Âi«ç ;»¤t§i§ghç H¶i§nghç RiÅÔtç:¤u»ni§çghç DÃiltqghç Gt¤itçghç Western Allied Corporation Page 203 of 221 . . Item 10 Page 203 of 221 JoZW¯QrcWZ¯NgugUg¯6|¯D& ¯Leg¯c}¯g¯¯VZ¯gWuYZY¯g¯Uuu¯VgY¯YW}Z¯]¯ pZW¯gugd¯uUV¯¯ZgWZ¯UuZY¯U¯&("""¯¯}Z¯7Wg)¯JuZUZ¯gYhWUZ¯eZ¯pV¯guZ!WuUg]mWUg¯¯VZ¯ZY¯g¯eZ¯ Z]}UWZ¯]¯eg¯WUW¯euY¯i¯VZ¯UUYZY¯¯¯]i}¯ JuZUZ¯gYgWUZ¯eZ¯}VZ¯^¯Z} uZZ¯g¯ZUWe¯qV¯WvUg_gWUg¯U¯Zuy¯U¯eZ¯}VZ¯_¯Z¯egZ¯g^¯U¯U¯U¯Zu¯]¯eg¯WUW¯FU}Z¯]¯3~ U¡¯?wfRK ¯ `<¯ ¯ '2¯JpZW¢¯O[T G¯ 48£¯S,@A¯ ¤¯¥¯ 9¯{¯ ¦§ $¯¯=V¯LguZ!3uUgbWUg¯5g}UZY¯}VZ¯]¯Zggd¯U]a¯¯VZ¯Z} xZY¯g¯5g}UZY¯}VZ¯]¯Z¯egZ¯¯VZ¯Z} uZY¯g¯eg¯WuUg]gWUg¯g]¯UUYZY¯eZ¯WUW¯eg¯WuUg]jWUj¯g]¯UUYZY¯eZ¯WUW¯¨¯©¯¯ ª¯X¯;¯HE-n¯«s¯¯\M¯z1¯ ./¯¬*>BC%#¯ ¯ ¯ t¯®¯I¯ k¯ ¯ 0Z¯U¯WZ¯Z} uZZ¯¯ ZgUu¯Z¯elZ¯PZ¯ZgYZ+¯:]¯¯e¯}U+¯Western Allied Corporation Page 204 of 221. . Item 10 Page 204 of 221 Western Allied Corporation Page 205 of 221 . . Item 10 Page 205 of 221 Western Allied Corporation Page 206 of 221 . . Item 10 Page 206 of 221 3JMnejcVC?q?cbnSnqncFiDguDorNbHfmdfdp;XprdfDiGdi_rKDADpNHb=vPXA;iDridGNsfdirOdbdG;b DzPprPbH&7 @dbridXp;r Nr|dG7Dibdb Qr|';XX \ !cbqjcYn0CqjcFSq < 4LC:cbCnnCjxCB>}qJC4j<bCXbqCYYRe<?jccFqce !wbSq<nyCZY<nqJC wbSqRqnCYFSn<bc>ncYCqCxCjnScbcF4j<bC4j<?WCj1c`C<jC<ncFqJCF<?SYRq} L<xCjC?CbqY}>CCbweB<qCBqc<)-, !bCq+wYqRejcqc?cYn}nqC`4JSn ejcVC?qyRYYC{e<bBqLC)-, !bCq+w[qRejcqc?cn}nqC`qcSb?cjecj<qC qJCFcYYcySbI S4j<bC19(%!2jccFqcee<?W<ICBwbRqcbqJCC<nqCbBcFqLC >wSYBSbI ] bCy(.8<jS<>YC%jChwCb?}"jSxC nJ<ZY>CejcxSBCB<bBSbnq<Y[CBC{qCjb<ZqcqJC046Rb< ,$+ 0Cb?YcnwkC nJ<FqIjcwbBSbIBCxS?CnL<YY>C<BBCB qcqJCC{SnqSbInweeY}F<b`cqcj<bBqLCC{SnqSbISbZCqIwSBC x<bCnnJ<YY>CYc?WCBSbqJCFwYY}ceCbecnSqScb ^YjCYCx<bqecSbqnFcjCb<>YSbI<bB?cbqjcYYSbIqJC046 nJ<YY>C>jcwIJqSbqcqLC +1 ] -wqnSBC Sl4C`eCj<qwjC 0Cqwjb Sj5C`eCj<qwjC +T{CB Sj5C`eCj<qwlC 1weeY} Rj4C`eCj<qwjC wSYBUbI1q<qR?/jCnnwjC 1weeY}%<b+cqcj1q<qwn 1weeY}%<b8%#1q<qwn 1weeY}%<b`cqcj<`eBj<y 1weeY}%<b8%#F<wYq 1weeY}%<b8%#neCCB 0CYSCF%<b1q<qwn !c`ejCnncj1q<qwn (S1q<tT?1ySq?J 0ccFqce6bRq Y<ja SS8 8~cbEnnCjxCB>}qJC5j<bC046<>cxC 1e<?CqC`eCj<qwjC *C<xSbI<SlqC`eCj<qwjCyLCjCJC<qTbISnejCnCbq SjFYcy SjFYcynCqecRbq #<`eCjecnSqRcb Western Allied Corporation Page 207 of 221 . . Item 10 Page 207 of 221 (.($DJF$6F(J?>C0D1>= 011 ".(JA>>)D>?J%>17(AJ?8$=DJG.1&.J1CJ$'4$&(=DJD>JD.(J"A$=(J #! >08(AJ(=$%8( >08(AJCD$DEC >DJG$D(AJCE??8IJJA(DEA=JD(<?(A$DEA( % ".(J<E8D1?A>D>&>9JCICD(<JC.$98J1=D(-A$D(JC($<8(CC8IJG1D.JD.(JA(&(=D8I 2=CD$88('JJCICD(<JC(AF1=-JD.(J1DIJ $68J%$C(<(=DJ>E=&08J.$<%(ACJ$=' J1C?$D&. 1 =IJ%A$='J>*J(@E0?<(=DJ<$IJ%(JEC('J$CJ8>=-J$CJ2DJ1CJ<E8D1?A>D>&>9 &><?$D1%6( 11 $ADCJ<ECDJ%(J$F$28$%8(J>=JD.(J>?(=J<$A5(D 111 E??>BDJ<ECDJ%(J$F$18$%8(J*A><J$=IJ<E:D1?A>D>&>8J&(AD1*1(' &>=DA$&D>AJG1D.>EDJA(-$A'JD>J<$=E*$&DEA(AJ'($8(AJ$+*181$D0>=C & >=DA$&D>BJC.$98J?B>F0'(J$88J=(&(CC$AIJ&$%81=-J*>AJD.(J1=CD$88$D1>=J>+JD.( =(GJCICD(< J>='E1DJC.$88J%(J?A>F1'('JG(A(J(H?>C('JD>JF1(GJ>AJ>ED'>>AC ' " J%$&5%>=(JG288J=>DJ%(J$88>G(' 4B *:*54B:5B:) B 5= B9 56 B5"B>58-B:) B *:@B)9B + B:5B.95 54= 8:B//B8 2+4+4(B64 ;2:+ B4 B / :8* B:+2 B /5 -BB B 54:85/9 +4B:) B *:@B0/ B ;*/ +4(B:5B +(*:/ B /.B4 >B 54:85/9B>*//B3: )B:) 96 +$+ :+54B45: B) 8 +4B4 B2: )B4 B B+4: (8: B>+:)B:) B ?+9:*4( +(+:.B 54:85/9B*4B:) B ;*/ +4( B)*9B 54= 89*54B*4 .; 9B1.B64 ;2:* 54:85/9B9 8=*4(B:) B:)8 B*8B)4 .+4(B;4*:9BB8 :;84B%49B+4B:) 6 4:)5;9 B9B> //B9B..B:) BA54 B 54:85/9 B )B64 ;2:+ BA54 9 549:4:B=5/;2 B2*?*4(B 5?B9)./B B 54= 8: B:5B *(*:/B 54:85/9B>+:) 26 8B +:+549 25 *$+ :+549B:5B+4+:+/.@B B 549:4:B=5.;3 B ;:B>+:) ./B 26 89B4 B 54:85.9B*4B6/ B:5B B 54= 8: B @B685(832*4( 25 +$+ :+54B54.@B:5B=8+ / B=5.;2 B BB56 8:+54B:B952 B65+4:B+4 :) B#;:;8 B *8B8 *4(9B9B8 7;*8 B:5B /* 8: B:) B 2*?*4(B 5?B $.5> 54:8509B4 B /4 B:5B:) B6.4B "2B'8B )B 5?B8 B+4 /; B+4B:)*9 9 56 B5"B>58- B /4 +4(B5"B9;66/@B *#";9 89B+9B45:B*4 /; B*4B:)*9B9 56 5"B>58- B /.B9 49589B>+.0B685=+ B +(+:0B: 26 8:;8 B8 *4(B4 B +/*:@ 5"B:) B96 B5 ;64:B:5B8*9 B58B.5> 8B:) B8552B: 26 8:;8 B>*:)*4 ,;9: 0!B.+2+:9 B) B+:@B>*.0B685=* B66 8B2 )4+ /B6.49 B)+9 9 56 B5"B>58-B*4 .; 9B";.0B4 >B&5586.4B(86)+ 9B4 B"<//B 9+(4:+54B 6 8'824 B5"B )BA54 B/ 9 B45: B:):B:) B ?*9:*4(B*8B 5268 9958 /95B+9B;9 B'8B454B B#;4 :+549B4 B*9B:5B8 2*4 B) B 566 8 64 ;2:+ B/+4 9B9 8=+4(B:) BB B9@9: 2B>+./B B 66 B5#"B:B65*4:9 9*(4: B @B:) B+:@B4 B0/B ?*9:*4(B 566 8B.+4 9B8 B:5B B/ ":B+4B6/ '8B";:;8 B *:@B 25BB8 ;9 ".(JD(&/=1&$8JC?(&0+0&$D1>=CJ&>=DA$&D>AJ@E$82,3&$D1>=CJ$='JA(*(A(=&(CJA(@E1A('J$A(J$=J1=D(-A$8J ?$BDJ>*JD.(JC&>?(J$='JG188J%(J$J&A0D1&$;J$C?(&DJD>JD.(J(F$8E$D1>=J>+JD.(J?A>?>C$6CJA(&(1F(' J A>?>C$8CJD.$DJ'>J=>DJ&><?8IJG1D.JD.(JA(@E1A('JD(&.=1&$8JC?(&1*1&$D1>=JA(*(A(=&(CJ>AJ @E$81*1&$D1>=JG188J%(J'1C@E$80+1('J$='J'((<('J=>=A(C?>=C1F( J Western Allied Corporation Page 208 of 221 . . Item 10 Page 208 of 221 GTE/LNY/EP/LHL5N/YH/LNGEE/>YPGY/ENQL/YNUNP/CY0QE-P5GE+>5PU Y/P+5?NYG0Y P3/Y/EP/LHL5N/Y+E.Y.+P+YE/PTGL<YL/KQ5L/C/EPNY+L/Y./05E/.Y6EY+YN/H+L+P/Y N/-P5GEYG0YP45NYNH/- Y ( /PTGL=Y"/>5+,7@5P ( #/-QL5PV 5 !LGS5./Y+Y-GCHL/4/EN6S/Y+E+>UN5NYG0Y+>>Y-GEPLG>YE/PTGL<5E2Y-+H+,5?5P5/N N4GT5E2YP4+PY+>?Y-GCCQE5-+P5GEY5OY8EY+--/HP+,>/YM+E2/N Y!LGS5./Y+ E/PTGL<Y+E+YUN5NYNQCC+MUY0GLY/+-4Y-4+EE/>Y0GLY+YPUH5-+>YY4GQLYH/L5G. .QL5E2YNUNP/CY0Q>>YGH/M+P5GEYN4GT5F2YP4+PY+>>Y-GCCQE6-+P5GEY5NYT5P45E +--/HP+,>/Y?5C5PNY+E.YP4+PYP4/L/Y+L/YEGYE/PTGL<YN5W6E2Y5NNQ/NY./S5-/ -GCCQE5-+P5GEY5NNQ/NYT6L7E2Y7NNQ/NY GLY,+E.T5.P4Y5NNQ/N 57 />5S/LY+Y0Q>?UY>9-/EN/.YE/PTGL<Y+E+>UN5NYPGG>Y+NYH+LPYG0YP4/YNUNP/CYT7P4 -GCH>/P/.Y.G-QC/EP+P5GEY+E.Y./CGENPL+P5GEYGEY5PNYQN/ 5%4/YNUNP/CYN4+>>Y/CH>GUY+Y4524Y./2L//YG0YE/PTGM<YN/-QM5PUY5EYGL./LYPG HL/S/EPY P+CH/L5E2 77GEPLG>Y /PTGL< 577 +-4Y-GEPMG>>/LYGEYP4/Y-GEPLG>YE/PTGL<YN4+@AY5E-GLHGL+P/Y+YE/PTGL< N/-QL5PUY+>2GL5P4CY+PYP4/YHLGPG-G>Y>+U/MNYNQ-4Y+NYC/NN+2/Y+QP4/EP5-+P5GE GLYC/NN+2/Y/E-LUHP5GE 5S /S5-/NYT5P4Y4524Y./2L//YG0YN/-RL5PUYN4+?>Y4+S/YP4/YGHP5GEYPGY4+S/YP4/5L N/-QL6PUY0/+PQM/Y/E+,>/. Y P4/LY./S5-/NYN4+>>Y4+S/YP4/YGHP6GEYPGYPQLEYG00 P4/:LYN/-QL5PUYHLG-/NNY5EYGL./LYPGY5CHLGS/YNUNP/CYH/L0GLC+E-/ S%4/YNUNP/CY./P+7?/.YHG5EPNY?5NPYN4+>>Y./05E/YT45-4YE/PTGL< -GCDQE5-+P5GEY/?/C/EPNYN4+>>Y/CH>GUYP4/Y-GCCQE5-+P5GEYN/-QL6PU S5 +P+Y /PTGM< S55%4/Y.+P+YE/PTGL<YN4+>>Y0G>>GTYNP+E.+L.YP4/LE/PY&!!YN/-QM5PUYHLGPG-G> GHP6GENYNQ-4Y+NY05L/T+>>NY $Y'%!#Y N/-QL/YNG-</PY>+U/LY+E.YCGM/ "/0/LYPGYP4/Y.+P+YE/PTGL<YM/KQ5L/C/EPN * )+LM+EPV * #QIJGLP '4/Y-GEPL+-PGLYN4+B>YHLGS5./Y+Y0Q>>Y+E.Y-GCH>/P/YNUNP/CYT+ML+EPUYEGEX HLGL+P/.YH+LPNYY>+,GLY0GLY+YH/L5G.YG0YGE/Y YU/+LY-GCC/E-5E2Y+0P/L 05E+>YHLG;/-PYN52EYG10 GEPM+-PGLYT+LL+EPUYN4+>>YHLGS5./Y0Q?>YNUNP/CY0QE-P5GE+>5PU YH+MPN L/H>+-/C/EPY>+,GL YNG0PT+L/Y+E.Y4+L.T+L/YQH2L+./NYE/-/NN+LUY5EYPG /ENQL/Y0Q>>YNUNP/CY0QE-P7GE+>6PUY.QL5E2YP4/YT+LL+EPUYH/L5G. Western Allied Corporation Page 209 of 221 . . Item 10 Page 209 of 221 / GFOJ OGJXN,99XHJGR. X $P99X O : H,GF X NPHHGJOX$GJX O, X SKJFOUXH J.G S.O,GQOX /O/GF9X GNO JR. /9.OV J/F/F* ., X GFOJ OGJXN,99XHJGR. XX%Q99UXN JR/ 9 X NUNO DXS.O,X GDH9 O NNXOGX99XNUNO DX GDHGF FONX GFOKG99 KNXN FNGJNX OQOGKNXHF 9N S.J/F)X7QF O.GFX GT NX 99X 9 D FONXG$X O, XNUNO DXDPNOX X NN. 9 X U D0FO FF XNO$$ 11FNPJ X;9X .F ONX F 9GNPJ NXF X.FNO9<O/GFNXJ X NN. 9 XS/O,GPO ,.F JF XJGR. X99X .F OX8 UNXS.O,X 9 JX.F . O/GFNXOGXO, /K 9G O.GF ...GX GFOJ OGJXGJXR F GJXHJGHJ. OKUXN JR. XOGG:NXS/9BX X99GS X 9: N JR. XOGG=NXN,C9X X/F @P XNXHJOXG$XO,.NX . J/F.F)XN,99X XHJGR. XGFXO, X$P>9XGH JO.GFXG$XO, X GFOJG9XNUNO D J/F.F)XN,99X !X HJGR1 X $GJX99XF OSGJ8X DF) D FOX GDD1NN.GF.F) OGG9NXF XF OSGJ8X .)FGNO. XF XF:UN.NXOGG9N 99X J/F.F)XN,99X XHJGR. XGFXO, XNUNO DXJ ,/O OPJ X N/ XHJGOG G9 H 2>.O. NXF XN JR. .F)XG$XO, XNUNO D J.F.F)XN,99X XHJGR. XGFX9:X R1 X GF$.)QJO3GFXF XHJG)JDD.F) OGG:N FO +JOGJXQ9/%/ O/GFN ., XF OSGJ8XNUNO DX.FO )JOGJXN,99X "X JO.'. XUNO DXFO )JOGJ GJ /F)XOGXHQ :/N, XHJG$. 5 F UXJ#IP.J D FONXF X.F QNOLWX NO HJ O6 NX FO )MO.GFX GFOJ OGJXN,99XHJGR. XX GHUXG$XO, .J J FO.9N ./ , XF OSGJ8X NUNO DX 4FO )JOGJXN,99X DH9GUXOX> NOXOSGX JO.$/ JG$ NN.GF:NXJGR/ XO, X J FO.9NXG$XOX9 NOXOSGX DH9GU NXS,GXS/:9 XJ NHGFN. 9 X$GJXO-.NXHJG7 OXJ FO.9NXN,?9X DGFNOJO X.F QNOJU NOXHJ O. NX$GJXHJG$. . F UX.FXO, X GJ XF OSGJ8.F)XO ,FG9G)UXHJGR. F XN,99X XQHXOGX O ../JGR. XOJ.F.F)X JO.$. O NX$JGDX8 UXH JNGFF 9XJ NHGFN1 9 X$GJXO,1N HJG7 OXN,GS/F)X 9NNXO8 FXF X GDH9 O.GFX O .R JGR. XHJG$ NN.GF9XJ NQD NX$GJX:9X8 UXH JNGFF 9XK NHGFN. 9 X$GJXO,.N HJG7 O RJGR. XOX: NOXOSGXN.D.9JXHJ/GJX7G X TDH9 NX DGFNOJO.F)X GEH O FOX9 R >XG$X8FGS9 ) XHJG$/ 1 F UXF X TH J. F R/FO )JOGJXN,9AX X&Q@9UXA. FN XOGXH J(GJDXO, X.FO F XSGJ8X JGR. X GHUXG$XFUXF X::XJ > RFOX GFOJ OGKX9. FN N Western Allied Corporation Page 210 of 221 . . Item 10 Page 210 of 221 <-: 5º¢¨R¿+°I¦o=~n¦» r&R}r´R¿=¿X°}}¼¿]°I¦rnb¿NS§S¿£S´oIS=F}S¿£¼£¨S rp!~¿OSµoIS£¿¢iB~}¿GS¿Y°}}¼¿c=SO¿=O¿Ir££qRO ¿=O¿=~~¿¢¼¢¦R¢ =O¿£°G£¼£¦R¢¿£i>}¿GR¿OR£¦=¦SO¿¦¿GS¿]°}}¼¿S?¦r=} rsn7iS¿I¦=I¦¿°¢¦¿rI °OS¿=}}¿´S¦oS¿I£¦¢¿SIT£¢=¼¿¦¿=II}o£i =¼¿¢j°¨O·¢¿O°rd¿Ro¦iR¿¦iS¿k~oO@¼¿I ¢°S¿¿´S¿·SS|RO¢ 8iS¿#o¦¼¿·o}}¿´rOR¿SIi=oI=~¿1&)¿}=£¿=O¿R°tR¦¿£IiSO°~R¢¿X¿¦iR¿R¹r¢§re¿S§k°£R¿ ,;"#¿¢¼¢¦S¿=¢¿·S}~¿=£¿2'*¿_ ¿}A£¿X¿§iS¿=S=£¿¨iB¦¿·r~~¿S°oS¿¾S¿}S´S~¿I¦}£¿ R¦Zo¦¿ " ! % % % % % % %% % %% % $ %% % #% % $ % % % %" % % %#% % %! % % %% % % % % $ % 9kS¿FuO¿OI°R¨£¿oI°OR¿=¿R°nRR¨¿¨¿}r¢¦¿¦iSR¿ ¿S[RRIR¿£o¦R£¿·kRS¿¦iS¿I¦=I©¿ iC¢¿=¿ro°¿\¿¨iRS¿¼R=¢¿S¹SoRIS¿¢°¨od¿¦iR¿£RIn]rRP¿R·¿I¦~¿¢¼£¦R¿=O¿¦¸¿ S]RRIR¿¢o¦R¢¿·iRS¿¦iR¿I¦=Iª¿i=£¿=¿or°¿]¿¦iSS¿¼S=¢¿R¹RnUJS¿¢°¦rc ¦kS¿S¹o£¦od¿£¼£¦S¿+=o±R¿¦¿´rOR¿«lS¿o]=¦r¿¦RO¿=F´R¿·v}}¿S£°~¦¿r¿¬iR¿£=~ GSrf¿I¤oOSSO¿ S££o´R #¦=K¨£¿·o£iod¿¨¿¢°Gn¦¿=¿£=}¿£i=}~¿GR¿=FS¿¦¿OV¢¨=¦R¿=~~¿¦iR¿]~·rd ¿ /ro°¿¿¼R>¢¿o¿G°¢rS¢¢¿°OR¿¦iS¿¢=S¿BS ¿I¨o°²£¼ o¢¦=}}rd¿¦iR¿¢SIo]oSO¿I¦}¿£¼£¦S (´rOSIS¿]¿]°~~¿oi°£S¿I==Fo}r¦¼¿`¿SdoSRrd¿rI}°Ord¿=¦¿~R=£¿R RIl=rI=~¿SgrRR¿~rIR¢RO¿G¼¿¦iR¿£§?¨S¿]¿#=}o]r= ¿RcrSRSO O =·rd¥¿d¡=rd¿Ir££rrd ¿=O¿¢R¶oIR¿£³¦ $£¦°I¦w¿=O¿SIO¿O=·od¢¿·r}~¿HR=¿¦jS¿¢¦=¿^¿=¿ScrSS S~¼RO¿G¼¿¦iR¿£°IIR££]³}¼¿=·=ORO¿L¦=I¦ 0°~¦o3¦I~¿5¼£¦R¿.¦Sh=¦¿%R¦r]oI=¦r " " 4´xOS¿¦iRR¿ ¿R]SRMS¿r¢¦=?®o£¿°¦r~y½xd¿¦kS¿£SIn]rSQ¿°}¦r¦I¿I¦£¿·z¯i¿ d=irID}~¼¿Or´W¿·SGFE¢SO¿°£R¿r¦Ra=IR¢¿6{¨R¿~I=¦o£¿=O¿I¦=I¨¿R¢¿·n¦i¿¨R}RmS¿ °FS¿°£¦¿GS¿~o¢¦SO¿ ¿6r¦S ¿ "" " " !" "" Western Allied Corporation Page 211 of 221 . . Item 10 Page 211 of 221 6#¸ 9$¸ Hce;¸ Wwk<¸ Hce<¸ Wxk=¸ Hce>¸R¸¸ ¸fL+¸.¸¸n¸B¸ ¸ §¨©¸ , ¸ -X ¸ ª | Y K « ¸ Fb¬%¤p¦¸TO¸ a r ¸ o G®1¯ C¸°}¸ ] ¸ J¸D[¸0¸ ¸ ¸ E ± ¸ ^ ¸ Z * _ ¸ y : ¸ U zik¸¡¸6¸lqkek¸{c~cx¸ww£ws¸tk¸k¢xxs¸\ck¸e¸c¸jkewdki¸cd k&¸¥`M¸²¸ Wxk¸ecx¸ci¸ece¸k¸¡wu¸kkuk¸dk¸¸dk¸wki'¸³"h)¸ 3#¸ Wwk?¸N!v¸´¸Sm¸QVµ¶ ¸ ·¸5g/¸AP4I¸ Hce@¸ 7(¸Wzk?¸ Hce<¸ " "" !" "" Western Allied Corporation Page 212 of 221 . . Item 10 Page 212 of 221 1'/1! *! %1 1 #! (, 1 % ! ' 1-(1( 1 1 * '%1 ( 1( 1 (! ( "%1 $ 1( 1 ( 1 ! (1 1 + 1 1%(1 1( 1 1 * '1 !1- 1 ( 1 '" %1-1 1 ! , 1 * "1' 1 (" ( !%1 ! & 1 1 (! ( !1% 1 ( 1( !1*1 1 -'1( 1-!() 1 % ( 1 1% 1 ! 1 ( 1 !1' 1 , !% 1 1' 10 1. 1 . %1! 1( 1 .%( 1 * ( 1' 1 (1 (1 1 1 1 1 ( 1 (! 1% 1 1 . 1 1 ( 1 1 ( ( 1 ! (1( 1% 1 & 1 1 * 1 Western Allied Corporation Page 213 of 221 . . Item 10 Page 213 of 221 Western Allied Corporation Page 214 of 221 . . Item 10 Page 214 of 221 Western Allied Corporation Page 215 of 221 . . Item 10 Page 215 of 221 Western Allied Corporation Page 216 of 221 . . Item 10 Page 216 of 221 Western Allied Corporation Page 217 of 221. . Item 10 Page 217 of 221 Western Allied Corporation Page 218 of 221. . Item 10 Page 218 of 221 Western Allied Corporation Page 219 of 221. . Item 10 Page 219 of 221 Western Allied Corporation Page 220 of 221. . Item 10 Page 220 of 221 Western Allied Corporation Page 221 of 221. . Item 10 Page 221 of 221 City Council Agenda Report Meeting Date:March 19, 2024 From:Yonnie Parker, Deputy City Clerk Department:City Clerk Submitted by:Sandra Dolson, Administrative Secretary Subject City Council Appointments to Outside Agencies Recommendation Appoint the City’s representative and alternate to the Gateway Cities Council of Governments. Background The Gateway Cities COG engages in regional and cooperative planning and coordination of government services and responsibilities to assist its members in the conduct of their affairs for the collective benefit of cities in the Southeast Los Angeles County area and focuses on transportation, air quality, housing, and economic development. The Gateway Cities COG meets on the 1st Wednesday of every month at 6:00 p.m. in Paramount, CA. Appointees serve as voting members and receive a $125 stipend for participation on the Board. Appointments are made by action of the City Council. On June 6, 2023, the City Council made appointments to outside agencies, including the Gateway Cities Council of Governments (Gateway Cities COG). Council Member Ybarra is the current representative yet no longer able to serve, and Council Member Lopez is the current alternate. At the March 5, 2024, Regular Meeting, City Council tabled appointments to the Gateway Cities Council of Governments to the March 19, 2024 Regular City Council Meeting. It is recommended that City Council appoint a delegate and alternate, if necessary, to serve as the City’s representatives to the Gateway Cities COG. Fiscal Impact There is no fiscal impact associated with this report. Attachments None. . . Item 11 Page 1 of 1 City Council Agenda Report Meeting Date:March 19, 2024 From:Michael Earl, Director of Human Resources Department:Human Resources Submitted by:Michael Earl, Director of Human Resources Subject Appointment of Deborah A. Harrington as Interim City Clerk Recommendation Adopt Resolution No. 2024-03 appointing Deborah A. Harrington to serve as Interim City Clerk of the City of Vernon and approving and authorizing the execution of a related at-will employment agreement. Background Due to the current unavailability of the City Clerk, and in light of pressing matters related to the City Clerk Department, it is recommended that the City appoint an individual on a limited duration temporary basis to perform special project work and provide extra help in support of the City Clerk Department functions. Under Government Code sections 7522.56, 21224,21227, and 21229, the California Public Employees Retirement System (CalPERS) allows contracting agencies to appoint CalPERS retired individuals to fill extra help positions, subject to certain restrictions. With more than forty years of experience working in the public sector municipal clerk field, and certification as a Master Municipal Clerk, Deborah Harrington possesses the desired breadth of experience and specialized skills needed to perform the work. Ms. Harrington has previously assisted with special projects and held interim assignments with other public agencies including, but not limited to, the San Diego Airport Authority and the cities of Murrieta, Ventura, Grand Terrace, and Canyon Lake. Ms. Harrington also previously served as Interim City Clerk for the City of Vernon. Ms. Harrington attended the University of San Francisco and is certified as a Master Municipal Clerk by the International Institute of Municipal Clerks. Ms. Harrington will be appointed into a retired annuitant position as Interim City Clerk and will be compensated at an hourly rate of approximately $108.08 per hour consistent with the City of Vernon’s publicly available salary schedule. The temporary at-will employment agreement between the City of Vernon and Ms. Harrington has been reviewed and approved as to form by the City Attorney’s Office. It is attached as Exhibit A of the resolution. At the regular City Council meeting of March 19, 2024, prior to taking final action to approve the attached resolution, the City Council will receive an oral report summarizing the recommended appointment and compensation, in accordance with Government Code Section54953(c)(3). Fiscal Impact The fiscal impact is estimated at $54,040. Sufficient funds are available in the General Fund, City Clerk Department, Salaries Account No. 011-010-125-501010 for the current fiscal year. If needed, additional funds will be budgeted in the 2024-2025 fiscal year budget. . . Item 12 Page 1 of 2 Attachments 1. Resolution 2024-03 . . Item 12 Page 2 of 2 RESOLUTION NO. 2024-03 A RESOLUTION OF THE CITY COUNCIL OF THE CITY OF VERNON APPOINTING DEBORAH A. HARRINGTON TO SERVE AS INTERIM CITY CLERK OF THE CITY OF VERNON AND APPROVING AND AUTHORIZING THE EXECUTION OF A RELATED TEMPORARY AT- WILL EMPLOYMENT AGREEMENT SECTION 1. Recitals. A. Due to the current unavailability of the City Clerk, there is a need for the appointment of a temporary employee for a limited duration to perform extra help and special project work. B. The City Clerk Department requires someone with specific skills and experience to provide oversight and complete special project work in the areas of municipal records, elections, and regulatory compliance issues. C. Deborah A. Harrington (Harrington) possesses the specialized skills needed to perform the required duties because of her many years of experience in the field and has previously served as Interim City Clerk for the City of Vernon. D. Harrington will be paid within the published salary range for the City Clerk position. E. The City Council of the City of Vernon desires to appoint Harrington to serve as Interim City Clerk on a limited duration temporary basis, effective March 19, 2024. F. At its regular meeting on March 19, 2024, prior to taking final action to approve this resolution, the City Council received an oral report summarizing the recommended appointment and compensation, in accordance with Government Code Section 54953(c)(3). NOW, THEREFORE, BE IT RESOLVED BY THE CITY COUNCIL OF THE CITY OF VERNON AS FOLLOWS: SECTION 2. The City Council of the City of Vernon finds and determines that the above recitals are true and correct. SECTION 3. The City Council of the City of Vernon hereby appoints Deborah A. Harrington to serve as Interim City Clerk of the City Clerk Department of the City of Vernon effective March 19, 2024. SECTION 4. The City Council of the City of Vernon hereby approves and authorizes the execution of the Temporary At-Will Employment Agreement with Deborah A. Harrington to serve as Interim City Clerk of the City of Vernon, in substantially the same . . Item 12 Page 1 of 10 Resolution No. 2024-03 Page 2 of 10 _______________________ form as attached hereto as Exhibit A. SECTION 5. The Deputy City Clerk, or any authorized officer, shall administer the Oath of Office prescribed in the Constitution of the State of California to Harrington and shall have her subscribe to it and file it with the Human Resources Department. SECTION 6. The City Council of the City of Vernon hereby directs the Deputy City Clerk to give a fully executed Agreement to Harrington. SECTION 7. The Deputy City Clerk shall certify the passage and adoption of this resolution and enter it into the book of original resolutions. APPROVED AND ADOPTED March 19, 2024. ________________________ CRYSTAL LARIOS, Mayor ATTEST: YONNIE PARKER, Deputy City Clerk (seal) APPROVED AS TO FORM: ZAYNAH N. MOUSSA, City Attorney . . Item 12 Page 2 of 10 Exhibit A Resolution No. 2024-03 Page 3 of 10 ___________________ . . Item 12 Page 3 of 10 Resolution No. 2024-03 Page 4 of 10 ___________________ . . Item 12 Page 4 of 10 Resolution No. 2024-03 Page 5 of 10 ___________________ . . Item 12 Page 5 of 10 Resolution No. 2024-03 Page 6 of 10 ___________________ . . Item 12 Page 6 of 10 Resolution No. 2024-03 Page 7 of 10 ___________________ . . Item 12 Page 7 of 10 City Clerk Vernon CA 1 of 3 JOB DESCRIPTION City Clerk Date Prepared: March 2014 Class Code: 1310 SUMMARY: Under general direction of the City Administrator, to plan, direct, supervise, and coordinate all activities of the City Clerk’s Office relating to Council meetings, City elections, and public records in accordance with applicable laws, codes, policies, and procedures, and to do related work as required. ESSENTIAL FUNCTIONS: -- Essential functions, as defined under the Americans with Disabilities Act, may include any of the following representative duties, knowledge, and skills. This is not a comprehensive listing of all functions and duties performed by incumbents of this class; employees may be assigned duties which are not listed below; reasonable accommodations will be made as required. The job description does not constitute an employment agreement and is subject to change at any time by the employer. Essential duties and responsibilities may include, but are not limited to, the following: Serve as Clerk to the City Council. Coordinate the preparation of Council agendas and supporting material including public notification, technical and legal documents; attend agenda conference; publish, issue, and post final agenda. Direct the preparation, publication, distribution, filing, indexing, and safekeeping of Council proceedings, minutes, and actions. Plan and direct the processing of ordinances, resolutions, bond issues, annexations, vacations, assessments, charter amendments, initiatives, referendum, recall petitions, and other related documents. Maintain the City Municipal Code; certify City documents; attest to proper execution of all public documents. Serve as the custodian of the City Seal, official City records, and official municipal documents; plan and direct the City’s records retention/preservation program in compliance with legal requirements and City policy. Oversee the processing of all appointments, resignations, and terminations for all official boards, commissions, and committees; administer oaths and affirmations. Plan and direct municipal elections including managing the dissemination, and return of ballots and the filing of all required technical documents; oversee and/or perform notary public duties. Serve as filing officer and official for state and local campaign statements and conflict of interest codes of the City Council advisory bodies and all designated employees under the Political Reform Act. Receive and process petitions, claims against the City, and lawsuits. Analyze, review, and make recommendations regarding office procedures. Prepare, administer, and control department budget. Coordinate City Clerk activities with other City departments, divisions, and with outside agencies. Verifies official City activities are in compliance with federal and state laws and regulations, and City policies; works independently and makes appropriate decisions based on knowledge of City policies; performs duties within scope of authority. Attachment A Resolution No. 2024-03 Page 8 of 10 ___________________ . . Item 12 Page 8 of 10 City Clerk Vernon CA 2 of 3 Assures the absolute confidentiality of City's confidential records and information. Assures that security protocols are followed, and all reports and paperwork are completed in a timely manner; updates, corrects, retrieves, and releases information according to procedures. Supports the relationship between the City of Vernon and the general public by demonstrating courteous and cooperative behavior when interacting with visitors and City staff; maintains confidentiality of work-related issues and City information; performs other duties as required or assigned. MINIMUM QUALIFICATIONS: Education, Training and Experience Guidelines: Bachelor’s Degree in Public or Business Administration, or closely related field; AND five years of responsible experience involving the administration of a City Clerk or similar municipality office including at least three years of supervisory experience. Knowledge of: City organization, operations, policies, and procedures. Federal and state laws and statutes governing municipal operations, public records, and open meetings, including California Public Employment Relations Board, the Meyers-Milias-Brown Act, California Public Records Act, California Elections Code, California Political Reform Act and the Federal Voter Rights Act. City ordinances, codes, policies, resolutions, and agreements. Federal and state laws and regulations governing City administration and elections. Parliamentary practices and procedures governing public meetings. Principles and practices of record keeping, records management, and records retention. Principles and practices of confidential records management, and security precautions in the public sector. Legal, ethical and professional rules of conduct for public sector employees and elected officials. Customer service principles, protocols, and methods. Business computers, and standard and specialized software applications. Skill in: Explaining and applying state and Federal rules and regulations and statutory standards. Researching, reviewing, correcting, and maintaining complex and extensive public records. Monitoring the City’s compliance with all laws, regulations, and rules. Assessing and prioritizing multiple tasks, projects and demands. Dealing tactfully and courteously with those seeking information about City functions and activities. Exercising sound, independent judgment within general policy guidelines. Establishing and maintaining effective working relationships with the City Clerk and City Attorney, co-workers, City Council, Mayor, City Administrator, City departments and staff, regional government agencies, and the public. Communicating effectively verbally and in writing. Resolution No. 2024-03 Page 9 of 10 ___________________ . . Item 12 Page 9 of 10 City Clerk Vernon CA 3 of 3 LICENSE AND CERTIFICATION REQUIREMENTS: A valid California State Driver’s License is required. Notary Public license. Certified Municipal Clerk (CMC) Certificate is desirable. PHYSICAL DEMANDS AND WORKING ENVIRONMENT: Work is performed in a standard office environment. Resolution No. 2024-03 Page 10 of 10 ___________________ . . Item 12 Page of